F367303
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 257 | 171 | 254 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10489052|Ga0157378_104890521 |
| Length | 222 |
| Sequence | MEQDILTEKLLDKISEDHFSSSLDTPMHEDAFALTDIQKIKIIAEHFRHIMHTLGLDLTDDSLKDTPLHVAKMYVKEVFSGLNPANKPEPALFENKYRYNEMLIEKDITLYSYCEHHFVPIIGKVHVAYFSSNDKVIGLSKINRLVQYYAKRPQVQERLTNQIAKGLKEALNTEHVAVIVDAVHLCVASRGIKDTNSSTITAYYSGRFNEESTKAEFLSLIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 2 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 108 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 109 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 110 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 111 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 118 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 120 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 136 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 150 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 151 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 152 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 153 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 154 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 155 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 156 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 157 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 158 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 159 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 160 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 163 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 164 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 165 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 166 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 167 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 168 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 169 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.5 |
| Metatranscriptomes | 1.95 |
| Isolates | 1.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.89 |
| Nodule | 0 |
| Rhizoplane | 0.78 |
| Rhizosphere | 88.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10106547 | 3300003316 | Unclassified | 1549 |
| 2 | rootH2_10069883 | 3300003320 | Bacteria | 1993 |
| 3 | rootL2_10019553 | 3300003322 | Bacteria | 6508 |
| 4 | rootL2_10039177 | 3300003322 | Bacteria | 5785 |
| 5 | rootL2_10380535 | 3300003322 | Bacteria | 1775 |
| 6 | rootH1_10008322 | 3300003323 | Bacteria | 11667 |
| 7 | rootH1_10012411 | 3300003316 | Bacteria | 9835 |
| 8 | rootH1_10012411 | 3300003323 | Bacteria | 38987 |
| 9 | rootH1_10129844 | 3300003323 | Unclassified | 1847 |
| 10 | rootH1_10157523 | 3300003323 | Bacteria | 4490 |
| 11 | Ga0055531_10000087 | 3300003794 | Bacteria | 101553 |
| 12 | Ga0065704_10276510 | 3300005289 | Bacteria | 931 |
| 13 | Ga0065712_10001612 | 3300005290 | Bacteria | 6881 |
| 14 | Ga0065715_10091790 | 3300005293 | Bacteria | 5549 |
| 15 | Ga0070658_10770158 | 3300005327 | Bacteria | 836 |
| 16 | Ga0070658_10778372 | 3300005327 | Bacteria | 831 |
| 17 | Ga0070670_100372633 | 3300005331 | Unclassified | 1257 |
| 18 | Ga0068869_100013184 | 3300005334 | Bacteria | 5491 |
| 19 | Ga0068869_100115616 | 3300005334 | Bacteria | 2046 |
| 20 | Ga0070680_100051620 | 3300005336 | Bacteria | 3355 |
| 21 | Ga0070682_100000018 | 3300005337 | Bacteria | 229427 |
| 22 | Ga0070660_100283646 | 3300005339 | Bacteria | 1355 |
| 23 | Ga0070660_100412863 | 3300005339 | Unclassified | 1117 |
| 24 | Ga0070691_10014712 | 3300005341 | Unclassified | 3591 |
| 25 | Ga0070687_100277994 | 3300005343 | Bacteria | 1053 |
| 26 | Ga0070669_100020504 | 3300005353 | Bacteria | 4721 |
| 27 | Ga0070675_100075885 | 3300005354 | Bacteria | 2795 |
| 28 | Ga0070675_100107980 | 3300005354 | Bacteria | 2350 |
| 29 | Ga0070688_100002899 | 3300005365 | Bacteria | 8746 |
| 30 | Ga0070688_100294046 | 3300005365 | Bacteria | 1172 |
| 31 | Ga0070659_100034273 | 3300005366 | Bacteria | 3948 |
| 32 | Ga0070659_100558627 | 3300005366 | Unclassified | 980 |
| 33 | Ga0070701_10057256 | 3300005438 | Unclassified | 2042 |
| 34 | Ga0070681_10757757 | 3300005458 | Unclassified | 887 |
| 35 | Ga0068867_100262049 | 3300005459 | Bacteria | 1410 |
| 36 | Ga0070685_10004800 | 3300005466 | Bacteria | 6844 |
| 37 | Ga0070685_10007831 | 3300005466 | Bacteria | 5469 |
| 38 | Ga0070679_100121956 | 3300005530 | Bacteria | 2591 |
| 39 | Ga0070679_100590447 | 3300005530 | Bacteria | 1054 |
| 40 | Ga0070697_100129915 | 3300005536 | Bacteria | 2112 |
| 41 | Ga0068853_100495557 | 3300005539 | Bacteria | 1153 |
| 42 | Ga0070672_100458424 | 3300005543 | Bacteria | 1099 |
| 43 | Ga0070686_100125411 | 3300005544 | Bacteria | 1768 |
| 44 | Ga0070693_100019417 | 3300005547 | Unclassified | 3562 |
| 45 | Ga0070704_100049577 | 3300005549 | Unclassified | 2947 |
| 46 | Ga0068855_100039739 | 3300005563 | Bacteria | 5585 |
| 47 | Ga0068855_100130744 | 3300005563 | Bacteria | 2867 |
| 48 | Ga0068855_100287144 | 3300005563 | Bacteria | 1825 |
| 49 | Ga0068855_100303391 | 3300005563 | Bacteria | 1768 |
| 50 | Ga0068857_100107148 | 3300005577 | Bacteria | 2510 |
| 51 | Ga0068857_100131761 | 3300005577 | Bacteria | 2255 |
| 52 | Ga0068857_100171285 | 3300005577 | Bacteria | 1974 |
| 53 | Ga0068857_100241182 | 3300005577 | Bacteria | 1655 |
| 54 | Ga0068859_100021816 | 3300005617 | Bacteria | 6422 |
| 55 | Ga0068859_100173027 | 3300005617 | Bacteria | 2241 |
| 56 | Ga0068864_100058532 | 3300005618 | Bacteria | 3331 |
| 57 | Ga0068864_100111010 | 3300005618 | Bacteria | 2442 |
| 58 | Ga0068861_100065917 | 3300005719 | Bacteria | 2790 |
| 59 | Ga0068861_100498966 | 3300005719 | Unclassified | 1100 |
| 60 | Ga0068851_10208063 | 3300005834 | Bacteria | 1095 |
| 61 | Ga0068863_100006763 | 3300005841 | Bacteria | 11243 |
| 62 | Ga0068863_100075646 | 3300005841 | Bacteria | 3186 |
| 63 | Ga0068863_100206510 | 3300005841 | Bacteria | 1891 |
| 64 | Ga0068863_100217200 | 3300005841 | Bacteria | 1841 |
| 65 | Ga0068858_100545287 | 3300005842 | Bacteria | 1122 |
| 66 | Ga0070712_100037157 | 3300006175 | Bacteria | 3318 |
| 67 | Ga0097621_100022498 | 3300006237 | Bacteria | 4893 |
| 68 | Ga0097621_100067635 | 3300006237 | Bacteria | 2945 |
| 69 | Ga0068871_100057028 | 3300006358 | Bacteria | 3176 |
| 70 | Ga0068865_100241747 | 3300006881 | Bacteria | 1421 |
| 71 | Ga0097620_100021817 | 3300006931 | Bacteria | 6422 |
| 72 | Ga0097620_100173022 | 3300006931 | Bacteria | 2241 |
| 73 | Ga0105241_10155298 | 3300009174 | Bacteria | 1876 |
| 74 | Ga0105242_10003477 | 3300009176 | Bacteria | 12245 |
| 75 | Ga0105242_10009040 | 3300009176 | Bacteria | 7655 |
| 76 | Ga0105242_10174547 | 3300009176 | Bacteria | 1891 |
| 77 | Ga0105237_10227547 | 3300009545 | Unclassified | 1865 |
| 78 | Ga0105249_10043585 | 3300009553 | Bacteria | 4080 |
| 79 | Ga0157373_10005869 | 3300013100 | Bacteria | 9186 |
| 80 | Ga0157373_10113251 | 3300013100 | Bacteria | 1906 |
| 81 | Ga0157373_10369288 | 3300013100 | Bacteria | 1025 |
| 82 | Ga0157371_10022112 | 3300013102 | Bacteria | 4665 |
| 83 | Ga0157371_10059445 | 3300013102 | Bacteria | 2709 |
| 84 | Ga0157371_10061308 | 3300013102 | Bacteria | 2667 |
| 85 | Ga0157370_10019864 | 3300013104 | Bacteria | 6722 |
| 86 | Ga0157370_10057910 | 3300013104 | Bacteria | 3683 |
| 87 | Ga0157370_10088444 | 3300013104 | Unclassified | 2909 |
| 88 | Ga0157370_10154870 | 3300013104 | Bacteria | 2132 |
| 89 | Ga0157370_10217591 | 3300013104 | Bacteria | 1770 |
| 90 | Ga0157370_10313125 | 3300013104 | Bacteria | 1448 |
| 91 | Ga0157369_10044156 | 3300013105 | Bacteria | 4853 |
| 92 | Ga0157369_10271052 | 3300013105 | Bacteria | 1769 |
| 93 | Ga0157378_10489052 | 3300013297 | Unclassified | 1227 |
| 94 | Ga0163162_10091167 | 3300013306 | Bacteria | 3131 |
| 95 | Ga0163162_10220056 | 3300013306 | Unclassified | 2029 |
| 96 | Ga0157372_10027272 | 3300013307 | Bacteria | 6218 |
| 97 | Ga0157372_10375523 | 3300013307 | Unclassified | 1657 |
| 98 | Ga0157372_10393444 | 3300013307 | Bacteria | 1615 |
| 99 | Ga0157372_10537056 | 3300013307 | Unclassified | 1363 |
| 100 | Ga0157375_10043658 | 3300013308 | Bacteria | 4350 |
| 101 | Ga0157375_10114817 | 3300013308 | Unclassified | 2795 |
| 102 | Ga0163163_10094317 | 3300014325 | Bacteria | 3011 |
| 103 | Ga0163163_10830251 | 3300014325 | Unclassified | 988 |
| 104 | Ga0157380_10268872 | 3300014326 | Bacteria | 1553 |
| 105 | Ga0157380_10764011 | 3300014326 | Unclassified | 979 |
| 106 | Ga0157380_11231768 | 3300014326 | Bacteria | 793 |
| 107 | Ga0157377_10171473 | 3300014745 | Bacteria | 1357 |
| 108 | Ga0157379_10210224 | 3300014968 | Unclassified | 1761 |
| 109 | Ga0157376_10043448 | 3300014969 | Bacteria | 3688 |
| 110 | Ga0157376_10760170 | 3300014969 | Bacteria | 979 |
| 111 | Ga0163161_10050760 | 3300017792 | Bacteria | 3003 |
| 112 | Ga0209563_110115 | 3300025230 | Unclassified | 1393 |
| 113 | Ga0209050_1010000 | 3300025298 | Bacteria | 4745 |
| 114 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 115 | Ga0207656_10336003 | 3300025321 | Bacteria | 752 |
| 116 | Ga0207682_10014813 | 3300025893 | Bacteria | 3037 |
| 117 | Ga0207654_10319749 | 3300025911 | Bacteria | 1060 |
| 118 | Ga0207707_10004731 | 3300025912 | Bacteria | 11943 |
| 119 | Ga0207695_10052227 | 3300025913 | Unclassified | 4283 |
| 120 | Ga0207660_10048900 | 3300025917 | Bacteria | 2994 |
| 121 | Ga0207660_10259670 | 3300025917 | Unclassified | 1373 |
| 122 | Ga0207662_10020830 | 3300025918 | Unclassified | 3743 |
| 123 | Ga0207657_10072227 | 3300025919 | Bacteria | 2920 |
| 124 | Ga0207657_10136100 | 3300025919 | Bacteria | 2010 |
| 125 | Ga0207652_10004675 | 3300025921 | Bacteria | 11106 |
| 126 | Ga0207652_10080110 | 3300025921 | Bacteria | 2854 |
| 127 | Ga0207652_10827645 | 3300025921 | Bacteria | 821 |
| 128 | Ga0207681_10244790 | 3300025923 | Bacteria | 1397 |
| 129 | Ga0207650_10173549 | 3300025925 | Bacteria | 1714 |
| 130 | Ga0207690_10463746 | 3300025932 | Unclassified | 1020 |
| 131 | Ga0207686_10000655 | 3300025934 | Bacteria | 21369 |
| 132 | Ga0207686_10002008 | 3300025934 | Bacteria | 11227 |
| 133 | Ga0207670_10037122 | 3300025936 | Bacteria | 3174 |
| 134 | Ga0207670_10265531 | 3300025936 | Bacteria | 1332 |
| 135 | Ga0207669_10121406 | 3300025937 | Unclassified | 1775 |
| 136 | Ga0207704_10207941 | 3300025938 | Bacteria | 1438 |
| 137 | Ga0207665_10054789 | 3300025939 | Bacteria | 2690 |
| 138 | Ga0207691_10024080 | 3300025940 | Bacteria | 5726 |
| 139 | Ga0207689_10007242 | 3300025942 | Bacteria | 9743 |
| 140 | Ga0207689_10099250 | 3300025942 | Unclassified | 2393 |
| 141 | Ga0207667_10107222 | 3300025949 | Bacteria | 2882 |
| 142 | Ga0207667_10115589 | 3300025949 | Bacteria | 2765 |
| 143 | Ga0207667_10213247 | 3300025949 | Bacteria | 1979 |
| 144 | Ga0207651_10259647 | 3300025960 | Unclassified | 1425 |
| 145 | Ga0207668_10822426 | 3300025972 | Bacteria | 823 |
| 146 | Ga0207640_10140291 | 3300025981 | Unclassified | 1761 |
| 147 | Ga0207658_10056455 | 3300025986 | Bacteria | 2914 |
| 148 | Ga0207677_10462486 | 3300026023 | Bacteria | 1089 |
| 149 | Ga0207708_10070554 | 3300026075 | Bacteria | 2675 |
| 150 | Ga0207641_10003368 | 3300026088 | Bacteria | 14188 |
| 151 | Ga0207641_10132410 | 3300026088 | Bacteria | 2240 |
| 152 | Ga0207641_10260836 | 3300026088 | Bacteria | 1622 |
| 153 | Ga0207648_10000394 | 3300026089 | Bacteria | 48433 |
| 154 | Ga0207648_10048171 | 3300026089 | Bacteria | 3732 |
| 155 | Ga0207676_10082504 | 3300026095 | Bacteria | 2615 |
| 156 | Ga0207676_10096679 | 3300026095 | Bacteria | 2438 |
| 157 | Ga0207676_10926007 | 3300026095 | Unclassified | 856 |
| 158 | Ga0207674_10045199 | 3300026116 | Unclassified | 4531 |
| 159 | Ga0207674_10121734 | 3300026116 | Bacteria | 2576 |
| 160 | Ga0207674_10128460 | 3300026116 | Bacteria | 2499 |
| 161 | Ga0207674_10989988 | 3300026116 | Unclassified | 810 |
| 162 | Ga0207675_100142475 | 3300026118 | Bacteria | 2277 |
| 163 | Ga0207675_100172335 | 3300026118 | Bacteria | 2069 |
| 164 | Ga0209995_1015558 | 3300027471 | Bacteria | 1247 |
| 165 | Ga0307515_10000016 | 3300028794 | Bacteria | 554870 |
| 166 | Ga0307515_10362386 | 3300028794 | Bacteria | 1090 |
| 167 | Ga0265324_10013304 | 3300029957 | Bacteria | 3074 |
| 168 | Ga0265327_10027018 | 3300031251 | Bacteria | 3311 |
| 169 | Ga0265327_10032889 | 3300031251 | Bacteria | 2899 |
| 170 | Ga0307513_10031311 | 3300031456 | Bacteria | 6026 |
| 171 | Ga0307513_10267957 | 3300031456 | Bacteria | 1493 |
| 172 | Ga0307408_100144399 | 3300031548 | Bacteria | 1871 |
| 173 | Ga0316576_10228923 | 3300031727 | Bacteria | 1398 |
| 174 | Ga0307413_10421822 | 3300031824 | Bacteria | 1051 |
| 175 | Ga0307413_10948157 | 3300031824 | Bacteria | 734 |
| 176 | Ga0316593_10092796 | 3300032168 | Bacteria | 1064 |
| 177 | Ga0316588_1027741 | 3300033528 | Bacteria | 1317 |
| 178 | Ga0373927_0013661 | 3300035695 | Bacteria | 5392 |
| 179 | Ga0373927_0028650 | 3300035695 | Unclassified | 3633 |
| 180 | Ga0395899_0006417 | 3300037312 | Bacteria | 9113 |
| 181 | Ga0395900_0000413 | 3300037418 | Bacteria | 61555 |
| 182 | Ga0395900_1009454 | 3300037418 | Bacteria | 752 |
| 183 | Ga0395898_0002918 | 3300037466 | Bacteria | 19458 |
| 184 | Ga0395898_0023245 | 3300037466 | Bacteria | 6264 |
| 185 | Ga0395905_0000188 | 3300037471 | Bacteria | 98070 |
| 186 | Ga0395905_0000340 | 3300037471 | Bacteria | 66412 |
| 187 | Ga0395905_0001214 | 3300037471 | Bacteria | 32159 |
| 188 | Ga0395901_0002175 | 3300038443 | Bacteria | 20011 |
| 189 | Ga0395901_0023222 | 3300038443 | Bacteria | 6357 |
| 190 | Ga0400483_015018 | 3300039062 | Bacteria | 97237 |
| 191 | Ga0451800_1035709 | 3300041459 | Bacteria | 2447 |
| 192 | Ga0451807_0294302 | 3300041486 | Bacteria | 1973 |
| 193 | Ga0439457_013989 | 3300042014 | Bacteria | 1800 |
| 194 | Ga0451576_0443070 | 3300045051 | Bacteria | 1363 |
| 195 | Ga0495592_0195878 | 3300046454 | Bacteria | 1367 |
| 196 | Ga0495638_0000003 | 3300046460 | Bacteria | 888792 |
| 197 | Ga0495638_0205879 | 3300046460 | Bacteria | 1108 |
| 198 | Ga0495585_0006671 | 3300046492 | Bacteria | 7131 |
| 199 | Ga0495594_0091835 | 3300046499 | Unclassified | 1702 |
| 200 | Ga0495632_0032094 | 3300046519 | Bacteria | 2709 |
| 201 | Ga0495648_0002217 | 3300046524 | Bacteria | 18201 |
| 202 | Ga0495642_0199915 | 3300046528 | Bacteria | 871 |
| 203 | Ga0495621_0088883 | 3300046539 | Bacteria | 1162 |
| 204 | Ga0495668_0000298 | 3300046616 | Bacteria | 68412 |
| 205 | Ga0495625_0000741 | 3300046660 | Bacteria | 45531 |
| 206 | Ga0495604_0118435 | 3300047317 | Unclassified | 1920 |
| 207 | Ga0495636_0000006 | 3300047318 | Bacteria | 107323 |
| 208 | Ga0495614_0163795 | 3300048089 | Unclassified | 996 |
| 209 | Ga0501308_009788 | 3300049128 | Bacteria | 1053 |
| 210 | Ga0501315_001289 | 3300049531 | Bacteria | 2098 |
| 211 | Ga0501032_0049620 | 3300049569 | Bacteria | 2832 |
| 212 | Ga0501033_0168031 | 3300049570 | Bacteria | 1576 |
| 213 | Ga0501034_0007973 | 3300049571 | Bacteria | 11244 |
| 214 | Ga0501034_0060189 | 3300049571 | Unclassified | 3815 |
| 215 | Ga0501034_0232683 | 3300049571 | Bacteria | 1791 |
| 216 | Ga0501036_0077634 | 3300049572 | Bacteria | 2810 |
| 217 | Ga0501037_0023833 | 3300049573 | Bacteria | 4526 |
| 218 | Ga0501037_0057737 | 3300049573 | Bacteria | 2833 |
| 219 | Ga0501038_0027311 | 3300049574 | Bacteria | 5079 |
| 220 | Ga0501039_0219076 | 3300049575 | Bacteria | 1496 |
| 221 | Ga0501043_0007131 | 3300049579 | Bacteria | 8892 |
| 222 | Ga0501046_0313749 | 3300049580 | Bacteria | 1143 |
| 223 | Ga0501046_0459381 | 3300049580 | Bacteria | 915 |
| 224 | Ga0501047_0029872 | 3300049581 | Bacteria | 5254 |
| 225 | Ga0501047_0075349 | 3300049581 | Bacteria | 3247 |
| 226 | Ga0501067_0031651 | 3300049583 | Bacteria | 2935 |
| 227 | Ga0501074_0306038 | 3300049590 | Bacteria | 1129 |
| 228 | Ga0501202_004919 | 3300049652 | Bacteria | 2354 |
| 229 | Ga0501217_003083 | 3300049661 | Bacteria | 3338 |
| 230 | Ga0501217_073200 | 3300049661 | Bacteria | 936 |
| 231 | Ga0501242_000171 | 3300049674 | Bacteria | 4930 |
| 232 | Ga0501250_000045 | 3300049680 | Bacteria | 6025 |
| 233 | Ga0501251_009666 | 3300049681 | Bacteria | 1116 |
| 234 | Ga0501252_008064 | 3300049682 | Bacteria | 1205 |
| 235 | Ga0501253_001584 | 3300049683 | Bacteria | 2354 |
| 236 | Ga0501259_000549 | 3300049688 | Bacteria | 6020 |
| 237 | Ga0501245_004700 | 3300049708 | Bacteria | 1879 |
| 238 | Ga0501266_000164 | 3300049763 | Bacteria | 8539 |
| 239 | Ga0501268_000207 | 3300049765 | Bacteria | 5713 |
| 240 | Ga0501035_0080891 | 3300049822 | Bacteria | 2868 |
| 241 | Ga0501044_0049172 | 3300049823 | Bacteria | 4353 |
| 242 | Ga0501044_0060440 | 3300049823 | Bacteria | 3880 |
| 243 | Ga0501044_0063449 | 3300049823 | Bacteria | 3774 |
| 244 | Ga0501044_0150933 | 3300049823 | Bacteria | 2306 |
| 245 | Ga0501212_013058 | 3300049851 | Bacteria | 1215 |
| 246 | Ga0500578_0000019 | 3300053086 | Bacteria | 169042 |
| 247 | Ga0500650_0183209 | 3300053098 | Bacteria | 959 |
| 248 | Ga0500557_055685 | 3300053105 | Bacteria | 1276 |
| 249 | Ga0500614_022913 | 3300053123 | Bacteria | 1463 |
| 250 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 251 | Ga0500611_000021 | 3300053727 | Bacteria | 102395 |
| 252 | Ga0501084_0145589 | 3300054114 | Bacteria | 1995 |
| 253 | Ga0587077_054551 | 3300059493 | Bacteria | 847 |
| 254 | Ga0501082_0083019 | 3300060353 | Bacteria | 2764 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013104 | Ga0157370_10057910 | Ga0157370_100579102 | 201 |
| 2 | 3300049569 | Ga0501032_0049620 | Ga0501032_0049620_2083_2691 | 202 |
| 3 | 3300049571 | Ga0501034_0007973 | Ga0501034_0007973_3601_4209 | 202 |
| 4 | 3300049572 | Ga0501036_0077634 | Ga0501036_0077634_1127_1735 | 202 |
| 5 | 3300049573 | Ga0501037_0023833 | Ga0501037_0023833_3587_4195 | 202 |
| 6 | 3300049574 | Ga0501038_0027311 | Ga0501038_0027311_3050_3658 | 202 |
| 7 | 3300049575 | Ga0501039_0219076 | Ga0501039_0219076_684_1292 | 202 |
| 8 | 3300049579 | Ga0501043_0007131 | Ga0501043_0007131_6288_6896 | 202 |
| 9 | 3300049580 | Ga0501046_0459381 | Ga0501046_0459381_78_686 | 202 |
| 10 | 3300049581 | Ga0501047_0029872 | Ga0501047_0029872_500_1108 | 202 |
| 11 | 3300049822 | Ga0501035_0080891 | Ga0501035_0080891_1725_2333 | 202 |
| 12 | 3300049823 | Ga0501044_0060440 | Ga0501044_0060440_479_1087 | 202 |
| 13 | 3300049128 | Ga0501308_009788 | Ga0501308_009788_50_664 | 204 |
| 14 | 3300003322 | rootL2_10019553 | rootL2_100195534 | 205 |
| 15 | iso_pu_bacteria | 3003233435 | 3003237151 | 205 |
| 16 | 3300003323 | rootH1_10008322 | rootH1_100083224 | 206 |
| 17 | 3300049661 | Ga0501217_073200 | Ga0501217_073200_33_662 | 206 |
| 18 | 3300005327 | Ga0070658_10778372 | Ga0070658_107783721 | 208 |
| 19 | 3300046460 | Ga0495638_0205879 | Ga0495638_0205879_321_950 | 209 |
| 20 | 3300049571 | Ga0501034_0060189 | Ga0501034_0060189_1384_2013 | 209 |
| 21 | 3300053727 | Ga0500611_000021 | Ga0500611_000021_97047_97676 | 209 |
| 22 | 3300005563 | Ga0068855_100303391 | Ga0068855_1003033912 | 210 |
| 23 | 3300013307 | Ga0157372_10375523 | Ga0157372_103755232 | 210 |
| 24 | 3300013307 | Ga0157372_10537056 | Ga0157372_105370561 | 210 |
| 25 | 3300025949 | Ga0207667_10213247 | Ga0207667_102132473 | 210 |
| 26 | 3300003323 | rootH1_10157523 | rootH1_101575235 | 211 |
| 27 | 3300009176 | Ga0105242_10174547 | Ga0105242_101745471 | 212 |
| 28 | 3300026089 | Ga0207648_10000394 | Ga0207648_100003948 | 212 |
| 29 | 3300029957 | Ga0265324_10013304 | Ga0265324_100133043 | 212 |
| 30 | 3300005339 | Ga0070660_100412863 | Ga0070660_1004128631 | 213 |
| 31 | 3300005341 | Ga0070691_10014712 | Ga0070691_100147123 | 213 |
| 32 | 3300005458 | Ga0070681_10757757 | Ga0070681_107577571 | 213 |
| 33 | 3300005530 | Ga0070679_100590447 | Ga0070679_1005904472 | 213 |
| 34 | 3300005539 | Ga0068853_100495557 | Ga0068853_1004955571 | 213 |
| 35 | 3300005547 | Ga0070693_100019417 | Ga0070693_1000194174 | 213 |
| 36 | 3300005563 | Ga0068855_100287144 | Ga0068855_1002871442 | 213 |
| 37 | 3300009545 | Ga0105237_10227547 | Ga0105237_102275472 | 213 |
| 38 | 3300013104 | Ga0157370_10088444 | Ga0157370_100884443 | 213 |
| 39 | 3300013104 | Ga0157370_10313125 | Ga0157370_103131252 | 213 |
| 40 | 3300013105 | Ga0157369_10271052 | Ga0157369_102710523 | 213 |
| 41 | 3300025912 | Ga0207707_10004731 | Ga0207707_100047315 | 213 |
| 42 | 3300025913 | Ga0207695_10052227 | Ga0207695_100522273 | 213 |
| 43 | 3300025917 | Ga0207660_10259670 | Ga0207660_102596702 | 213 |
| 44 | 3300025921 | Ga0207652_10004675 | Ga0207652_100046753 | 213 |
| 45 | 3300025921 | Ga0207652_10827645 | Ga0207652_108276451 | 213 |
| 46 | 3300031251 | Ga0265327_10032889 | Ga0265327_100328892 | 213 |
| 47 | 3300049580 | Ga0501046_0313749 | Ga0501046_0313749_280_945 | 213 |
| 48 | 3300049581 | Ga0501047_0075349 | Ga0501047_0075349_792_1457 | 213 |
| 49 | 3300049583 | Ga0501067_0031651 | Ga0501067_0031651_1939_2604 | 213 |
| 50 | 3300049590 | Ga0501074_0306038 | Ga0501074_0306038_168_833 | 213 |
| 51 | 3300049823 | Ga0501044_0063449 | Ga0501044_0063449_1155_1820 | 213 |
| 52 | 3300054114 | Ga0501084_0145589 | Ga0501084_0145589_495_1160 | 213 |
| 53 | 3300060353 | Ga0501082_0083019 | Ga0501082_0083019_1838_2503 | 213 |
| 54 | 3300005617 | Ga0068859_100173027 | Ga0068859_1001730273 | 214 |
| 55 | 3300006931 | Ga0097620_100173022 | Ga0097620_1001730222 | 214 |
| 56 | 3300013104 | Ga0157370_10019864 | Ga0157370_100198647 | 215 |
| 57 | 3300031251 | Ga0265327_10027018 | Ga0265327_100270183 | 216 |
| 58 | 3300045051 | Ga0451576_0443070 | Ga0451576_0443070_330_1019 | 216 |
| 59 | 3300049823 | Ga0501044_0049172 | Ga0501044_0049172_640_1308 | 216 |
| 60 | 3300013104 | Ga0157370_10217591 | Ga0157370_102175912 | 217 |
| 61 | 3300049571 | Ga0501034_0232683 | Ga0501034_0232683_1005_1658 | 217 |
| 62 | 3300049573 | Ga0501037_0057737 | Ga0501037_0057737_1248_1901 | 217 |
| 63 | 3300049823 | Ga0501044_0150933 | Ga0501044_0150933_1158_1811 | 217 |
| 64 | 3300042014 | Ga0439457_013989 | Ga0439457_013989_1120_1776 | 218 |
| 65 | 3300049674 | Ga0501242_000171 | Ga0501242_000171_1825_2538 | 218 |
| 66 | 3300005289 | Ga0065704_10276510 | Ga0065704_102765101 | 220 |
| 67 | 3300005563 | Ga0068855_100130744 | Ga0068855_1001307444 | 220 |
| 68 | 3300005577 | Ga0068857_100241182 | Ga0068857_1002411822 | 220 |
| 69 | 3300006175 | Ga0070712_100037157 | Ga0070712_1000371575 | 220 |
| 70 | 3300025949 | Ga0207667_10107222 | Ga0207667_101072221 | 220 |
| 71 | 3300026116 | Ga0207674_10989988 | Ga0207674_109899882 | 220 |
| 72 | 3300049570 | Ga0501033_0168031 | Ga0501033_0168031_85_747 | 220 |
| 73 | 3300003320 | rootH2_10069883 | rootH2_100698831 | 221 |
| 74 | 3300005327 | Ga0070658_10770158 | Ga0070658_107701581 | 221 |
| 75 | 3300005336 | Ga0070680_100051620 | Ga0070680_1000516204 | 221 |
| 76 | 3300005337 | Ga0070682_100000018 | Ga0070682_100000018115 | 221 |
| 77 | 3300005366 | Ga0070659_100034273 | Ga0070659_1000342734 | 221 |
| 78 | 3300005530 | Ga0070679_100121956 | Ga0070679_1001219561 | 221 |
| 79 | 3300005563 | Ga0068855_100039739 | Ga0068855_1000397397 | 221 |
| 80 | 3300005577 | Ga0068857_100107148 | Ga0068857_1001071481 | 221 |
| 81 | 3300013100 | Ga0157373_10113251 | Ga0157373_101132513 | 221 |
| 82 | 3300013102 | Ga0157371_10022112 | Ga0157371_100221124 | 221 |
| 83 | 3300013297 | Ga0157378_10489052 | Ga0157378_104890521 | 221 |
| 84 | 3300013307 | Ga0157372_10027272 | Ga0157372_100272721 | 221 |
| 85 | 3300025917 | Ga0207660_10048900 | Ga0207660_100489004 | 221 |
| 86 | 3300025919 | Ga0207657_10072227 | Ga0207657_100722274 | 221 |
| 87 | 3300025921 | Ga0207652_10080110 | Ga0207652_100801104 | 221 |
| 88 | 3300025949 | Ga0207667_10115589 | Ga0207667_101155894 | 221 |
| 89 | 3300026116 | Ga0207674_10121734 | Ga0207674_101217342 | 221 |
| 90 | 3300035695 | Ga0373927_0028650 | Ga0373927_0028650_1229_1897 | 221 |
| 91 | 3300046454 | Ga0495592_0195878 | Ga0495592_0195878_544_1212 | 221 |
| 92 | 3300046460 | Ga0495638_0000003 | Ga0495638_0000003_633532_634200 | 222 |
| 93 | 3300053105 | Ga0500557_055685 | Ga0500557_055685_161_829 | 222 |
| 94 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_162744_163412 | 222 |
| 95 | 3300013100 | Ga0157373_10005869 | Ga0157373_1000586911 | 223 |
| 96 | 3300013102 | Ga0157371_10061308 | Ga0157371_100613084 | 223 |
| 97 | 3300026116 | Ga0207674_10045199 | Ga0207674_100451995 | 223 |
| 98 | 3300027471 | Ga0209995_1015558 | Ga0209995_10155581 | 223 |
| 99 | iso_pu_bacteria | 2884933994 | 2884936856 | 223 |
| 100 | 3300003323 | rootH1_10012411 | rootH1_1001241119 | 225 |
| 101 | 3300003323 | rootH1_10129844 | rootH1_101298442 | 225 |
| 102 | 3300037471 | Ga0395905_0000340 | Ga0395905_0000340_25312_25998 | 225 |
| 103 | 3300005339 | Ga0070660_100283646 | Ga0070660_1002836462 | 226 |
| 104 | 3300025919 | Ga0207657_10136100 | Ga0207657_101361004 | 226 |
| 105 | 3300025939 | Ga0207665_10054789 | Ga0207665_100547892 | 226 |
| 106 | 3300025942 | Ga0207689_10099250 | Ga0207689_100992501 | 226 |
| 107 | 3300031824 | Ga0307413_10421822 | Ga0307413_104218221 | 226 |
| 108 | 3300032168 | Ga0316593_10092796 | Ga0316593_100927961 | 226 |
| 109 | 3300037466 | Ga0395898_0023245 | Ga0395898_0023245_2275_2961 | 226 |
| 110 | 3300037471 | Ga0395905_0001214 | Ga0395905_0001214_22244_22930 | 226 |
| 111 | 3300038443 | Ga0395901_0023222 | Ga0395901_0023222_674_1354 | 226 |
| 112 | 3300046492 | Ga0495585_0006671 | Ga0495585_0006671_4618_5307 | 226 |
| 113 | 3300046524 | Ga0495648_0002217 | Ga0495648_0002217_8509_9198 | 226 |
| 114 | 3300046616 | Ga0495668_0000298 | Ga0495668_0000298_10291_10974 | 226 |
| 115 | 3300046660 | Ga0495625_0000741 | Ga0495625_0000741_39220_39909 | 226 |
| 116 | 3300049652 | Ga0501202_004919 | Ga0501202_004919_1522_2259 | 226 |
| 117 | 3300049661 | Ga0501217_003083 | Ga0501217_003083_1131_1868 | 226 |
| 118 | 3300049680 | Ga0501250_000045 | Ga0501250_000045_2320_3057 | 226 |
| 119 | 3300049681 | Ga0501251_009666 | Ga0501251_009666_57_794 | 226 |
| 120 | 3300049682 | Ga0501252_008064 | Ga0501252_008064_250_987 | 226 |
| 121 | 3300049683 | Ga0501253_001584 | Ga0501253_001584_257_994 | 226 |
| 122 | 3300049688 | Ga0501259_000549 | Ga0501259_000549_4771_5508 | 226 |
| 123 | 3300049708 | Ga0501245_004700 | Ga0501245_004700_510_1247 | 226 |
| 124 | 3300049763 | Ga0501266_000164 | Ga0501266_000164_1383_2120 | 226 |
| 125 | 3300049765 | Ga0501268_000207 | Ga0501268_000207_238_975 | 226 |
| 126 | 3300049851 | Ga0501212_013058 | Ga0501212_013058_22_759 | 226 |
| 127 | 3300053123 | Ga0500614_022913 | Ga0500614_022913_519_1202 | 226 |
| 128 | iso_pu_bacteria | 2839989709 | 2839989928 | 226 |
| 129 | 3300003322 | rootL2_10039177 | rootL2_100391776 | 227 |
| 130 | 3300003794 | Ga0055531_10000087 | Ga0055531_1000008748 | 227 |
| 131 | 3300005366 | Ga0070659_100558627 | Ga0070659_1005586271 | 227 |
| 132 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006373 | 227 |
| 133 | 3300025932 | Ga0207690_10463746 | Ga0207690_104637461 | 227 |
| 134 | 3300037312 | Ga0395899_0006417 | Ga0395899_0006417_642_1325 | 227 |
| 135 | 3300037418 | Ga0395900_0000413 | Ga0395900_0000413_53007_53690 | 227 |
| 136 | 3300037466 | Ga0395898_0002918 | Ga0395898_0002918_7209_7892 | 227 |
| 137 | 3300037471 | Ga0395905_0000188 | Ga0395905_0000188_44381_45064 | 227 |
| 138 | 3300038443 | Ga0395901_0002175 | Ga0395901_0002175_7866_8549 | 227 |
| 139 | 3300053086 | Ga0500578_0000019 | Ga0500578_0000019_128671_129387 | 227 |
| 140 | 3300005293 | Ga0065715_10091790 | Ga0065715_100917905 | 228 |
| 141 | 3300005543 | Ga0070672_100458424 | Ga0070672_1004584242 | 228 |
| 142 | 3300013307 | Ga0157372_10393444 | Ga0157372_103934443 | 228 |
| 143 | 3300014325 | Ga0163163_10830251 | Ga0163163_108302511 | 228 |
| 144 | 3300025230 | Ga0209563_110115 | Ga0209563_1101152 | 228 |
| 145 | 3300028794 | Ga0307515_10000016 | Ga0307515_10000016321 | 228 |
| 146 | 3300028794 | Ga0307515_10362386 | Ga0307515_103623861 | 228 |
| 147 | 3300031548 | Ga0307408_100144399 | Ga0307408_1001443992 | 228 |
| 148 | 3300031824 | Ga0307413_10948157 | Ga0307413_109481571 | 228 |
| 149 | 3300046519 | Ga0495632_0032094 | Ga0495632_0032094_1233_1922 | 228 |
| 150 | 3300049531 | Ga0501315_001289 | Ga0501315_001289_218_904 | 228 |
| 151 | 3300005577 | Ga0068857_100171285 | Ga0068857_1001712853 | 229 |
| 152 | 3300013100 | Ga0157373_10369288 | Ga0157373_103692881 | 229 |
| 153 | 3300013102 | Ga0157371_10059445 | Ga0157371_100594453 | 229 |
| 154 | 3300013104 | Ga0157370_10154870 | Ga0157370_101548703 | 229 |
| 155 | 3300013105 | Ga0157369_10044156 | Ga0157369_100441566 | 229 |
| 156 | 3300014326 | Ga0157380_11231768 | Ga0157380_112317681 | 229 |
| 157 | 3300025298 | Ga0209050_1010000 | Ga0209050_10100003 | 229 |
| 158 | 3300026095 | Ga0207676_10926007 | Ga0207676_109260071 | 229 |
| 159 | 3300026116 | Ga0207674_10128460 | Ga0207674_101284602 | 229 |
| 160 | 3300031456 | Ga0307513_10031311 | Ga0307513_100313114 | 229 |
| 161 | 3300031456 | Ga0307513_10267957 | Ga0307513_102679572 | 229 |
| 162 | 3300035695 | Ga0373927_0013661 | Ga0373927_0013661_2219_2908 | 229 |
| 163 | 3300037418 | Ga0395900_1009454 | Ga0395900_1009454_49_738 | 229 |
| 164 | 3300047317 | Ga0495604_0118435 | Ga0495604_0118435_236_925 | 229 |
| 165 | 3300048089 | Ga0495614_0163795 | Ga0495614_0163795_86_775 | 229 |
| 166 | 3300053098 | Ga0500650_0183209 | Ga0500650_0183209_52_741 | 229 |
| 167 | 3300005331 | Ga0070670_100372633 | Ga0070670_1003726332 | 230 |
| 168 | 3300005618 | Ga0068864_100058532 | Ga0068864_1000585323 | 230 |
| 169 | 3300005841 | Ga0068863_100075646 | Ga0068863_1000756466 | 230 |
| 170 | 3300025925 | Ga0207650_10173549 | Ga0207650_101735493 | 230 |
| 171 | 3300026095 | Ga0207676_10096679 | Ga0207676_100966793 | 230 |
| 172 | 3300031727 | Ga0316576_10228923 | Ga0316576_102289231 | 230 |
| 173 | 3300039062 | Ga0400483_015018 | Ga0400483_015018_53263_53961 | 230 |
| 174 | 3300003322 | rootL2_10380535 | rootL2_103805352 | 231 |
| 175 | 3300005290 | Ga0065712_10001612 | Ga0065712_100016124 | 231 |
| 176 | 3300005334 | Ga0068869_100013184 | Ga0068869_1000131845 | 231 |
| 177 | 3300005343 | Ga0070687_100277994 | Ga0070687_1002779941 | 231 |
| 178 | 3300005353 | Ga0070669_100020504 | Ga0070669_1000205042 | 231 |
| 179 | 3300005354 | Ga0070675_100107980 | Ga0070675_1001079801 | 231 |
| 180 | 3300005365 | Ga0070688_100002899 | Ga0070688_1000028995 | 231 |
| 181 | 3300005365 | Ga0070688_100294046 | Ga0070688_1002940462 | 231 |
| 182 | 3300005438 | Ga0070701_10057256 | Ga0070701_100572561 | 231 |
| 183 | 3300005459 | Ga0068867_100262049 | Ga0068867_1002620492 | 231 |
| 184 | 3300005466 | Ga0070685_10004800 | Ga0070685_100048005 | 231 |
| 185 | 3300005466 | Ga0070685_10007831 | Ga0070685_100078314 | 231 |
| 186 | 3300005536 | Ga0070697_100129915 | Ga0070697_1001299153 | 231 |
| 187 | 3300005544 | Ga0070686_100125411 | Ga0070686_1001254111 | 231 |
| 188 | 3300005549 | Ga0070704_100049577 | Ga0070704_1000495772 | 231 |
| 189 | 3300005577 | Ga0068857_100131761 | Ga0068857_1001317613 | 231 |
| 190 | 3300005617 | Ga0068859_100021816 | Ga0068859_1000218165 | 231 |
| 191 | 3300005618 | Ga0068864_100111010 | Ga0068864_1001110102 | 231 |
| 192 | 3300005719 | Ga0068861_100065917 | Ga0068861_1000659174 | 231 |
| 193 | 3300005834 | Ga0068851_10208063 | Ga0068851_102080631 | 231 |
| 194 | 3300005841 | Ga0068863_100006763 | Ga0068863_10000676312 | 231 |
| 195 | 3300005841 | Ga0068863_100206510 | Ga0068863_1002065102 | 231 |
| 196 | 3300005841 | Ga0068863_100217200 | Ga0068863_1002172002 | 231 |
| 197 | 3300005842 | Ga0068858_100545287 | Ga0068858_1005452872 | 231 |
| 198 | 3300006237 | Ga0097621_100022498 | Ga0097621_1000224985 | 231 |
| 199 | 3300006358 | Ga0068871_100057028 | Ga0068871_1000570283 | 231 |
| 200 | 3300006881 | Ga0068865_100241747 | Ga0068865_1002417471 | 231 |
| 201 | 3300006931 | Ga0097620_100021817 | Ga0097620_1000218175 | 231 |
| 202 | 3300009174 | Ga0105241_10155298 | Ga0105241_101552982 | 231 |
| 203 | 3300009176 | Ga0105242_10009040 | Ga0105242_100090406 | 231 |
| 204 | 3300009553 | Ga0105249_10043585 | Ga0105249_100435851 | 231 |
| 205 | 3300013306 | Ga0163162_10091167 | Ga0163162_100911673 | 231 |
| 206 | 3300013306 | Ga0163162_10220056 | Ga0163162_102200561 | 231 |
| 207 | 3300013308 | Ga0157375_10043658 | Ga0157375_100436584 | 231 |
| 208 | 3300013308 | Ga0157375_10114817 | Ga0157375_101148174 | 231 |
| 209 | 3300014325 | Ga0163163_10094317 | Ga0163163_100943173 | 231 |
| 210 | 3300014326 | Ga0157380_10764011 | Ga0157380_107640111 | 231 |
| 211 | 3300014745 | Ga0157377_10171473 | Ga0157377_101714732 | 231 |
| 212 | 3300014968 | Ga0157379_10210224 | Ga0157379_102102242 | 231 |
| 213 | 3300014969 | Ga0157376_10043448 | Ga0157376_100434482 | 231 |
| 214 | 3300017792 | Ga0163161_10050760 | Ga0163161_100507602 | 231 |
| 215 | 3300025321 | Ga0207656_10336003 | Ga0207656_103360031 | 231 |
| 216 | 3300025893 | Ga0207682_10014813 | Ga0207682_100148133 | 231 |
| 217 | 3300025911 | Ga0207654_10319749 | Ga0207654_103197493 | 231 |
| 218 | 3300025918 | Ga0207662_10020830 | Ga0207662_100208305 | 231 |
| 219 | 3300025923 | Ga0207681_10244790 | Ga0207681_102447902 | 231 |
| 220 | 3300025934 | Ga0207686_10000655 | Ga0207686_1000065519 | 231 |
| 221 | 3300025936 | Ga0207670_10037122 | Ga0207670_100371223 | 231 |
| 222 | 3300025936 | Ga0207670_10265531 | Ga0207670_102655312 | 231 |
| 223 | 3300025937 | Ga0207669_10121406 | Ga0207669_101214061 | 231 |
| 224 | 3300025938 | Ga0207704_10207941 | Ga0207704_102079412 | 231 |
| 225 | 3300025940 | Ga0207691_10024080 | Ga0207691_100240803 | 231 |
| 226 | 3300025942 | Ga0207689_10007242 | Ga0207689_100072424 | 231 |
| 227 | 3300025960 | Ga0207651_10259647 | Ga0207651_102596471 | 231 |
| 228 | 3300025972 | Ga0207668_10822426 | Ga0207668_108224261 | 231 |
| 229 | 3300025981 | Ga0207640_10140291 | Ga0207640_101402911 | 231 |
| 230 | 3300025986 | Ga0207658_10056455 | Ga0207658_100564553 | 231 |
| 231 | 3300026023 | Ga0207677_10462486 | Ga0207677_104624861 | 231 |
| 232 | 3300026075 | Ga0207708_10070554 | Ga0207708_100705541 | 231 |
| 233 | 3300026088 | Ga0207641_10003368 | Ga0207641_100033686 | 231 |
| 234 | 3300026088 | Ga0207641_10132410 | Ga0207641_101324103 | 231 |
| 235 | 3300026088 | Ga0207641_10260836 | Ga0207641_102608362 | 231 |
| 236 | 3300026089 | Ga0207648_10048171 | Ga0207648_100481712 | 231 |
| 237 | 3300026095 | Ga0207676_10082504 | Ga0207676_100825043 | 231 |
| 238 | 3300026118 | Ga0207675_100142475 | Ga0207675_1001424754 | 231 |
| 239 | 3300026118 | Ga0207675_100172335 | Ga0207675_1001723353 | 231 |
| 240 | 3300041459 | Ga0451800_1035709 | Ga0451800_1035709_787_1482 | 231 |
| 241 | 3300041486 | Ga0451807_0294302 | Ga0451807_0294302_757_1452 | 231 |
| 242 | 3300046499 | Ga0495594_0091835 | Ga0495594_0091835_67_762 | 231 |
| 243 | 3300046528 | Ga0495642_0199915 | Ga0495642_0199915_44_739 | 231 |
| 244 | 3300046539 | Ga0495621_0088883 | Ga0495621_0088883_165_860 | 231 |
| 245 | 3300047318 | Ga0495636_0000006 | Ga0495636_0000006_30825_31520 | 231 |
| 246 | 3300005334 | Ga0068869_100115616 | Ga0068869_1001156162 | 232 |
| 247 | 3300033528 | Ga0316588_1027741 | Ga0316588_10277411 | 232 |
| 248 | 3300059493 | Ga0587077_054551 | Ga0587077_054551_56_754 | 232 |
| 249 | iso_pu_bacteria | 2818991444 | 2819588486 | 232 |
| 250 | 3300005354 | Ga0070675_100075885 | Ga0070675_1000758852 | 233 |
| 251 | 3300005719 | Ga0068861_100498966 | Ga0068861_1004989661 | 233 |
| 252 | 3300006237 | Ga0097621_100067635 | Ga0097621_1000676353 | 233 |
| 253 | 3300009176 | Ga0105242_10003477 | Ga0105242_1000347710 | 233 |
| 254 | 3300014326 | Ga0157380_10268872 | Ga0157380_102688722 | 233 |
| 255 | 3300014969 | Ga0157376_10760170 | Ga0157376_107601701 | 233 |
| 256 | 3300025934 | Ga0207686_10002008 | Ga0207686_100020087 | 233 |
| 257 | 3300003316 | rootH1_10106547 | rootH1_101065473 | 236 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1fbx-assembly1.cif.gz_A | crystal structure of zinc-containing e.coli gtp cyclohydrolase i | 0.9616 | 33 | 232 |
| 1a9c-assembly1.cif.gz_A | gtp cyclohydrolase i (c110s mutant) in complex with gtp | 0.9603 | 33 | 233 |
| 1a8r-assembly1.cif.gz_A | gtp cyclohydrolase i (h112s mutant) in complex with gtp | 0.9596 | 33 | 232 |
| 4du6-assembly1.cif.gz_E-2 | crystal structure of gtp cyclohydrolase i from yersinia pestis complexed with gtp | 0.9594 | 33 | 232 |
| 4du6-assembly1.cif.gz_A | crystal structure of gtp cyclohydrolase i from yersinia pestis complexed with gtp | 0.959 | 33 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1a8rA02 | Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain | 0.9588 | 100 | 232 | 3.30.1130.10 |
| 4du6C01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9486 | 34 | 99 | 1.10.286.10 |
| 4du6A01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9477 | 34 | 99 | 1.10.286.10 |
| 4du6E01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9465 | 34 | 99 | 1.10.286.10 |
| 1n3rM01 | Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain | 0.9428 | 35 | 99 | 1.10.286.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382L1Q8-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.9846 | 58 | 185 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 |
| AF-A0A3D1E5D5-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.977 | 30 | 180 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A0L8VDE2-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) | 0.976 | 37 | 232 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-A0A2T4WQN7-F1-model_v4 | GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) | 0.9723 | 30 | 235 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0006730 GO:0008270 GO:0046654 |
| AF-X1MIN2-F1-model_v4 | GTP cyclohydrolase I (EC 3.5.4.16) | 0.97 | 103 | 195 |
GO:0003934
GO:0005525 GO:0005737 GO:0006729 GO:0008270 GO:0046654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar