F367303

General Info

Members Datasets Scaffolds Average Seq Length
257 171 254 226

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10489052|Ga0157378_104890521
Length 222
Sequence MEQDILTEKLLDKISEDHFSSSLDTPMHEDAFALTDIQKIKIIAEHFRHIMHTLGLDLTDDSLKDTPLHVAKMYVKEVFSGLNPANKPEPALFENKYRYNEMLIEKDITLYSYCEHHFVPIIGKVHVAYFSSNDKVIGLSKINRLVQYYAKRPQVQERLTNQIAKGLKEALNTEHVAVIVDAVHLCVASRGIKDTNSSTITAYYSGRFNEESTKAEFLSLIK

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
150 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
151 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
152 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
153 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
154 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
155 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
158 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
159 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
168 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 1.95
Isolates 1.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 0.78
Rhizosphere 88.72
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10106547 3300003316 Unclassified 1549
2 rootH2_10069883 3300003320 Bacteria 1993
3 rootL2_10019553 3300003322 Bacteria 6508
4 rootL2_10039177 3300003322 Bacteria 5785
5 rootL2_10380535 3300003322 Bacteria 1775
6 rootH1_10008322 3300003323 Bacteria 11667
7 rootH1_10012411 3300003316 Bacteria 9835
8 rootH1_10012411 3300003323 Bacteria 38987
9 rootH1_10129844 3300003323 Unclassified 1847
10 rootH1_10157523 3300003323 Bacteria 4490
11 Ga0055531_10000087 3300003794 Bacteria 101553
12 Ga0065704_10276510 3300005289 Bacteria 931
13 Ga0065712_10001612 3300005290 Bacteria 6881
14 Ga0065715_10091790 3300005293 Bacteria 5549
15 Ga0070658_10770158 3300005327 Bacteria 836
16 Ga0070658_10778372 3300005327 Bacteria 831
17 Ga0070670_100372633 3300005331 Unclassified 1257
18 Ga0068869_100013184 3300005334 Bacteria 5491
19 Ga0068869_100115616 3300005334 Bacteria 2046
20 Ga0070680_100051620 3300005336 Bacteria 3355
21 Ga0070682_100000018 3300005337 Bacteria 229427
22 Ga0070660_100283646 3300005339 Bacteria 1355
23 Ga0070660_100412863 3300005339 Unclassified 1117
24 Ga0070691_10014712 3300005341 Unclassified 3591
25 Ga0070687_100277994 3300005343 Bacteria 1053
26 Ga0070669_100020504 3300005353 Bacteria 4721
27 Ga0070675_100075885 3300005354 Bacteria 2795
28 Ga0070675_100107980 3300005354 Bacteria 2350
29 Ga0070688_100002899 3300005365 Bacteria 8746
30 Ga0070688_100294046 3300005365 Bacteria 1172
31 Ga0070659_100034273 3300005366 Bacteria 3948
32 Ga0070659_100558627 3300005366 Unclassified 980
33 Ga0070701_10057256 3300005438 Unclassified 2042
34 Ga0070681_10757757 3300005458 Unclassified 887
35 Ga0068867_100262049 3300005459 Bacteria 1410
36 Ga0070685_10004800 3300005466 Bacteria 6844
37 Ga0070685_10007831 3300005466 Bacteria 5469
38 Ga0070679_100121956 3300005530 Bacteria 2591
39 Ga0070679_100590447 3300005530 Bacteria 1054
40 Ga0070697_100129915 3300005536 Bacteria 2112
41 Ga0068853_100495557 3300005539 Bacteria 1153
42 Ga0070672_100458424 3300005543 Bacteria 1099
43 Ga0070686_100125411 3300005544 Bacteria 1768
44 Ga0070693_100019417 3300005547 Unclassified 3562
45 Ga0070704_100049577 3300005549 Unclassified 2947
46 Ga0068855_100039739 3300005563 Bacteria 5585
47 Ga0068855_100130744 3300005563 Bacteria 2867
48 Ga0068855_100287144 3300005563 Bacteria 1825
49 Ga0068855_100303391 3300005563 Bacteria 1768
50 Ga0068857_100107148 3300005577 Bacteria 2510
51 Ga0068857_100131761 3300005577 Bacteria 2255
52 Ga0068857_100171285 3300005577 Bacteria 1974
53 Ga0068857_100241182 3300005577 Bacteria 1655
54 Ga0068859_100021816 3300005617 Bacteria 6422
55 Ga0068859_100173027 3300005617 Bacteria 2241
56 Ga0068864_100058532 3300005618 Bacteria 3331
57 Ga0068864_100111010 3300005618 Bacteria 2442
58 Ga0068861_100065917 3300005719 Bacteria 2790
59 Ga0068861_100498966 3300005719 Unclassified 1100
60 Ga0068851_10208063 3300005834 Bacteria 1095
61 Ga0068863_100006763 3300005841 Bacteria 11243
62 Ga0068863_100075646 3300005841 Bacteria 3186
63 Ga0068863_100206510 3300005841 Bacteria 1891
64 Ga0068863_100217200 3300005841 Bacteria 1841
65 Ga0068858_100545287 3300005842 Bacteria 1122
66 Ga0070712_100037157 3300006175 Bacteria 3318
67 Ga0097621_100022498 3300006237 Bacteria 4893
68 Ga0097621_100067635 3300006237 Bacteria 2945
69 Ga0068871_100057028 3300006358 Bacteria 3176
70 Ga0068865_100241747 3300006881 Bacteria 1421
71 Ga0097620_100021817 3300006931 Bacteria 6422
72 Ga0097620_100173022 3300006931 Bacteria 2241
73 Ga0105241_10155298 3300009174 Bacteria 1876
74 Ga0105242_10003477 3300009176 Bacteria 12245
75 Ga0105242_10009040 3300009176 Bacteria 7655
76 Ga0105242_10174547 3300009176 Bacteria 1891
77 Ga0105237_10227547 3300009545 Unclassified 1865
78 Ga0105249_10043585 3300009553 Bacteria 4080
79 Ga0157373_10005869 3300013100 Bacteria 9186
80 Ga0157373_10113251 3300013100 Bacteria 1906
81 Ga0157373_10369288 3300013100 Bacteria 1025
82 Ga0157371_10022112 3300013102 Bacteria 4665
83 Ga0157371_10059445 3300013102 Bacteria 2709
84 Ga0157371_10061308 3300013102 Bacteria 2667
85 Ga0157370_10019864 3300013104 Bacteria 6722
86 Ga0157370_10057910 3300013104 Bacteria 3683
87 Ga0157370_10088444 3300013104 Unclassified 2909
88 Ga0157370_10154870 3300013104 Bacteria 2132
89 Ga0157370_10217591 3300013104 Bacteria 1770
90 Ga0157370_10313125 3300013104 Bacteria 1448
91 Ga0157369_10044156 3300013105 Bacteria 4853
92 Ga0157369_10271052 3300013105 Bacteria 1769
93 Ga0157378_10489052 3300013297 Unclassified 1227
94 Ga0163162_10091167 3300013306 Bacteria 3131
95 Ga0163162_10220056 3300013306 Unclassified 2029
96 Ga0157372_10027272 3300013307 Bacteria 6218
97 Ga0157372_10375523 3300013307 Unclassified 1657
98 Ga0157372_10393444 3300013307 Bacteria 1615
99 Ga0157372_10537056 3300013307 Unclassified 1363
100 Ga0157375_10043658 3300013308 Bacteria 4350
101 Ga0157375_10114817 3300013308 Unclassified 2795
102 Ga0163163_10094317 3300014325 Bacteria 3011
103 Ga0163163_10830251 3300014325 Unclassified 988
104 Ga0157380_10268872 3300014326 Bacteria 1553
105 Ga0157380_10764011 3300014326 Unclassified 979
106 Ga0157380_11231768 3300014326 Bacteria 793
107 Ga0157377_10171473 3300014745 Bacteria 1357
108 Ga0157379_10210224 3300014968 Unclassified 1761
109 Ga0157376_10043448 3300014969 Bacteria 3688
110 Ga0157376_10760170 3300014969 Bacteria 979
111 Ga0163161_10050760 3300017792 Bacteria 3003
112 Ga0209563_110115 3300025230 Unclassified 1393
113 Ga0209050_1010000 3300025298 Bacteria 4745
114 Ga0209257_1000006 3300025304 Bacteria 1570111
115 Ga0207656_10336003 3300025321 Bacteria 752
116 Ga0207682_10014813 3300025893 Bacteria 3037
117 Ga0207654_10319749 3300025911 Bacteria 1060
118 Ga0207707_10004731 3300025912 Bacteria 11943
119 Ga0207695_10052227 3300025913 Unclassified 4283
120 Ga0207660_10048900 3300025917 Bacteria 2994
121 Ga0207660_10259670 3300025917 Unclassified 1373
122 Ga0207662_10020830 3300025918 Unclassified 3743
123 Ga0207657_10072227 3300025919 Bacteria 2920
124 Ga0207657_10136100 3300025919 Bacteria 2010
125 Ga0207652_10004675 3300025921 Bacteria 11106
126 Ga0207652_10080110 3300025921 Bacteria 2854
127 Ga0207652_10827645 3300025921 Bacteria 821
128 Ga0207681_10244790 3300025923 Bacteria 1397
129 Ga0207650_10173549 3300025925 Bacteria 1714
130 Ga0207690_10463746 3300025932 Unclassified 1020
131 Ga0207686_10000655 3300025934 Bacteria 21369
132 Ga0207686_10002008 3300025934 Bacteria 11227
133 Ga0207670_10037122 3300025936 Bacteria 3174
134 Ga0207670_10265531 3300025936 Bacteria 1332
135 Ga0207669_10121406 3300025937 Unclassified 1775
136 Ga0207704_10207941 3300025938 Bacteria 1438
137 Ga0207665_10054789 3300025939 Bacteria 2690
138 Ga0207691_10024080 3300025940 Bacteria 5726
139 Ga0207689_10007242 3300025942 Bacteria 9743
140 Ga0207689_10099250 3300025942 Unclassified 2393
141 Ga0207667_10107222 3300025949 Bacteria 2882
142 Ga0207667_10115589 3300025949 Bacteria 2765
143 Ga0207667_10213247 3300025949 Bacteria 1979
144 Ga0207651_10259647 3300025960 Unclassified 1425
145 Ga0207668_10822426 3300025972 Bacteria 823
146 Ga0207640_10140291 3300025981 Unclassified 1761
147 Ga0207658_10056455 3300025986 Bacteria 2914
148 Ga0207677_10462486 3300026023 Bacteria 1089
149 Ga0207708_10070554 3300026075 Bacteria 2675
150 Ga0207641_10003368 3300026088 Bacteria 14188
151 Ga0207641_10132410 3300026088 Bacteria 2240
152 Ga0207641_10260836 3300026088 Bacteria 1622
153 Ga0207648_10000394 3300026089 Bacteria 48433
154 Ga0207648_10048171 3300026089 Bacteria 3732
155 Ga0207676_10082504 3300026095 Bacteria 2615
156 Ga0207676_10096679 3300026095 Bacteria 2438
157 Ga0207676_10926007 3300026095 Unclassified 856
158 Ga0207674_10045199 3300026116 Unclassified 4531
159 Ga0207674_10121734 3300026116 Bacteria 2576
160 Ga0207674_10128460 3300026116 Bacteria 2499
161 Ga0207674_10989988 3300026116 Unclassified 810
162 Ga0207675_100142475 3300026118 Bacteria 2277
163 Ga0207675_100172335 3300026118 Bacteria 2069
164 Ga0209995_1015558 3300027471 Bacteria 1247
165 Ga0307515_10000016 3300028794 Bacteria 554870
166 Ga0307515_10362386 3300028794 Bacteria 1090
167 Ga0265324_10013304 3300029957 Bacteria 3074
168 Ga0265327_10027018 3300031251 Bacteria 3311
169 Ga0265327_10032889 3300031251 Bacteria 2899
170 Ga0307513_10031311 3300031456 Bacteria 6026
171 Ga0307513_10267957 3300031456 Bacteria 1493
172 Ga0307408_100144399 3300031548 Bacteria 1871
173 Ga0316576_10228923 3300031727 Bacteria 1398
174 Ga0307413_10421822 3300031824 Bacteria 1051
175 Ga0307413_10948157 3300031824 Bacteria 734
176 Ga0316593_10092796 3300032168 Bacteria 1064
177 Ga0316588_1027741 3300033528 Bacteria 1317
178 Ga0373927_0013661 3300035695 Bacteria 5392
179 Ga0373927_0028650 3300035695 Unclassified 3633
180 Ga0395899_0006417 3300037312 Bacteria 9113
181 Ga0395900_0000413 3300037418 Bacteria 61555
182 Ga0395900_1009454 3300037418 Bacteria 752
183 Ga0395898_0002918 3300037466 Bacteria 19458
184 Ga0395898_0023245 3300037466 Bacteria 6264
185 Ga0395905_0000188 3300037471 Bacteria 98070
186 Ga0395905_0000340 3300037471 Bacteria 66412
187 Ga0395905_0001214 3300037471 Bacteria 32159
188 Ga0395901_0002175 3300038443 Bacteria 20011
189 Ga0395901_0023222 3300038443 Bacteria 6357
190 Ga0400483_015018 3300039062 Bacteria 97237
191 Ga0451800_1035709 3300041459 Bacteria 2447
192 Ga0451807_0294302 3300041486 Bacteria 1973
193 Ga0439457_013989 3300042014 Bacteria 1800
194 Ga0451576_0443070 3300045051 Bacteria 1363
195 Ga0495592_0195878 3300046454 Bacteria 1367
196 Ga0495638_0000003 3300046460 Bacteria 888792
197 Ga0495638_0205879 3300046460 Bacteria 1108
198 Ga0495585_0006671 3300046492 Bacteria 7131
199 Ga0495594_0091835 3300046499 Unclassified 1702
200 Ga0495632_0032094 3300046519 Bacteria 2709
201 Ga0495648_0002217 3300046524 Bacteria 18201
202 Ga0495642_0199915 3300046528 Bacteria 871
203 Ga0495621_0088883 3300046539 Bacteria 1162
204 Ga0495668_0000298 3300046616 Bacteria 68412
205 Ga0495625_0000741 3300046660 Bacteria 45531
206 Ga0495604_0118435 3300047317 Unclassified 1920
207 Ga0495636_0000006 3300047318 Bacteria 107323
208 Ga0495614_0163795 3300048089 Unclassified 996
209 Ga0501308_009788 3300049128 Bacteria 1053
210 Ga0501315_001289 3300049531 Bacteria 2098
211 Ga0501032_0049620 3300049569 Bacteria 2832
212 Ga0501033_0168031 3300049570 Bacteria 1576
213 Ga0501034_0007973 3300049571 Bacteria 11244
214 Ga0501034_0060189 3300049571 Unclassified 3815
215 Ga0501034_0232683 3300049571 Bacteria 1791
216 Ga0501036_0077634 3300049572 Bacteria 2810
217 Ga0501037_0023833 3300049573 Bacteria 4526
218 Ga0501037_0057737 3300049573 Bacteria 2833
219 Ga0501038_0027311 3300049574 Bacteria 5079
220 Ga0501039_0219076 3300049575 Bacteria 1496
221 Ga0501043_0007131 3300049579 Bacteria 8892
222 Ga0501046_0313749 3300049580 Bacteria 1143
223 Ga0501046_0459381 3300049580 Bacteria 915
224 Ga0501047_0029872 3300049581 Bacteria 5254
225 Ga0501047_0075349 3300049581 Bacteria 3247
226 Ga0501067_0031651 3300049583 Bacteria 2935
227 Ga0501074_0306038 3300049590 Bacteria 1129
228 Ga0501202_004919 3300049652 Bacteria 2354
229 Ga0501217_003083 3300049661 Bacteria 3338
230 Ga0501217_073200 3300049661 Bacteria 936
231 Ga0501242_000171 3300049674 Bacteria 4930
232 Ga0501250_000045 3300049680 Bacteria 6025
233 Ga0501251_009666 3300049681 Bacteria 1116
234 Ga0501252_008064 3300049682 Bacteria 1205
235 Ga0501253_001584 3300049683 Bacteria 2354
236 Ga0501259_000549 3300049688 Bacteria 6020
237 Ga0501245_004700 3300049708 Bacteria 1879
238 Ga0501266_000164 3300049763 Bacteria 8539
239 Ga0501268_000207 3300049765 Bacteria 5713
240 Ga0501035_0080891 3300049822 Bacteria 2868
241 Ga0501044_0049172 3300049823 Bacteria 4353
242 Ga0501044_0060440 3300049823 Bacteria 3880
243 Ga0501044_0063449 3300049823 Bacteria 3774
244 Ga0501044_0150933 3300049823 Bacteria 2306
245 Ga0501212_013058 3300049851 Bacteria 1215
246 Ga0500578_0000019 3300053086 Bacteria 169042
247 Ga0500650_0183209 3300053098 Bacteria 959
248 Ga0500557_055685 3300053105 Bacteria 1276
249 Ga0500614_022913 3300053123 Bacteria 1463
250 Ga0500616_0000007 3300053153 Bacteria 836875
251 Ga0500611_000021 3300053727 Bacteria 102395
252 Ga0501084_0145589 3300054114 Bacteria 1995
253 Ga0587077_054551 3300059493 Bacteria 847
254 Ga0501082_0083019 3300060353 Bacteria 2764

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10057910 Ga0157370_100579102 201
2 3300049569 Ga0501032_0049620 Ga0501032_0049620_2083_2691 202
3 3300049571 Ga0501034_0007973 Ga0501034_0007973_3601_4209 202
4 3300049572 Ga0501036_0077634 Ga0501036_0077634_1127_1735 202
5 3300049573 Ga0501037_0023833 Ga0501037_0023833_3587_4195 202
6 3300049574 Ga0501038_0027311 Ga0501038_0027311_3050_3658 202
7 3300049575 Ga0501039_0219076 Ga0501039_0219076_684_1292 202
8 3300049579 Ga0501043_0007131 Ga0501043_0007131_6288_6896 202
9 3300049580 Ga0501046_0459381 Ga0501046_0459381_78_686 202
10 3300049581 Ga0501047_0029872 Ga0501047_0029872_500_1108 202
11 3300049822 Ga0501035_0080891 Ga0501035_0080891_1725_2333 202
12 3300049823 Ga0501044_0060440 Ga0501044_0060440_479_1087 202
13 3300049128 Ga0501308_009788 Ga0501308_009788_50_664 204
14 3300003322 rootL2_10019553 rootL2_100195534 205
15 iso_pu_bacteria 3003233435 3003237151 205
16 3300003323 rootH1_10008322 rootH1_100083224 206
17 3300049661 Ga0501217_073200 Ga0501217_073200_33_662 206
18 3300005327 Ga0070658_10778372 Ga0070658_107783721 208
19 3300046460 Ga0495638_0205879 Ga0495638_0205879_321_950 209
20 3300049571 Ga0501034_0060189 Ga0501034_0060189_1384_2013 209
21 3300053727 Ga0500611_000021 Ga0500611_000021_97047_97676 209
22 3300005563 Ga0068855_100303391 Ga0068855_1003033912 210
23 3300013307 Ga0157372_10375523 Ga0157372_103755232 210
24 3300013307 Ga0157372_10537056 Ga0157372_105370561 210
25 3300025949 Ga0207667_10213247 Ga0207667_102132473 210
26 3300003323 rootH1_10157523 rootH1_101575235 211
27 3300009176 Ga0105242_10174547 Ga0105242_101745471 212
28 3300026089 Ga0207648_10000394 Ga0207648_100003948 212
29 3300029957 Ga0265324_10013304 Ga0265324_100133043 212
30 3300005339 Ga0070660_100412863 Ga0070660_1004128631 213
31 3300005341 Ga0070691_10014712 Ga0070691_100147123 213
32 3300005458 Ga0070681_10757757 Ga0070681_107577571 213
33 3300005530 Ga0070679_100590447 Ga0070679_1005904472 213
34 3300005539 Ga0068853_100495557 Ga0068853_1004955571 213
35 3300005547 Ga0070693_100019417 Ga0070693_1000194174 213
36 3300005563 Ga0068855_100287144 Ga0068855_1002871442 213
37 3300009545 Ga0105237_10227547 Ga0105237_102275472 213
38 3300013104 Ga0157370_10088444 Ga0157370_100884443 213
39 3300013104 Ga0157370_10313125 Ga0157370_103131252 213
40 3300013105 Ga0157369_10271052 Ga0157369_102710523 213
41 3300025912 Ga0207707_10004731 Ga0207707_100047315 213
42 3300025913 Ga0207695_10052227 Ga0207695_100522273 213
43 3300025917 Ga0207660_10259670 Ga0207660_102596702 213
44 3300025921 Ga0207652_10004675 Ga0207652_100046753 213
45 3300025921 Ga0207652_10827645 Ga0207652_108276451 213
46 3300031251 Ga0265327_10032889 Ga0265327_100328892 213
47 3300049580 Ga0501046_0313749 Ga0501046_0313749_280_945 213
48 3300049581 Ga0501047_0075349 Ga0501047_0075349_792_1457 213
49 3300049583 Ga0501067_0031651 Ga0501067_0031651_1939_2604 213
50 3300049590 Ga0501074_0306038 Ga0501074_0306038_168_833 213
51 3300049823 Ga0501044_0063449 Ga0501044_0063449_1155_1820 213
52 3300054114 Ga0501084_0145589 Ga0501084_0145589_495_1160 213
53 3300060353 Ga0501082_0083019 Ga0501082_0083019_1838_2503 213
54 3300005617 Ga0068859_100173027 Ga0068859_1001730273 214
55 3300006931 Ga0097620_100173022 Ga0097620_1001730222 214
56 3300013104 Ga0157370_10019864 Ga0157370_100198647 215
57 3300031251 Ga0265327_10027018 Ga0265327_100270183 216
58 3300045051 Ga0451576_0443070 Ga0451576_0443070_330_1019 216
59 3300049823 Ga0501044_0049172 Ga0501044_0049172_640_1308 216
60 3300013104 Ga0157370_10217591 Ga0157370_102175912 217
61 3300049571 Ga0501034_0232683 Ga0501034_0232683_1005_1658 217
62 3300049573 Ga0501037_0057737 Ga0501037_0057737_1248_1901 217
63 3300049823 Ga0501044_0150933 Ga0501044_0150933_1158_1811 217
64 3300042014 Ga0439457_013989 Ga0439457_013989_1120_1776 218
65 3300049674 Ga0501242_000171 Ga0501242_000171_1825_2538 218
66 3300005289 Ga0065704_10276510 Ga0065704_102765101 220
67 3300005563 Ga0068855_100130744 Ga0068855_1001307444 220
68 3300005577 Ga0068857_100241182 Ga0068857_1002411822 220
69 3300006175 Ga0070712_100037157 Ga0070712_1000371575 220
70 3300025949 Ga0207667_10107222 Ga0207667_101072221 220
71 3300026116 Ga0207674_10989988 Ga0207674_109899882 220
72 3300049570 Ga0501033_0168031 Ga0501033_0168031_85_747 220
73 3300003320 rootH2_10069883 rootH2_100698831 221
74 3300005327 Ga0070658_10770158 Ga0070658_107701581 221
75 3300005336 Ga0070680_100051620 Ga0070680_1000516204 221
76 3300005337 Ga0070682_100000018 Ga0070682_100000018115 221
77 3300005366 Ga0070659_100034273 Ga0070659_1000342734 221
78 3300005530 Ga0070679_100121956 Ga0070679_1001219561 221
79 3300005563 Ga0068855_100039739 Ga0068855_1000397397 221
80 3300005577 Ga0068857_100107148 Ga0068857_1001071481 221
81 3300013100 Ga0157373_10113251 Ga0157373_101132513 221
82 3300013102 Ga0157371_10022112 Ga0157371_100221124 221
83 3300013297 Ga0157378_10489052 Ga0157378_104890521 221
84 3300013307 Ga0157372_10027272 Ga0157372_100272721 221
85 3300025917 Ga0207660_10048900 Ga0207660_100489004 221
86 3300025919 Ga0207657_10072227 Ga0207657_100722274 221
87 3300025921 Ga0207652_10080110 Ga0207652_100801104 221
88 3300025949 Ga0207667_10115589 Ga0207667_101155894 221
89 3300026116 Ga0207674_10121734 Ga0207674_101217342 221
90 3300035695 Ga0373927_0028650 Ga0373927_0028650_1229_1897 221
91 3300046454 Ga0495592_0195878 Ga0495592_0195878_544_1212 221
92 3300046460 Ga0495638_0000003 Ga0495638_0000003_633532_634200 222
93 3300053105 Ga0500557_055685 Ga0500557_055685_161_829 222
94 3300053153 Ga0500616_0000007 Ga0500616_0000007_162744_163412 222
95 3300013100 Ga0157373_10005869 Ga0157373_1000586911 223
96 3300013102 Ga0157371_10061308 Ga0157371_100613084 223
97 3300026116 Ga0207674_10045199 Ga0207674_100451995 223
98 3300027471 Ga0209995_1015558 Ga0209995_10155581 223
99 iso_pu_bacteria 2884933994 2884936856 223
100 3300003323 rootH1_10012411 rootH1_1001241119 225
101 3300003323 rootH1_10129844 rootH1_101298442 225
102 3300037471 Ga0395905_0000340 Ga0395905_0000340_25312_25998 225
103 3300005339 Ga0070660_100283646 Ga0070660_1002836462 226
104 3300025919 Ga0207657_10136100 Ga0207657_101361004 226
105 3300025939 Ga0207665_10054789 Ga0207665_100547892 226
106 3300025942 Ga0207689_10099250 Ga0207689_100992501 226
107 3300031824 Ga0307413_10421822 Ga0307413_104218221 226
108 3300032168 Ga0316593_10092796 Ga0316593_100927961 226
109 3300037466 Ga0395898_0023245 Ga0395898_0023245_2275_2961 226
110 3300037471 Ga0395905_0001214 Ga0395905_0001214_22244_22930 226
111 3300038443 Ga0395901_0023222 Ga0395901_0023222_674_1354 226
112 3300046492 Ga0495585_0006671 Ga0495585_0006671_4618_5307 226
113 3300046524 Ga0495648_0002217 Ga0495648_0002217_8509_9198 226
114 3300046616 Ga0495668_0000298 Ga0495668_0000298_10291_10974 226
115 3300046660 Ga0495625_0000741 Ga0495625_0000741_39220_39909 226
116 3300049652 Ga0501202_004919 Ga0501202_004919_1522_2259 226
117 3300049661 Ga0501217_003083 Ga0501217_003083_1131_1868 226
118 3300049680 Ga0501250_000045 Ga0501250_000045_2320_3057 226
119 3300049681 Ga0501251_009666 Ga0501251_009666_57_794 226
120 3300049682 Ga0501252_008064 Ga0501252_008064_250_987 226
121 3300049683 Ga0501253_001584 Ga0501253_001584_257_994 226
122 3300049688 Ga0501259_000549 Ga0501259_000549_4771_5508 226
123 3300049708 Ga0501245_004700 Ga0501245_004700_510_1247 226
124 3300049763 Ga0501266_000164 Ga0501266_000164_1383_2120 226
125 3300049765 Ga0501268_000207 Ga0501268_000207_238_975 226
126 3300049851 Ga0501212_013058 Ga0501212_013058_22_759 226
127 3300053123 Ga0500614_022913 Ga0500614_022913_519_1202 226
128 iso_pu_bacteria 2839989709 2839989928 226
129 3300003322 rootL2_10039177 rootL2_100391776 227
130 3300003794 Ga0055531_10000087 Ga0055531_1000008748 227
131 3300005366 Ga0070659_100558627 Ga0070659_1005586271 227
132 3300025304 Ga0209257_1000006 Ga0209257_1000006373 227
133 3300025932 Ga0207690_10463746 Ga0207690_104637461 227
134 3300037312 Ga0395899_0006417 Ga0395899_0006417_642_1325 227
135 3300037418 Ga0395900_0000413 Ga0395900_0000413_53007_53690 227
136 3300037466 Ga0395898_0002918 Ga0395898_0002918_7209_7892 227
137 3300037471 Ga0395905_0000188 Ga0395905_0000188_44381_45064 227
138 3300038443 Ga0395901_0002175 Ga0395901_0002175_7866_8549 227
139 3300053086 Ga0500578_0000019 Ga0500578_0000019_128671_129387 227
140 3300005293 Ga0065715_10091790 Ga0065715_100917905 228
141 3300005543 Ga0070672_100458424 Ga0070672_1004584242 228
142 3300013307 Ga0157372_10393444 Ga0157372_103934443 228
143 3300014325 Ga0163163_10830251 Ga0163163_108302511 228
144 3300025230 Ga0209563_110115 Ga0209563_1101152 228
145 3300028794 Ga0307515_10000016 Ga0307515_10000016321 228
146 3300028794 Ga0307515_10362386 Ga0307515_103623861 228
147 3300031548 Ga0307408_100144399 Ga0307408_1001443992 228
148 3300031824 Ga0307413_10948157 Ga0307413_109481571 228
149 3300046519 Ga0495632_0032094 Ga0495632_0032094_1233_1922 228
150 3300049531 Ga0501315_001289 Ga0501315_001289_218_904 228
151 3300005577 Ga0068857_100171285 Ga0068857_1001712853 229
152 3300013100 Ga0157373_10369288 Ga0157373_103692881 229
153 3300013102 Ga0157371_10059445 Ga0157371_100594453 229
154 3300013104 Ga0157370_10154870 Ga0157370_101548703 229
155 3300013105 Ga0157369_10044156 Ga0157369_100441566 229
156 3300014326 Ga0157380_11231768 Ga0157380_112317681 229
157 3300025298 Ga0209050_1010000 Ga0209050_10100003 229
158 3300026095 Ga0207676_10926007 Ga0207676_109260071 229
159 3300026116 Ga0207674_10128460 Ga0207674_101284602 229
160 3300031456 Ga0307513_10031311 Ga0307513_100313114 229
161 3300031456 Ga0307513_10267957 Ga0307513_102679572 229
162 3300035695 Ga0373927_0013661 Ga0373927_0013661_2219_2908 229
163 3300037418 Ga0395900_1009454 Ga0395900_1009454_49_738 229
164 3300047317 Ga0495604_0118435 Ga0495604_0118435_236_925 229
165 3300048089 Ga0495614_0163795 Ga0495614_0163795_86_775 229
166 3300053098 Ga0500650_0183209 Ga0500650_0183209_52_741 229
167 3300005331 Ga0070670_100372633 Ga0070670_1003726332 230
168 3300005618 Ga0068864_100058532 Ga0068864_1000585323 230
169 3300005841 Ga0068863_100075646 Ga0068863_1000756466 230
170 3300025925 Ga0207650_10173549 Ga0207650_101735493 230
171 3300026095 Ga0207676_10096679 Ga0207676_100966793 230
172 3300031727 Ga0316576_10228923 Ga0316576_102289231 230
173 3300039062 Ga0400483_015018 Ga0400483_015018_53263_53961 230
174 3300003322 rootL2_10380535 rootL2_103805352 231
175 3300005290 Ga0065712_10001612 Ga0065712_100016124 231
176 3300005334 Ga0068869_100013184 Ga0068869_1000131845 231
177 3300005343 Ga0070687_100277994 Ga0070687_1002779941 231
178 3300005353 Ga0070669_100020504 Ga0070669_1000205042 231
179 3300005354 Ga0070675_100107980 Ga0070675_1001079801 231
180 3300005365 Ga0070688_100002899 Ga0070688_1000028995 231
181 3300005365 Ga0070688_100294046 Ga0070688_1002940462 231
182 3300005438 Ga0070701_10057256 Ga0070701_100572561 231
183 3300005459 Ga0068867_100262049 Ga0068867_1002620492 231
184 3300005466 Ga0070685_10004800 Ga0070685_100048005 231
185 3300005466 Ga0070685_10007831 Ga0070685_100078314 231
186 3300005536 Ga0070697_100129915 Ga0070697_1001299153 231
187 3300005544 Ga0070686_100125411 Ga0070686_1001254111 231
188 3300005549 Ga0070704_100049577 Ga0070704_1000495772 231
189 3300005577 Ga0068857_100131761 Ga0068857_1001317613 231
190 3300005617 Ga0068859_100021816 Ga0068859_1000218165 231
191 3300005618 Ga0068864_100111010 Ga0068864_1001110102 231
192 3300005719 Ga0068861_100065917 Ga0068861_1000659174 231
193 3300005834 Ga0068851_10208063 Ga0068851_102080631 231
194 3300005841 Ga0068863_100006763 Ga0068863_10000676312 231
195 3300005841 Ga0068863_100206510 Ga0068863_1002065102 231
196 3300005841 Ga0068863_100217200 Ga0068863_1002172002 231
197 3300005842 Ga0068858_100545287 Ga0068858_1005452872 231
198 3300006237 Ga0097621_100022498 Ga0097621_1000224985 231
199 3300006358 Ga0068871_100057028 Ga0068871_1000570283 231
200 3300006881 Ga0068865_100241747 Ga0068865_1002417471 231
201 3300006931 Ga0097620_100021817 Ga0097620_1000218175 231
202 3300009174 Ga0105241_10155298 Ga0105241_101552982 231
203 3300009176 Ga0105242_10009040 Ga0105242_100090406 231
204 3300009553 Ga0105249_10043585 Ga0105249_100435851 231
205 3300013306 Ga0163162_10091167 Ga0163162_100911673 231
206 3300013306 Ga0163162_10220056 Ga0163162_102200561 231
207 3300013308 Ga0157375_10043658 Ga0157375_100436584 231
208 3300013308 Ga0157375_10114817 Ga0157375_101148174 231
209 3300014325 Ga0163163_10094317 Ga0163163_100943173 231
210 3300014326 Ga0157380_10764011 Ga0157380_107640111 231
211 3300014745 Ga0157377_10171473 Ga0157377_101714732 231
212 3300014968 Ga0157379_10210224 Ga0157379_102102242 231
213 3300014969 Ga0157376_10043448 Ga0157376_100434482 231
214 3300017792 Ga0163161_10050760 Ga0163161_100507602 231
215 3300025321 Ga0207656_10336003 Ga0207656_103360031 231
216 3300025893 Ga0207682_10014813 Ga0207682_100148133 231
217 3300025911 Ga0207654_10319749 Ga0207654_103197493 231
218 3300025918 Ga0207662_10020830 Ga0207662_100208305 231
219 3300025923 Ga0207681_10244790 Ga0207681_102447902 231
220 3300025934 Ga0207686_10000655 Ga0207686_1000065519 231
221 3300025936 Ga0207670_10037122 Ga0207670_100371223 231
222 3300025936 Ga0207670_10265531 Ga0207670_102655312 231
223 3300025937 Ga0207669_10121406 Ga0207669_101214061 231
224 3300025938 Ga0207704_10207941 Ga0207704_102079412 231
225 3300025940 Ga0207691_10024080 Ga0207691_100240803 231
226 3300025942 Ga0207689_10007242 Ga0207689_100072424 231
227 3300025960 Ga0207651_10259647 Ga0207651_102596471 231
228 3300025972 Ga0207668_10822426 Ga0207668_108224261 231
229 3300025981 Ga0207640_10140291 Ga0207640_101402911 231
230 3300025986 Ga0207658_10056455 Ga0207658_100564553 231
231 3300026023 Ga0207677_10462486 Ga0207677_104624861 231
232 3300026075 Ga0207708_10070554 Ga0207708_100705541 231
233 3300026088 Ga0207641_10003368 Ga0207641_100033686 231
234 3300026088 Ga0207641_10132410 Ga0207641_101324103 231
235 3300026088 Ga0207641_10260836 Ga0207641_102608362 231
236 3300026089 Ga0207648_10048171 Ga0207648_100481712 231
237 3300026095 Ga0207676_10082504 Ga0207676_100825043 231
238 3300026118 Ga0207675_100142475 Ga0207675_1001424754 231
239 3300026118 Ga0207675_100172335 Ga0207675_1001723353 231
240 3300041459 Ga0451800_1035709 Ga0451800_1035709_787_1482 231
241 3300041486 Ga0451807_0294302 Ga0451807_0294302_757_1452 231
242 3300046499 Ga0495594_0091835 Ga0495594_0091835_67_762 231
243 3300046528 Ga0495642_0199915 Ga0495642_0199915_44_739 231
244 3300046539 Ga0495621_0088883 Ga0495621_0088883_165_860 231
245 3300047318 Ga0495636_0000006 Ga0495636_0000006_30825_31520 231
246 3300005334 Ga0068869_100115616 Ga0068869_1001156162 232
247 3300033528 Ga0316588_1027741 Ga0316588_10277411 232
248 3300059493 Ga0587077_054551 Ga0587077_054551_56_754 232
249 iso_pu_bacteria 2818991444 2819588486 232
250 3300005354 Ga0070675_100075885 Ga0070675_1000758852 233
251 3300005719 Ga0068861_100498966 Ga0068861_1004989661 233
252 3300006237 Ga0097621_100067635 Ga0097621_1000676353 233
253 3300009176 Ga0105242_10003477 Ga0105242_1000347710 233
254 3300014326 Ga0157380_10268872 Ga0157380_102688722 233
255 3300014969 Ga0157376_10760170 Ga0157376_107601701 233
256 3300025934 Ga0207686_10002008 Ga0207686_100020087 233
257 3300003316 rootH1_10106547 rootH1_101065473 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01227

GTP_cyclohydroI

GTP cyclohydrolase I

43

222

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fbx-assembly1.cif.gz_A crystal structure of zinc-containing e.coli gtp cyclohydrolase i 0.9616 33 232
1a9c-assembly1.cif.gz_A gtp cyclohydrolase i (c110s mutant) in complex with gtp 0.9603 33 233
1a8r-assembly1.cif.gz_A gtp cyclohydrolase i (h112s mutant) in complex with gtp 0.9596 33 232
4du6-assembly1.cif.gz_E-2 crystal structure of gtp cyclohydrolase i from yersinia pestis complexed with gtp 0.9594 33 232
4du6-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase i from yersinia pestis complexed with gtp 0.959 33 231
ID Description Score Start End Superfamily
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9588 100 232 3.30.1130.10
4du6C01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9486 34 99 1.10.286.10
4du6A01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9477 34 99 1.10.286.10
4du6E01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9465 34 99 1.10.286.10
1n3rM01 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1;GTP cyclohydrolase I, N-terminal domain 0.9428 35 99 1.10.286.10
ID Description Score Start End GO Terms
AF-A0A382L1Q8-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.9846 58 185 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654
AF-A0A3D1E5D5-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.977 30 180 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A0L8VDE2-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.976 37 232 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-A0A2T4WQN7-F1-model_v4 GTP cyclohydrolase 1 (EC 3.5.4.16) (GTP cyclohydrolase I) (GTP-CH-I) 0.9723 30 235 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0006730
GO:0008270
GO:0046654
AF-X1MIN2-F1-model_v4 GTP cyclohydrolase I (EC 3.5.4.16) 0.97 103 195 GO:0003934
GO:0005525
GO:0005737
GO:0006729
GO:0008270
GO:0046654

Feature Viewer

pLDDT pTM Quality
85.59 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map