F367241

General Info

Members Datasets Scaffolds Average Seq Length
257 176 514 313

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10036701|Ga0105244_100367012
Length 353
Sequence MERVNSAEPSQPRTVELLPVRVQGTGNEEEPIMAVQHTDKVQKIDLRGRDFIEFTDYTAEEIRYLLDLAIEIKGKQKSGVPFQPLKGKTIGLIFEKSSTRTRVSFEVGMFQLGGHALFLSKNDIQLGRGETTHDTAKVLSRYLDGIMIRTFGHHNVIELAEHADVPVINGLSDAAHPCQVLADFQTVLEHKGKLAGLKMAYVGDGNNMAHSLMLGAAKMGMHVAVATPEGYEPDSTVVEQARAIAQESGSEVVVTYSAQEAVKDADIVYTDVWASMGFEEEQKIREQAFAAYQVDEELMKGAKPDYMFLHCLPAHRGEEVSAGVIDGPNSLIFDQAENRLHAQKALMAALMSE

Samples

Sample ID Description Type Environment
1 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
17 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
21 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
22 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
23 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
26 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
31 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
32 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
33 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
36 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
37 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
38 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
53 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
54 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
55 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
56 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
57 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
58 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
59 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
60 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
61 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
62 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
63 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
64 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
70 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
75 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
76 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
77 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
82 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
95 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
96 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
97 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
98 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
99 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
100 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
104 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
105 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
106 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
107 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
108 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
109 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
110 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
111 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
112 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
113 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
114 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
115 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
116 2643221735 Bacillus sp. Root920 Isolate Unclassified
117 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
118 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
119 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
120 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
121 2738541295 Bacillus sp. OK085 Isolate Unclassified
122 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
123 2738543010 Bacillus sp. YR335 Isolate Unclassified
124 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
125 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
126 2842682962 Bacillus sp. R-72492 Isolate Unclassified
127 2849139964 Bacillus sp. R-71875 Isolate Unclassified
128 2860837431 Bacillus sp. WR11 Isolate Unclassified
129 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
130 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
131 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
132 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
133 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
134 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
135 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
136 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
137 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
138 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
139 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
140 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
141 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
142 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
143 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
144 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
145 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
146 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
147 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
148 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
149 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
150 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
151 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
152 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
153 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
154 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
155 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
156 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
157 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
158 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
159 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
160 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
161 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
162 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
163 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
164 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
165 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
166 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
167 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
168 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
169 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
170 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
171 8022653035 Bacillus sp. Rc4 Isolate Unclassified
172 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
173 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
174 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
175 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
176 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 70.43
Metatranscriptomes 1.95
Isolates 27.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0
Endosphere 3.11
Nodule 0
Rhizoplane 1.56
Rhizosphere 66.93
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105244_10036701 3300009036 Bacteria 2566
2 JGI25162J39368_1005439 3300002737 Bacteria 2499
3 Ga0006562J51391_1002675 3300003578 Bacteria 12360
4 Ga0055538_1000384 3300003751 Bacteria 18126
5 Ga0070694_100000026 3300005444 Bacteria 68351
6 Ga0070708_100001346 3300005445 Bacteria 18798
7 Ga0070708_100005485 3300005445 Bacteria 10057
8 Ga0070708_100213125 3300005445 Bacteria 1810
9 Ga0070706_100000104 3300005467 Bacteria 103774
10 Ga0070707_100318783 3300005468 Bacteria 1511
11 Ga0070698_100248327 3300005471 Bacteria 1712
12 Ga0070699_100092823 3300005518 Bacteria 2641
13 Ga0070699_100186618 3300005518 Bacteria 1841
14 Ga0070697_100191283 3300005536 Bacteria 1737
15 Ga0070664_100206345 3300005564 Bacteria 1755
16 Ga0068858_100387696 3300005842 Bacteria 1341
17 Ga0081538_10011776 3300005981 Bacteria 7058
18 Ga0081538_10028380 3300005981 Bacteria 3850
19 Ga0081538_10045622 3300005981 Bacteria 2714
20 Ga0081539_10000707 3300005985 Bacteria 66881
21 Ga0081539_10043944 3300005985 Bacteria 2584
22 Ga0099794_10011872 3300007265 Bacteria 3744
23 Ga0099794_10020512 3300007265 Bacteria 2992
24 Ga0099794_10099553 3300007265 Bacteria 1450
25 Ga0105251_10032449 3300009011 Bacteria 2602
26 Ga0105244_10045700 3300009036 Bacteria 2252
27 Ga0105244_10100187 3300009036 Bacteria 1418
28 Ga0105244_10103083 3300009036 Bacteria 1394
29 Ga0111539_10203032 3300009094 Bacteria 2311
30 Ga0114129_10027702 3300009147 Bacteria 8022
31 Ga0114129_10066480 3300009147 Bacteria 5030
32 Ga0105246_10001176 3300011119 Bacteria 15193
33 Ga0157371_10080917 3300013102 Bacteria 2300
34 Ga0163162_10275118 3300013306 Bacteria 1816
35 Ga0209784_100075 3300025224 Bacteria 139902
36 Ga0209566_100230 3300025225 Bacteria 54216
37 Ga0209566_106565 3300025225 Bacteria 1367
38 Ga0209437_100453 3300025233 Bacteria 33692
39 Ga0209675_1015208 3300025291 Bacteria 2298
40 Ga0209025_1000001 3300025294 Bacteria 1888151
41 Ga0207684_10000044 3300025910 Bacteria 258218
42 Ga0209588_1018481 3300027671 Bacteria 2171
43 Ga0265326_10009247 3300028558 Unclassified 2945
44 Ga0265318_10060980 3300028577 Bacteria 1405
45 Ga0265332_10005895 3300031238 Bacteria 5605
46 Ga0265316_10006463 3300031344 Bacteria 11188
47 Ga0307408_100013757 3300031548 Bacteria 5372
48 Ga0265313_10003982 3300031595 Bacteria 11601
49 Ga0316575_10000346 3300031665 Bacteria 13099
50 Ga0316575_10027585 3300031665 Bacteria 2209
51 Ga0316579_10008099 3300031691 Bacteria 4368
52 Ga0316579_10059360 3300031691 Bacteria 1798
53 Ga0265342_10000009 3300031712 Bacteria 220210
54 Ga0265342_10087414 3300031712 Unclassified 1791
55 Ga0316576_10007548 3300031727 Bacteria 6860
56 Ga0316576_10009415 3300031727 Bacteria 6301
57 Ga0316576_10018173 3300031727 Bacteria 4793
58 Ga0316576_10018593 3300031727 Bacteria 4747
59 Ga0316576_10030809 3300031727 Bacteria 3801
60 Ga0316576_10077968 3300031727 Bacteria 2454
61 Ga0316576_10088381 3300031727 Bacteria 2307
62 Ga0316576_10107699 3300031727 Archaea 2088
63 Ga0316576_10225782 3300031727 Bacteria 1408
64 Ga0316578_10017576 3300031728 Bacteria 3895
65 Ga0316578_10072255 3300031728 Bacteria 2043
66 Ga0316577_10017446 3300031733 Bacteria 3963
67 Ga0316577_10023393 3300031733 Bacteria 3431
68 Ga0316577_10052188 3300031733 Bacteria 2281
69 Ga0316577_10128227 3300031733 Bacteria 1427
70 Ga0307413_10075437 3300031824 Bacteria 2140
71 Ga0307410_10020849 3300031852 Bacteria 4019
72 Ga0307406_10051460 3300031901 Bacteria 2615
73 Ga0307407_10042992 3300031903 Bacteria 2537
74 Ga0307407_10103077 3300031903 Bacteria 1775
75 Ga0307407_10138344 3300031903 Bacteria 1568
76 Ga0307412_10034230 3300031911 Bacteria 3237
77 Ga0307409_100126286 3300031995 Bacteria 2176
78 Ga0307416_100054523 3300032002 Bacteria 3214
79 Ga0307416_100080327 3300032002 Bacteria 2752
80 Ga0307414_10160932 3300032004 Bacteria 1783
81 Ga0307414_10477141 3300032004 Bacteria 1099
82 Ga0307411_10008952 3300032005 Bacteria 5226
83 Ga0307415_100033889 3300032126 Bacteria 3318
84 Ga0307415_100291272 3300032126 Bacteria 1348
85 Ga0316583_10003206 3300032133 Bacteria 5753
86 Ga0316583_10022353 3300032133 Bacteria 2264
87 Ga0316583_10023556 3300032133 Bacteria 2199
88 Ga0316583_10047377 3300032133 Bacteria 1516
89 Ga0316574_0001100 3300035398 Bacteria 12378
90 Ga0316574_0025218 3300035398 Bacteria 3567
91 Ga0316574_0036985 3300035398 Bacteria 2991
92 Ga0316574_0085330 3300035398 Bacteria 2009
93 Ga0316582_0010019 3300036647 Bacteria 5171
94 Ga0316582_0019434 3300036647 Bacteria 3976
95 Ga0316582_0060778 3300036647 Bacteria 2423
96 Ga0316582_0104517 3300036647 Bacteria 1879
97 Ga0316582_0236331 3300036647 Bacteria 1251
98 Ga0316582_0373896 3300036647 Bacteria 981
99 Ga0316582_0400021 3300036647 Bacteria 946
100 Ga0316584_0018874 3300036712 Bacteria 4979
101 Ga0316584_0075098 3300036712 Bacteria 2534
102 Ga0316584_0088837 3300036712 Bacteria 2314
103 Ga0316584_0180168 3300036712 Bacteria 1564
104 Ga0316584_0266689 3300036712 Bacteria 1247
105 Ga0316581_0005060 3300037588 Bacteria 3407
106 Ga0400484_21093 3300038725 Bacteria 30201
107 Ga0400490_30992 3300038726 Bacteria 11068
108 Ga0400490_31716 3300038726 Bacteria 1608
109 Ga0400490_60561 3300038726 Bacteria 10314
110 Ga0400491_01477 3300038727 Bacteria 11544
111 Ga0400485_05769 3300038735 Bacteria 13446
112 Ga0400485_13295 3300038735 Bacteria 2343
113 Ga0400485_21360 3300038735 Bacteria 2349
114 Ga0400486_02353 3300038742 Bacteria 2835
115 Ga0400486_02364 3300038742 Bacteria 5955
116 Ga0400486_03860 3300038742 Bacteria 65081
117 Ga0400486_10548 3300038742 Bacteria 2281
118 Ga0400486_19528 3300038742 Bacteria 1218
119 Ga0400483_083197 3300039062 Bacteria 151799
120 Ga0400483_146965 3300039062 Bacteria 18835
121 Ga0400483_169151 3300039062 Bacteria 15152
122 Ga0400483_184129 3300039062 Bacteria 3981
123 Ga0400483_278855 3300039062 Bacteria 1102
124 Ga0400489_19285 3300039093 Bacteria 25488
125 Ga0400489_35967 3300039093 Bacteria 4316
126 Ga0400489_42824 3300039093 Bacteria 20644
127 Ga0400489_62576 3300039093 Bacteria 4294
128 Ga0400487_37382 3300039110 Bacteria 1644
129 Ga0400487_50061 3300039110 Unclassified 4792
130 Ga0400487_54206 3300039110 Bacteria 2355
131 Ga0436365_0721206 3300039437 Bacteria 8915
132 Ga0439439_0000238 3300041406 Bacteria 8611
133 Ga0439433_0002441 3300041999 Bacteria 3942
134 Ga0439449_0000214 3300042007 Bacteria 20492
135 Ga0439457_024337 3300042014 Bacteria 1340
136 Ga0439462_0000480 3300042015 Bacteria 7856
137 Ga0451577_0027619 3300042876 Bacteria 5138
138 Ga0451577_0077731 3300042876 Bacteria 2959
139 Ga0451577_0101223 3300042876 Bacteria 2574
140 Ga0453684_0072695 3300044712 Bacteria 4340
141 Ga0453684_0119621 3300044712 Bacteria 3183
142 Ga0451576_0120060 3300045051 Bacteria 2737
143 Ga0495627_053838 3300046453 Bacteria 1204
144 Ga0495588_0186126 3300046674 Bacteria 1097
145 Ga0495660_0200474 3300046810 Bacteria 953
146 Ga0496101_0060287 3300048904 Bacteria 2753
147 Ga0496110_0177080 3300048913 Bacteria 1936
148 Ga0496112_0209819 3300048915 Bacteria 1905
149 Ga0496116_0005053 3300048919 Bacteria 12411
150 Ga0496116_0007212 3300048919 Bacteria 9923
151 Ga0496116_0037501 3300048919 Bacteria 3379
152 Ga0496116_0042902 3300048919 Bacteria 3087
153 Ga0496119_0000316 3300048922 Bacteria 67705
154 Ga0496120_0002629 3300048923 Bacteria 17792
155 Ga0496122_0005848 3300048925 Bacteria 14445
156 Ga0496122_0013623 3300048925 Bacteria 7938
157 Ga0496123_0036489 3300048926 Unclassified 3486
158 Ga0496123_0055685 3300048926 Bacteria 2592
159 Ga0496124_0000976 3300048927 Bacteria 45516
160 Ga0496124_0052906 3300048927 Bacteria 3447
161 Ga0496125_0008884 3300048928 Bacteria 10433
162 Ga0496126_0002425 3300048929 Bacteria 25239
163 Ga0496126_0003416 3300048929 Bacteria 20076
164 Ga0501309_003696 3300049129 Bacteria 1746
165 Ga0501315_000220 3300049531 Bacteria 3515
166 Ga0501316_001090 3300049532 Bacteria 2196
167 Ga0501316_001504 3300049532 Bacteria 1996
168 Ga0501031_0089147 3300049568 Bacteria 2011
169 Ga0501041_0195096 3300049577 Bacteria 1269
170 Ga0501041_0228639 3300049577 Bacteria 1168
171 Ga0501041_0256202 3300049577 Bacteria 1100
172 Ga0501068_0158454 3300049584 Bacteria 1426
173 Ga0501072_0079254 3300049588 Bacteria 2601
174 Ga0501075_0244783 3300049591 Bacteria 1367
175 Ga0501198_009562 3300049649 Bacteria 1425
176 Ga0501217_009591 3300049661 Bacteria 2108
177 Ga0501259_014650 3300049688 Bacteria 1332
178 Ga0501261_008550 3300049690 Bacteria 1324
179 Ga0501080_0219054 3300049742 Bacteria 1742
180 nmdc:mga05p37_26578_c1 3300050507 Bacteria 7038
181 nmdc:mga05p37_735917_c1 3300050507 Bacteria 1090
182 Ga0501084_0208775 3300054114 Bacteria 1648
183 Ga0590075_025284 3300059424 Bacteria 1492
184 Ga0590077_006320 3300059426 Bacteria 2430
185 Ga0530510_0065645 3300061734 Bacteria 2630
186 Ga0530510_0206694 3300061734 Bacteria 1459
187 2550904444 2548877040 Bacteria 7507281
188 2571530745 2571042143 Bacteria 6986194
189 2573040712 2571042588 Bacteria 5045676
190 2578339006 2576861424 Bacteria 5270569
191 2580934816 2579778775 Bacteria 5360914
192 2601640453 2600255286 Bacteria 5390125
193 2621277454 2619619294 Bacteria 5575484
194 2631984958 2630968484 Bacteria 3876276
195 2643736911 2643221543 Bacteria 6628015
196 2644423345 2643221676 Bacteria 8119172
197 2644739438 2643221735 Bacteria 3676263
198 2651530052 2648501850 Bacteria 3975476
199 2695626958 2695420354 Bacteria 3922431
200 2717917230 2716884898 Bacteria 3928789
201 2728531434 2728368933 Bacteria 7044283
202 2738817246 2738541295 Bacteria 5730091
203 2738838266 2738541299 Bacteria 4020721
204 2739232062 2738543010 Bacteria 5583595
205 2816863572 2816332186 Bacteria 5331395
206 2821118199 2821111986 Bacteria 6894338
207 2842685525 2842682962 Bacteria 5589973
208 2849140475 2849139964 Bacteria 5613304
209 2860838642 2860837431 Bacteria 4202080
210 2864736463 2864733723 Bacteria 6770668
211 2877769775 2877768649 Bacteria 3957164
212 2880170774 2880169592 Bacteria 3900066
213 2881638048 2881636855 Bacteria 5205297
214 2885529840 2885526491 Bacteria 7164189
215 2888584525 2888578766 Bacteria 6743310
216 2889048092 2889042446 Bacteria 7618936
217 2897110759 2897109615 Bacteria 4009619
218 2904168068 2904162308 Bacteria 7086713
219 2904494360 2904490793 Bacteria 7046938
220 2907207306 2907202186 Bacteria 6632024
221 2908666356 2908665501 Bacteria 3678115
222 2919093527 2919093281 Bacteria 3660974
223 2919165122 2919160200 Bacteria 6929020
224 2919415709 2919414237 Bacteria 5429133
225 2929207042 2929206907 Bacteria 5918291
226 2931385198 2931384279 Bacteria 7299545
227 2936364523 2936361878 Bacteria 5632809
228 2938652537 2938649242 Bacteria 7118381
229 2939680626 2939679117 Bacteria 6921672
230 2939706807 2939702853 Bacteria 5139229
231 2945996160 2945991243 Bacteria 7008369
232 2954775068 2954773129 Bacteria 3741715
233 2962292027 2962290636 Bacteria 4072939
234 2968559299 2968558590 Bacteria 6956864
235 2969138047 2969136845 Bacteria 3923176
236 2969771831 2969770375 Bacteria 4271280
237 2971410378 2971403814 Bacteria 7370929
238 2971514400 2971511577 Bacteria 5404012
239 2971894524 2971893375 Bacteria 3929648
240 2980180614 2980176882 Bacteria 5397533
241 2980190073 2980182181 Bacteria 9454109
242 2980493824 2980492589 Bacteria 4072961
243 2984531261 2984527788 Bacteria 5288478
244 2984537371 2984532647 Bacteria 5288506
245 2988227430 2988225383 Bacteria 7221625
246 2996637771 2996632988 Bacteria 6921523
247 3001273235 3001272096 Bacteria 4729684
248 3001895452 3001892409 Bacteria 6328293
249 3006989472 3006988479 Bacteria 4767936
250 8002324562 8002317523 Bacteria 8051857
251 8022633985 8022630665 Bacteria 3886130
252 8022655214 8022653035 Bacteria 4035078
253 8046997236 8046991243 Bacteria 8497463
254 8051953402 8051952484 Bacteria 3926774
255 8054471426 8054465665 Bacteria 7323556
256 8055633204 8055632911 Bacteria 5283357
257 8057981389 8057977335 Bacteria 5694872
258 Ga0105244_10036701
259 JGI25162J39368_1005439
260 Ga0006562J51391_1002675
261 Ga0055538_1000384
262 Ga0070694_100000026
263 Ga0070708_100001346
264 Ga0070708_100005485
265 Ga0070708_100213125
266 Ga0070706_100000104
267 Ga0070707_100318783
268 Ga0070698_100248327
269 Ga0070699_100092823
270 Ga0070699_100186618
271 Ga0070697_100191283
272 Ga0070664_100206345
273 Ga0068858_100387696
274 Ga0081538_10011776
275 Ga0081538_10028380
276 Ga0081538_10045622
277 Ga0081539_10000707
278 Ga0081539_10043944
279 Ga0099794_10011872
280 Ga0099794_10020512
281 Ga0099794_10099553
282 Ga0105251_10032449
283 Ga0105244_10045700
284 Ga0105244_10100187
285 Ga0105244_10103083
286 Ga0111539_10203032
287 Ga0114129_10027702
288 Ga0114129_10066480
289 Ga0105246_10001176
290 Ga0157371_10080917
291 Ga0163162_10275118
292 Ga0209784_100075
293 Ga0209566_100230
294 Ga0209566_106565
295 Ga0209437_100453
296 Ga0209675_1015208
297 Ga0209025_1000001
298 Ga0207684_10000044
299 Ga0209588_1018481
300 Ga0265326_10009247
301 Ga0265318_10060980
302 Ga0265332_10005895
303 Ga0265316_10006463
304 Ga0307408_100013757
305 Ga0265313_10003982
306 Ga0316575_10000346
307 Ga0316575_10027585
308 Ga0316579_10008099
309 Ga0316579_10059360
310 Ga0265342_10000009
311 Ga0265342_10087414
312 Ga0316576_10007548
313 Ga0316576_10009415
314 Ga0316576_10018173
315 Ga0316576_10018593
316 Ga0316576_10030809
317 Ga0316576_10077968
318 Ga0316576_10088381
319 Ga0316576_10107699
320 Ga0316576_10225782
321 Ga0316578_10017576
322 Ga0316578_10072255
323 Ga0316577_10017446
324 Ga0316577_10023393
325 Ga0316577_10052188
326 Ga0316577_10128227
327 Ga0307413_10075437
328 Ga0307410_10020849
329 Ga0307406_10051460
330 Ga0307407_10042992
331 Ga0307407_10103077
332 Ga0307407_10138344
333 Ga0307412_10034230
334 Ga0307409_100126286
335 Ga0307416_100054523
336 Ga0307416_100080327
337 Ga0307414_10160932
338 Ga0307414_10477141
339 Ga0307411_10008952
340 Ga0307415_100033889
341 Ga0307415_100291272
342 Ga0316583_10003206
343 Ga0316583_10022353
344 Ga0316583_10023556
345 Ga0316583_10047377
346 Ga0316574_0001100
347 Ga0316574_0025218
348 Ga0316574_0036985
349 Ga0316574_0085330
350 Ga0316582_0010019
351 Ga0316582_0019434
352 Ga0316582_0060778
353 Ga0316582_0104517
354 Ga0316582_0236331
355 Ga0316582_0373896
356 Ga0316582_0400021
357 Ga0316584_0018874
358 Ga0316584_0075098
359 Ga0316584_0088837
360 Ga0316584_0180168
361 Ga0316584_0266689
362 Ga0316581_0005060
363 Ga0400484_21093
364 Ga0400490_30992
365 Ga0400490_31716
366 Ga0400490_60561
367 Ga0400491_01477
368 Ga0400485_05769
369 Ga0400485_13295
370 Ga0400485_21360
371 Ga0400486_02353
372 Ga0400486_02364
373 Ga0400486_03860
374 Ga0400486_10548
375 Ga0400486_19528
376 Ga0400483_083197
377 Ga0400483_146965
378 Ga0400483_169151
379 Ga0400483_184129
380 Ga0400483_278855
381 Ga0400489_19285
382 Ga0400489_35967
383 Ga0400489_42824
384 Ga0400489_62576
385 Ga0400487_37382
386 Ga0400487_50061
387 Ga0400487_54206
388 Ga0436365_0721206
389 Ga0439439_0000238
390 Ga0439433_0002441
391 Ga0439449_0000214
392 Ga0439457_024337
393 Ga0439462_0000480
394 Ga0451577_0027619
395 Ga0451577_0077731
396 Ga0451577_0101223
397 Ga0453684_0072695
398 Ga0453684_0119621
399 Ga0451576_0120060
400 Ga0495627_053838
401 Ga0495588_0186126
402 Ga0495660_0200474
403 Ga0496101_0060287
404 Ga0496110_0177080
405 Ga0496112_0209819
406 Ga0496116_0005053
407 Ga0496116_0007212
408 Ga0496116_0037501
409 Ga0496116_0042902
410 Ga0496119_0000316
411 Ga0496120_0002629
412 Ga0496122_0005848
413 Ga0496122_0013623
414 Ga0496123_0036489
415 Ga0496123_0055685
416 Ga0496124_0000976
417 Ga0496124_0052906
418 Ga0496125_0008884
419 Ga0496126_0002425
420 Ga0496126_0003416
421 Ga0501309_003696
422 Ga0501315_000220
423 Ga0501316_001090
424 Ga0501316_001504
425 Ga0501031_0089147
426 Ga0501041_0195096
427 Ga0501041_0228639
428 Ga0501041_0256202
429 Ga0501068_0158454
430 Ga0501072_0079254
431 Ga0501075_0244783
432 Ga0501198_009562
433 Ga0501217_009591
434 Ga0501259_014650
435 Ga0501261_008550
436 Ga0501080_0219054
437 nmdc:mga05p37_26578_c1
438 nmdc:mga05p37_735917_c1
439 Ga0501084_0208775
440 Ga0590075_025284
441 Ga0590077_006320
442 Ga0530510_0065645
443 Ga0530510_0206694
444 2550904444
445 2571530745
446 2573040712
447 2578339006
448 2580934816
449 2601640453
450 2621277454
451 2631984958
452 2643736911
453 2644423345
454 2644739438
455 2651530052
456 2695626958
457 2717917230
458 2728531434
459 2738817246
460 2738838266
461 2739232062
462 2816863572
463 2821118199
464 2842685525
465 2849140475
466 2860838642
467 2864736463
468 2877769775
469 2880170774
470 2881638048
471 2885529840
472 2888584525
473 2889048092
474 2897110759
475 2904168068
476 2904494360
477 2907207306
478 2908666356
479 2919093527
480 2919165122
481 2919415709
482 2929207042
483 2931385198
484 2936364523
485 2938652537
486 2939680626
487 2939706807
488 2945996160
489 2954775068
490 2962292027
491 2968559299
492 2969138047
493 2969771831
494 2971410378
495 2971514400
496 2971894524
497 2980180614
498 2980190073
499 2980493824
500 2984531261
501 2984537371
502 2988227430
503 2996637771
504 3001273235
505 3001895452
506 3006989472
507 8002324562
508 8022633985
509 8022655214
510 8046997236
511 8051953402
512 8054471426
513 8055633204
514 8057981389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00185

OTCace

Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain

195

350

0.99

PF02729

OTCace_N

Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain

49

189

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1a1s-assembly1.cif.gz_A ornithine carbamoyltransferase from pyrococcus furiosus 0.9818 11 319
1dxh-assembly1.cif.gz_A catabolic ornithine carbamoyltransferase from pseudomonas aeruginosa 0.9736 11 321
1vlv-assembly1.cif.gz_A crystal structure of ornithine carbamoyltransferase (tm1097) from thermotoga maritima at 2.25 a resolution 0.9705 11 319
3upd-assembly1.cif.gz_A 2.9 angstrom crystal structure of ornithine carbamoyltransferase (argf) from vibrio vulnificus 0.9701 14 321
4f2g-assembly1.cif.gz_A the crystal structure of ornithine carbamoyltransferase from burkholderia thailandensis e264 0.97 17 319
ID Description Score Start End Superfamily
af_E9QHD9_33_172_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9821 12 149 3.40.50.1370
4a8pF01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9809 16 159 3.40.50.1370
af_O50039_80_205_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9786 24 147 3.40.50.1370
af_Q2FUX8_12_142_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9762 16 145 3.40.50.1370
af_P05150_153_315_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9731 164 305 3.40.50.1370
ID Description Score Start End GO Terms
AF-A0A7V4Q8K6-F1-model_v4 Ornithine carbamoyltransferase 0.9965 17 134 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A7W0ZA55-F1-model_v4 Ornithine carbamoyltransferase (EC 2.1.3.3) 0.9942 29 155 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A316RJP8-F1-model_v4 deleted 0.9917 17 212
AF-A0A3D1HBA6-F1-model_v4 Ornithine carbamoyltransferase (EC 2.1.3.3) 0.9908 59 180 GO:0004585
GO:0016597
GO:0019240
GO:0042450
AF-A0A5C0NTW3-F1-model_v4 ornithine carbamoyltransferase (EC 2.1.3.3) 0.9904 102 191 GO:0006526
GO:0016597
GO:0016743

Map