F367465

General Info

Members Datasets Scaffolds Average Seq Length
257 143 503 355

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0197229|Ga0395900_0197229_853_2019
Length 388
Sequence MYMADKAYTVIHFLKLLNMVNSSKLKLVLIYSFLLLAASVIISCDGSNDKSPNDMAKNAGNNEDDNNLLGAGSTFDYPLFSKQFAEYNKITGLKVNYQSIGSGGGILQLTNKTVDFGASDAVLNEEQTAKIGAPVLHIPMCAGAVVISYNLPDVKDTLKLTPDIIANIFLGKIKTWNDPQIAAANAGTKLPNMPMVVAHRSDGSGTTNIFTTYLSKVNAGWNTKPGKGSSINWPIGLGGKGNEGVAGLIKQTPGAIGYIELAYAIQNNMAFAKIQNKSGNFITPSVASTSAASNIQLPADAKVSLTNTEAADGYPISGFSWVLIYKEQNYNNRSQNRAAKLLKLLWWNIHEGQQYNTPLHYAPLSPSAVTVAENILKSATYAGKPLLP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.33
Nodule 0
Rhizoplane 0.39
Rhizosphere 91.83
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0197229 3300037418 Bacteria 2039
2 JGI25162J39368_1000755 3300002737 Bacteria 21942
3 JGI25164J39214_1002370 3300002772 Bacteria 2945
4 JGI25165J46597_1000773 3300003214 Bacteria 24441
5 rootH1_10051068 3300003316 Bacteria 3554
6 rootH1_10051068 3300003323 Bacteria 3370
7 rootH2_10007442 3300003320 Bacteria 19947
8 rootH2_10040873 3300003320 Bacteria 6265
9 rootH1_10005851 3300003323 Bacteria 85811
10 Ga0065712_10112334 3300005290 Bacteria 1744
11 Ga0070658_10005963 3300005327 Bacteria 9881
12 Ga0070658_10029429 3300005327 Bacteria 4412
13 Ga0070658_10236335 3300005327 Unclassified 1548
14 Ga0070658_10266573 3300005327 Unclassified 1456
15 Ga0070676_10003547 3300005328 Bacteria 8161
16 Ga0070683_100188290 3300005329 Bacteria 1959
17 Ga0070683_100192807 3300005329 Bacteria 1935
18 Ga0070666_10003504 3300005335 Bacteria 9511
19 Ga0070680_100021447 3300005336 Bacteria 5134
20 Ga0068868_100002736 3300005338 Bacteria 12218
21 Ga0068868_100040867 3300005338 Bacteria 3611
22 Ga0070660_100003655 3300005339 Bacteria 10620
23 Ga0070660_100038186 3300005339 Bacteria 3644
24 Ga0070661_100016634 3300005344 Bacteria 5203
25 Ga0070668_100006858 3300005347 Bacteria 8445
26 Ga0070673_100000295 3300005364 Bacteria 25910
27 Ga0070673_100223918 3300005364 Bacteria 1629
28 Ga0070659_100079653 3300005366 Bacteria 2615
29 Ga0070659_100406267 3300005366 Bacteria 1150
30 Ga0070667_100001136 3300005367 Bacteria 24244
31 Ga0070663_100006547 3300005455 Bacteria 7019
32 Ga0070678_100011185 3300005456 Bacteria 5525
33 Ga0070662_100061853 3300005457 Bacteria 2734
34 Ga0068867_100127836 3300005459 Bacteria 1971
35 Ga0070679_100009011 3300005530 Bacteria 9413
36 Ga0070679_100180931 3300005530 Bacteria 2080
37 Ga0068853_100020025 3300005539 Bacteria 5559
38 Ga0068853_100216307 3300005539 Bacteria 1748
39 Ga0070672_100000303 3300005543 Bacteria 27811
40 Ga0070665_100001440 3300005548 Bacteria 27902
41 Ga0070665_100002475 3300005548 Bacteria 20360
42 Ga0068855_100000304 3300005563 Bacteria 61250
43 Ga0068855_100026095 3300005563 Bacteria 6989
44 Ga0068855_100091845 3300005563 Bacteria 3501
45 Ga0068855_100165180 3300005563 Bacteria 2510
46 Ga0070664_100210036 3300005564 Unclassified 1739
47 Ga0068857_100028375 3300005577 Bacteria 4939
48 Ga0068854_100023964 3300005578 Bacteria 4173
49 Ga0068854_100217247 3300005578 Unclassified 1511
50 Ga0068856_100004342 3300005614 Bacteria 14127
51 Ga0068856_100016430 3300005614 Bacteria 7161
52 Ga0068856_100023052 3300005614 Bacteria 6054
53 Ga0068856_100055132 3300005614 Bacteria 3923
54 Ga0068852_100000408 3300005616 Bacteria 28653
55 Ga0068852_100012375 3300005616 Bacteria 6477
56 Ga0068864_100001268 3300005618 Bacteria 20970
57 Ga0068861_100012013 3300005719 Bacteria 6032
58 Ga0068851_10000260 3300005834 Bacteria 24877
59 Ga0068863_100000984 3300005841 Bacteria 28612
60 Ga0068858_100022058 3300005842 Bacteria 5946
61 Ga0068860_100007039 3300005843 Bacteria 11262
62 Ga0097621_100006023 3300006237 Bacteria 8572
63 Ga0097621_100038491 3300006237 Bacteria 3838
64 Ga0068871_100044526 3300006358 Bacteria 3570
65 Ga0068865_100003526 3300006881 Bacteria 9383
66 Ga0105240_10000160 3300009093 Bacteria 137390
67 Ga0105240_10000212 3300009093 Bacteria 117609
68 Ga0105240_10000558 3300009093 Bacteria 69072
69 Ga0105240_10002861 3300009093 Bacteria 27285
70 Ga0105240_10061111 3300009093 Bacteria 4695
71 Ga0105240_10074589 3300009093 Bacteria 4187
72 Ga0105240_10163116 3300009093 Bacteria 2645
73 Ga0105240_10301265 3300009093 Bacteria 1834
74 Ga0105240_10452740 3300009093 Bacteria 1436
75 Ga0105247_10006868 3300009101 Bacteria 7013
76 Ga0105241_10020315 3300009174 Bacteria 4907
77 Ga0105242_10006666 3300009176 Bacteria 8908
78 Ga0105248_10033120 3300009177 Bacteria 5772
79 Ga0105237_10000191 3300009545 Bacteria 87065
80 Ga0105237_10001386 3300009545 Bacteria 32014
81 Ga0105237_10002847 3300009545 Bacteria 21034
82 Ga0105237_10025386 3300009545 Bacteria 6061
83 Ga0105237_10037920 3300009545 Bacteria 4869
84 Ga0105237_10084202 3300009545 Bacteria 3171
85 Ga0105238_10058070 3300009551 Bacteria 3879
86 Ga0105238_10151500 3300009551 Unclassified 2294
87 Ga0105249_10004211 3300009553 Bacteria 12433
88 Ga0105239_10000140 3300010375 Bacteria 101896
89 Ga0105239_10000468 3300010375 Bacteria 59019
90 Ga0105239_10004282 3300010375 Bacteria 17118
91 Ga0105239_10055213 3300010375 Bacteria 4356
92 Ga0105239_10059653 3300010375 Bacteria 4187
93 Ga0105239_10072826 3300010375 Bacteria 3778
94 Ga0105239_10187298 3300010375 Bacteria 2316
95 Ga0157373_10013604 3300013100 Bacteria 5969
96 Ga0157373_10020597 3300013100 Bacteria 4791
97 Ga0157373_10073851 3300013100 Unclassified 2406
98 Ga0157373_10124943 3300013100 Bacteria 1809
99 Ga0157371_10006916 3300013102 Bacteria 9255
100 Ga0157371_10012235 3300013102 Bacteria 6570
101 Ga0157371_10045938 3300013102 Unclassified 3107
102 Ga0157371_10079676 3300013102 Bacteria 2320
103 Ga0157370_10004168 3300013104 Bacteria 16727
104 Ga0157370_10027009 3300013104 Bacteria 5662
105 Ga0157370_10192518 3300013104 Unclassified 1893
106 Ga0157370_10241682 3300013104 Bacteria 1670
107 Ga0157370_10286940 3300013104 Unclassified 1520
108 Ga0157369_10016220 3300013105 Bacteria 8384
109 Ga0157369_10016517 3300013105 Bacteria 8299
110 Ga0157369_10036979 3300013105 Bacteria 5348
111 Ga0157369_10133044 3300013105 Bacteria 2634
112 Ga0157369_10151971 3300013105 Bacteria 2447
113 Ga0157374_10000004 3300013296 Bacteria 759774
114 Ga0157374_10000011 3300013296 Bacteria 466749
115 Ga0157374_10001853 3300013296 Bacteria 17784
116 Ga0157374_10082231 3300013296 Bacteria 3057
117 Ga0157374_10097315 3300013296 Bacteria 2816
118 Ga0157378_10083733 3300013297 Bacteria 2887
119 Ga0157378_10200838 3300013297 Bacteria 1886
120 Ga0163162_10000275 3300013306 Bacteria 46947
121 Ga0163162_10001289 3300013306 Bacteria 23440
122 Ga0157372_10000029 3300013307 Bacteria 180371
123 Ga0157372_10002435 3300013307 Bacteria 20157
124 Ga0157372_10005977 3300013307 Bacteria 12934
125 Ga0157372_10010853 3300013307 Bacteria 9696
126 Ga0157372_10013684 3300013307 Bacteria 8671
127 Ga0157372_10023441 3300013307 Bacteria 6691
128 Ga0157372_10031401 3300013307 Bacteria 5816
129 Ga0157372_10037848 3300013307 Bacteria 5323
130 Ga0157372_10039776 3300013307 Bacteria 5191
131 Ga0157372_10100261 3300013307 Bacteria 3305
132 Ga0157372_10111849 3300013307 Bacteria 3129
133 Ga0157372_10221726 3300013307 Bacteria 2192
134 Ga0157372_10269616 3300013307 Bacteria 1978
135 Ga0157375_10000295 3300013308 Bacteria 45219
136 Ga0163163_10000617 3300014325 Bacteria 30764
137 Ga0157377_10101781 3300014745 Unclassified 1713
138 Ga0157379_10001265 3300014968 Bacteria 20546
139 Ga0157376_10000599 3300014969 Bacteria 23288
140 Ga0157376_10002626 3300014969 Bacteria 12226
141 Ga0213876_10002097 3300021384 Bacteria 11796
142 Ga0207427_100025 3300025231 Bacteria 433726
143 Ga0209437_100010 3300025233 Bacteria 838447
144 Ga0209026_1004063 3300025250 Bacteria 4519
145 Ga0209233_1000017 3300025261 Bacteria 898076
146 Ga0207656_10000340 3300025321 Bacteria 15908
147 Ga0207710_10045396 3300025900 Bacteria 1959
148 Ga0207647_10000086 3300025904 Bacteria 71173
149 Ga0207647_10034236 3300025904 Bacteria 3245
150 Ga0207647_10103914 3300025904 Unclassified 1684
151 Ga0207645_10006706 3300025907 Bacteria 8228
152 Ga0207705_10027729 3300025909 Bacteria 4039
153 Ga0207705_10261592 3300025909 Unclassified 1321
154 Ga0207654_10211821 3300025911 Bacteria 1281
155 Ga0207707_10183950 3300025912 Unclassified 1824
156 Ga0207695_10000027 3300025913 Bacteria 612456
157 Ga0207695_10000248 3300025913 Bacteria 140288
158 Ga0207695_10000351 3300025913 Bacteria 105891
159 Ga0207695_10000489 3300025913 Bacteria 84728
160 Ga0207695_10000658 3300025913 Bacteria 68310
161 Ga0207695_10006101 3300025913 Bacteria 15724
162 Ga0207695_10022062 3300025913 Bacteria 7244
163 Ga0207695_10087415 3300025913 Bacteria 3140
164 Ga0207695_10113016 3300025913 Bacteria 2693
165 Ga0207671_10000056 3300025914 Bacteria 186251
166 Ga0207671_10004052 3300025914 Bacteria 14208
167 Ga0207671_10006834 3300025914 Bacteria 10071
168 Ga0207671_10087826 3300025914 Bacteria 2338
169 Ga0207660_10112128 3300025917 Bacteria 2054
170 Ga0207657_10017919 3300025919 Bacteria 6776
171 Ga0207652_10004275 3300025921 Bacteria 11651
172 Ga0207694_10099028 3300025924 Bacteria 2309
173 Ga0207694_10106612 3300025924 Bacteria 2226
174 Ga0207690_10181927 3300025932 Unclassified 1583
175 Ga0207706_10050774 3300025933 Bacteria 3664
176 Ga0207686_10061159 3300025934 Bacteria 2387
177 Ga0207704_10002104 3300025938 Bacteria 8925
178 Ga0207691_10000372 3300025940 Bacteria 45068
179 Ga0207661_10159263 3300025944 Bacteria 1957
180 Ga0207661_10185999 3300025944 Bacteria 1818
181 Ga0207667_10004109 3300025949 Bacteria 17883
182 Ga0207667_10036329 3300025949 Bacteria 5280
183 Ga0207667_10064280 3300025949 Bacteria 3832
184 Ga0207667_10143483 3300025949 Bacteria 2458
185 Ga0207651_10000904 3300025960 Bacteria 13056
186 Ga0207712_10237547 3300025961 Bacteria 1466
187 Ga0207668_10002254 3300025972 Bacteria 11245
188 Ga0207640_10033029 3300025981 Bacteria 3215
189 Ga0207658_10001190 3300025986 Bacteria 20757
190 Ga0207677_10005349 3300026023 Bacteria 6963
191 Ga0207703_10004061 3300026035 Bacteria 12086
192 Ga0207639_10055647 3300026041 Bacteria 3029
193 Ga0207639_10185802 3300026041 Bacteria 1772
194 Ga0207678_10136315 3300026067 Bacteria 2094
195 Ga0207702_10000165 3300026078 Bacteria 79066
196 Ga0207702_10046554 3300026078 Bacteria 3652
197 Ga0207702_10096532 3300026078 Bacteria 2600
198 Ga0207702_10296815 3300026078 Unclassified 1532
199 Ga0207641_10002655 3300026088 Bacteria 16350
200 Ga0207648_10019764 3300026089 Bacteria 6078
201 Ga0207676_10035962 3300026095 Bacteria 3764
202 Ga0207674_10027681 3300026116 Bacteria 5992
203 Ga0207698_10036938 3300026142 Bacteria 3592
204 Ga0207698_10267181 3300026142 Bacteria 1575
205 Ga0268266_10000981 3300028379 Bacteria 36054
206 Ga0268266_10014574 3300028379 Bacteria 6755
207 Ga0268264_10019104 3300028381 Bacteria 5603
208 Ga0265319_1033509 3300028563 Bacteria 1773
209 Ga0265336_10016214 3300028666 Bacteria 2439
210 Ga0307517_10143427 3300028786 Unclassified 1667
211 Ga0307511_10000104 3300030521 Bacteria 75069
212 Ga0307511_10001310 3300030521 Bacteria 26417
213 Ga0265320_10003598 3300031240 Bacteria 10362
214 Ga0265327_10000115 3300031251 Bacteria 173854
215 Ga0265327_10000697 3300031251 Bacteria 53480
216 Ga0265327_10010512 3300031251 Bacteria 6498
217 Ga0265327_10036352 3300031251 Bacteria 2708
218 Ga0307509_10055143 3300031507 Bacteria 4226
219 Ga0265313_10048060 3300031595 Bacteria 2062
220 Ga0265314_10030751 3300031711 Bacteria 3971
221 Ga0307416_100068652 3300032002 Bacteria 2930
222 Ga0307510_10003535 3300033180 Bacteria 18226
223 Ga0373937_0206181 3300036401 Bacteria 1849
224 Ga0373937_0383242 3300036401 Bacteria 1333
225 Ga0395899_0000024 3300037312 Bacteria 357402
226 Ga0395901_0422447 3300038443 Unclassified 1367
227 Ga0400483_135928 3300039062 Bacteria 2463
228 Ga0400483_163197 3300039062 Bacteria 3641
229 Ga0436365_0574791 3300039437 Bacteria 6561
230 Ga0439449_0023732 3300042007 Bacteria 2294
231 Ga0439449_0095872 3300042007 Bacteria 1096
232 Ga0466969_0099766 3300044656 Bacteria 1368
233 Ga0466961_0007843 3300044693 Bacteria 6799
234 Ga0466964_0038557 3300044706 Bacteria 1922
235 Ga0466971_0050567 3300044719 Bacteria 1870
236 Ga0466959_0062976 3300045049 Bacteria 2694
237 Ga0466958_0064540 3300045836 Bacteria 2234
238 Ga0466958_0168599 3300045836 Bacteria 1386
239 Ga0495611_0000592 3300046648 Bacteria 20920
240 Ga0495649_0059113 3300046694 Bacteria 2064
241 Ga0495686_0000005 3300047472 Bacteria 827143
242 Ga0495686_0000373 3300047472 Bacteria 71977
243 Ga0496109_0098370 3300048912 Bacteria 2712
244 Ga0501032_0103564 3300049569 Bacteria 1886
245 Ga0501036_0188574 3300049572 Bacteria 1735
246 Ga0501037_0022589 3300049573 Bacteria 4652
247 Ga0501038_0035952 3300049574 Bacteria 4347
248 Ga0501039_0016736 3300049575 Bacteria 5618
249 Ga0501080_0112064 3300049742 Bacteria 2529
250 Ga0501035_0161212 3300049822 Bacteria 1941
251 Ga0501044_0045057 3300049823 Bacteria 4574
252 Ga0466962_0028051 3300061719 Bacteria 2699
253 Ga0395900_0197229
254 JGI25162J39368_1000755
255 JGI25164J39214_1002370
256 JGI25165J46597_1000773
257 rootH1_10051068
258 rootH2_10007442
259 rootH2_10040873
260 rootH1_10005851
261 Ga0065712_10112334
262 Ga0070658_10005963
263 Ga0070658_10029429
264 Ga0070658_10236335
265 Ga0070658_10266573
266 Ga0070676_10003547
267 Ga0070683_100188290
268 Ga0070683_100192807
269 Ga0070666_10003504
270 Ga0070680_100021447
271 Ga0068868_100002736
272 Ga0068868_100040867
273 Ga0070660_100003655
274 Ga0070660_100038186
275 Ga0070661_100016634
276 Ga0070668_100006858
277 Ga0070673_100000295
278 Ga0070673_100223918
279 Ga0070659_100079653
280 Ga0070659_100406267
281 Ga0070667_100001136
282 Ga0070663_100006547
283 Ga0070678_100011185
284 Ga0070662_100061853
285 Ga0068867_100127836
286 Ga0070679_100009011
287 Ga0070679_100180931
288 Ga0068853_100020025
289 Ga0068853_100216307
290 Ga0070672_100000303
291 Ga0070665_100001440
292 Ga0070665_100002475
293 Ga0068855_100000304
294 Ga0068855_100026095
295 Ga0068855_100091845
296 Ga0068855_100165180
297 Ga0070664_100210036
298 Ga0068857_100028375
299 Ga0068854_100023964
300 Ga0068854_100217247
301 Ga0068856_100004342
302 Ga0068856_100016430
303 Ga0068856_100023052
304 Ga0068856_100055132
305 Ga0068852_100000408
306 Ga0068852_100012375
307 Ga0068864_100001268
308 Ga0068861_100012013
309 Ga0068851_10000260
310 Ga0068863_100000984
311 Ga0068858_100022058
312 Ga0068860_100007039
313 Ga0097621_100006023
314 Ga0097621_100038491
315 Ga0068871_100044526
316 Ga0068865_100003526
317 Ga0105240_10000160
318 Ga0105240_10000212
319 Ga0105240_10000558
320 Ga0105240_10002861
321 Ga0105240_10061111
322 Ga0105240_10074589
323 Ga0105240_10163116
324 Ga0105240_10301265
325 Ga0105240_10452740
326 Ga0105247_10006868
327 Ga0105241_10020315
328 Ga0105242_10006666
329 Ga0105248_10033120
330 Ga0105237_10000191
331 Ga0105237_10001386
332 Ga0105237_10002847
333 Ga0105237_10025386
334 Ga0105237_10037920
335 Ga0105237_10084202
336 Ga0105238_10058070
337 Ga0105238_10151500
338 Ga0105249_10004211
339 Ga0105239_10000140
340 Ga0105239_10000468
341 Ga0105239_10004282
342 Ga0105239_10055213
343 Ga0105239_10059653
344 Ga0105239_10072826
345 Ga0105239_10187298
346 Ga0157373_10013604
347 Ga0157373_10020597
348 Ga0157373_10073851
349 Ga0157373_10124943
350 Ga0157371_10006916
351 Ga0157371_10012235
352 Ga0157371_10045938
353 Ga0157371_10079676
354 Ga0157370_10004168
355 Ga0157370_10027009
356 Ga0157370_10192518
357 Ga0157370_10241682
358 Ga0157370_10286940
359 Ga0157369_10016220
360 Ga0157369_10016517
361 Ga0157369_10036979
362 Ga0157369_10133044
363 Ga0157369_10151971
364 Ga0157374_10000004
365 Ga0157374_10000011
366 Ga0157374_10001853
367 Ga0157374_10082231
368 Ga0157374_10097315
369 Ga0157378_10083733
370 Ga0157378_10200838
371 Ga0163162_10000275
372 Ga0163162_10001289
373 Ga0157372_10000029
374 Ga0157372_10002435
375 Ga0157372_10005977
376 Ga0157372_10010853
377 Ga0157372_10013684
378 Ga0157372_10023441
379 Ga0157372_10031401
380 Ga0157372_10037848
381 Ga0157372_10039776
382 Ga0157372_10100261
383 Ga0157372_10111849
384 Ga0157372_10221726
385 Ga0157372_10269616
386 Ga0157375_10000295
387 Ga0163163_10000617
388 Ga0157377_10101781
389 Ga0157379_10001265
390 Ga0157376_10000599
391 Ga0157376_10002626
392 Ga0213876_10002097
393 Ga0207427_100025
394 Ga0209437_100010
395 Ga0209026_1004063
396 Ga0209233_1000017
397 Ga0207656_10000340
398 Ga0207710_10045396
399 Ga0207647_10000086
400 Ga0207647_10034236
401 Ga0207647_10103914
402 Ga0207645_10006706
403 Ga0207705_10027729
404 Ga0207705_10261592
405 Ga0207654_10211821
406 Ga0207707_10183950
407 Ga0207695_10000027
408 Ga0207695_10000248
409 Ga0207695_10000351
410 Ga0207695_10000489
411 Ga0207695_10000658
412 Ga0207695_10006101
413 Ga0207695_10022062
414 Ga0207695_10087415
415 Ga0207695_10113016
416 Ga0207671_10000056
417 Ga0207671_10004052
418 Ga0207671_10006834
419 Ga0207671_10087826
420 Ga0207660_10112128
421 Ga0207657_10017919
422 Ga0207652_10004275
423 Ga0207694_10099028
424 Ga0207694_10106612
425 Ga0207690_10181927
426 Ga0207706_10050774
427 Ga0207686_10061159
428 Ga0207704_10002104
429 Ga0207691_10000372
430 Ga0207661_10159263
431 Ga0207661_10185999
432 Ga0207667_10004109
433 Ga0207667_10036329
434 Ga0207667_10064280
435 Ga0207667_10143483
436 Ga0207651_10000904
437 Ga0207712_10237547
438 Ga0207668_10002254
439 Ga0207640_10033029
440 Ga0207658_10001190
441 Ga0207677_10005349
442 Ga0207703_10004061
443 Ga0207639_10055647
444 Ga0207639_10185802
445 Ga0207678_10136315
446 Ga0207702_10000165
447 Ga0207702_10046554
448 Ga0207702_10096532
449 Ga0207702_10296815
450 Ga0207641_10002655
451 Ga0207648_10019764
452 Ga0207676_10035962
453 Ga0207674_10027681
454 Ga0207698_10036938
455 Ga0207698_10267181
456 Ga0268266_10000981
457 Ga0268266_10014574
458 Ga0268264_10019104
459 Ga0265319_1033509
460 Ga0265336_10016214
461 Ga0307517_10143427
462 Ga0307511_10000104
463 Ga0307511_10001310
464 Ga0265320_10003598
465 Ga0265327_10000115
466 Ga0265327_10000697
467 Ga0265327_10010512
468 Ga0265327_10036352
469 Ga0307509_10055143
470 Ga0265313_10048060
471 Ga0265314_10030751
472 Ga0307416_100068652
473 Ga0307510_10003535
474 Ga0373937_0206181
475 Ga0373937_0383242
476 Ga0395899_0000024
477 Ga0395901_0422447
478 Ga0400483_135928
479 Ga0400483_163197
480 Ga0436365_0574791
481 Ga0439449_0023732
482 Ga0439449_0095872
483 Ga0466969_0099766
484 Ga0466961_0007843
485 Ga0466964_0038557
486 Ga0466971_0050567
487 Ga0466959_0062976
488 Ga0466958_0064540
489 Ga0466958_0168599
490 Ga0495611_0000592
491 Ga0495649_0059113
492 Ga0495686_0000005
493 Ga0495686_0000373
494 Ga0496109_0098370
495 Ga0501032_0103564
496 Ga0501036_0188574
497 Ga0501037_0022589
498 Ga0501038_0035952
499 Ga0501039_0016736
500 Ga0501080_0112064
501 Ga0501035_0161212
502 Ga0501044_0045057
503 Ga0466962_0028051

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

66

345

0.82

PF12849

PBP_like_2

PBP superfamily domain

57

344

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pbp-assembly1.cif.gz_A fine tuning of the specificity of the periplasmic phosphate transport receptor: site-directed mutagenesis, ligand binding, and crystallographic studies 0.9442 47 366
1quk-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by asn complex with phosphate 0.9429 47 366
2z22-assembly2.cif.gz_A crystal structure of phosphate preplasmic binding protein psts from yersinia pestis 0.9422 47 367
1quj-assembly1.cif.gz_A phosphate-binding protein mutant with asp 137 replaced by gly complex with chlorine and phosphate 0.9419 47 366
1a40-assembly1.cif.gz_A phosphate-binding protein with ala 197 replaced with trp 0.9414 47 366
ID Description Score Start End Superfamily
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9759 125 296 3.40.190.10
af_P0AG82_103_278_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9487 125 296 3.40.190.10
af_Q58421_135_323_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9361 126 296 3.40.190.10
1pc3B02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9361 124 296 3.40.190.10
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9358 47 112 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4S1FX25-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9976 136 239
AF-A0A7V5NY69-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9951 136 368 GO:0035435
GO:0042301
GO:0043190
AF-A0A7C0Y7T5-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9905 214 368
AF-T1ADT3-F1-model_v4 Phosphate ABC transporter, periplasmic phosphate-binding protein 0.9874 154 267
AF-A0A398D3F1-F1-model_v4 Phosphate ABC transporter substrate-binding protein PstS 0.9871 46 366 GO:0035435
GO:0042301
GO:0043190

Map