F366900

General Info

Members Datasets Scaffolds Average Seq Length
256 130 256 154

Family's Representative Sequence

Representative Sequence 3300053146|Ga0500588_0117519|Ga0500588_0117519_355_891
Length 178
Sequence LVVEVDSSYHRDSDRWLEERRGMEKETVLIVDDEEMVLTSLSTYLMLETSYDVVTFTSAVRALSHLEANDVGVIISDFLMPEMDGITFLAKAKELRPDAPRVILTGYADKENAIKAINLVGLYQYVEKPWDNDDIRLIIRNGLEKKQLLAKLTQKVTQINQAYGELQSIQQEILKAFA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
109 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
120 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
121 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
128 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
130 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 0.39
Rhizosphere 98.05
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_1486547 2162886012 Unclassified 1047
2 Ga0065712_10511720 3300005290 Unclassified 642
3 Ga0065707_10252312 3300005295 Bacteria 1121
4 Ga0070676_10407555 3300005328 Unclassified 947
5 Ga0070690_100053654 3300005330 Bacteria 2579
6 Ga0070670_100007669 3300005331 Bacteria 9172
7 Ga0070670_100670563 3300005331 Bacteria 931
8 Ga0070670_101153643 3300005331 Unclassified 707
9 Ga0068869_100536378 3300005334 Unclassified 981
10 Ga0068869_101354215 3300005334 Bacteria 629
11 Ga0070666_10031030 3300005335 Bacteria 3526
12 Ga0070666_10162055 3300005335 Unclassified 1564
13 Ga0070689_100843291 3300005340 Bacteria 808
14 Ga0070687_100072297 3300005343 Bacteria 1856
15 Ga0070687_100312665 3300005343 Bacteria 1001
16 Ga0070669_100326708 3300005353 Unclassified 1240
17 Ga0070675_100000186 3300005354 Bacteria 38682
18 Ga0070675_100002661 3300005354 Bacteria 13429
19 Ga0070675_100092313 3300005354 Bacteria 2538
20 Ga0070675_100342556 3300005354 Bacteria 1324
21 Ga0070671_100025878 3300005355 Unclassified 4818
22 Ga0070671_101787181 3300005355 Unclassified 546
23 Ga0070673_100035216 3300005364 Bacteria 3794
24 Ga0070688_100003875 3300005365 Bacteria 7753
25 Ga0070688_100023348 3300005365 Unclassified 3636
26 Ga0070688_100137982 3300005365 Bacteria 1653
27 Ga0070667_100004413 3300005367 Bacteria 11865
28 Ga0070667_101253066 3300005367 Unclassified 694
29 Ga0070701_10276302 3300005438 Unclassified 1024
30 Ga0070700_100120179 3300005441 Bacteria 1759
31 Ga0070700_100260747 3300005441 Unclassified 1248
32 Ga0070700_100784822 3300005441 Bacteria 766
33 Ga0070694_100952740 3300005444 Unclassified 711
34 Ga0070708_101330101 3300005445 Unclassified 671
35 Ga0070663_100053388 3300005455 Bacteria 2885
36 Ga0070678_100232618 3300005456 Bacteria 1537
37 Ga0070662_100448820 3300005457 Bacteria 1070
38 Ga0068867_100500492 3300005459 Unclassified 1044
39 Ga0070685_10003680 3300005466 Bacteria 7774
40 Ga0070685_10021429 3300005466 Unclassified 3513
41 Ga0070685_11050636 3300005466 Unclassified 613
42 Ga0070672_100009476 3300005543 Bacteria 6715
43 Ga0070672_100236631 3300005543 Bacteria 1535
44 Ga0070686_100028159 3300005544 Bacteria 3406
45 Ga0070665_101032019 3300005548 Bacteria 834
46 Ga0070704_100469966 3300005549 Bacteria 1086
47 Ga0070664_100001428 3300005564 Bacteria 19055
48 Ga0070664_100205833 3300005564 Unclassified 1757
49 Ga0070664_100504628 3300005564 Unclassified 1115
50 Ga0068857_100086547 3300005577 Bacteria 2802
51 Ga0068852_102414085 3300005616 Bacteria 546
52 Ga0068859_100002963 3300005617 Bacteria 17215
53 Ga0068859_100054690 3300005617 Bacteria 4016
54 Ga0068864_100601395 3300005618 Bacteria 1067
55 Ga0068864_101650237 3300005618 Unclassified 645
56 Ga0068861_100000809 3300005719 Bacteria 18893
57 Ga0068861_100170353 3300005719 Bacteria 1804
58 Ga0068861_102358393 3300005719 Unclassified 534
59 Ga0068870_10286788 3300005840 Bacteria 1034
60 Ga0068870_10313788 3300005840 Bacteria 994
61 Ga0068863_100000691 3300005841 Bacteria 33929
62 Ga0068858_100019033 3300005842 Bacteria 6425
63 Ga0068860_100010281 3300005843 Bacteria 9259
64 Ga0068860_100857911 3300005843 Bacteria 923
65 Ga0068860_101092955 3300005843 Unclassified 817
66 Ga0068862_100853959 3300005844 Unclassified 892
67 Ga0070716_100374005 3300006173 Bacteria 1016
68 Ga0097621_100001239 3300006237 Bacteria 17655
69 Ga0097621_101670011 3300006237 Bacteria 606
70 Ga0068871_100023796 3300006358 Bacteria 4743
71 Ga0068871_100386672 3300006358 Unclassified 1244
72 Ga0075428_100056644 3300006844 Bacteria 4293
73 Ga0075428_100093050 3300006844 Bacteria 3286
74 Ga0075428_100211986 3300006844 Bacteria 2093
75 Ga0075428_100527127 3300006844 Unclassified 1263
76 Ga0075428_100896579 3300006844 Unclassified 941
77 Ga0075428_101270897 3300006844 Unclassified 775
78 Ga0075428_101680333 3300006844 Bacteria 663
79 Ga0075430_101306992 3300006846 Unclassified 596
80 Ga0075431_100002061 3300006847 Bacteria 19205
81 Ga0075431_100029014 3300006847 Bacteria 5691
82 Ga0075431_100233649 3300006847 Unclassified 1872
83 Ga0075431_100269080 3300006847 Unclassified 1728
84 Ga0075431_100953964 3300006847 Bacteria 826
85 Ga0075433_10000394 3300006852 Bacteria 27749
86 Ga0075433_10062028 3300006852 Bacteria 3274
87 Ga0075433_11174971 3300006852 Bacteria 666
88 Ga0075433_11265090 3300006852 Unclassified 640
89 Ga0075433_11487192 3300006852 Unclassified 585
90 Ga0075434_100085379 3300006871 Bacteria 3156
91 Ga0075434_100935431 3300006871 Unclassified 881
92 Ga0075434_101347494 3300006871 Unclassified 724
93 Ga0068865_100143650 3300006881 Unclassified 1802
94 Ga0068865_100607303 3300006881 Bacteria 925
95 Ga0075436_100185264 3300006914 Bacteria 1472
96 Ga0097620_100002963 3300006931 Bacteria 17215
97 Ga0097620_100054690 3300006931 Bacteria 4016
98 Ga0075435_100329940 3300007076 Bacteria 1306
99 Ga0099794_10099137 3300007265 Unclassified 1453
100 Ga0111539_10094435 3300009094 Unclassified 3513
101 Ga0111539_10206519 3300009094 Bacteria 2289
102 Ga0111539_10329443 3300009094 Bacteria 1777
103 Ga0111539_10611765 3300009094 Unclassified 1269
104 Ga0111539_11010373 3300009094 Archaea 967
105 Ga0111539_11754530 3300009094 Bacteria 720
106 Ga0105247_10267766 3300009101 Bacteria 1174
107 Ga0114129_10029669 3300009147 Bacteria 7746
108 Ga0114129_10086939 3300009147 Unclassified 4335
109 Ga0114129_10119213 3300009147 Bacteria 3635
110 Ga0114129_10121077 3300009147 Bacteria 3602
111 Ga0114129_10180506 3300009147 Bacteria 2872
112 Ga0114129_10247519 3300009147 Unclassified 2394
113 Ga0114129_10300253 3300009147 Bacteria 2141
114 Ga0114129_11688497 3300009147 Bacteria 773
115 Ga0114129_11869177 3300009147 Unclassified 729
116 Ga0105242_10541909 3300009176 Bacteria 1114
117 Ga0105248_10000316 3300009177 Bacteria 57329
118 Ga0105248_10405670 3300009177 Bacteria 1535
119 Ga0105248_10702764 3300009177 Bacteria 1141
120 Ga0105249_10008303 3300009553 Bacteria 9040
121 Ga0105249_10465560 3300009553 Bacteria 1305
122 Ga0105249_10554787 3300009553 Bacteria 1200
123 Ga0105246_10269644 3300011119 Bacteria 1360
124 Ga0105246_11423749 3300011119 Unclassified 648
125 Ga0157374_10119571 3300013296 Bacteria 2541
126 Ga0157378_10059665 3300013297 Bacteria 3404
127 Ga0157378_10960882 3300013297 Unclassified 887
128 Ga0157378_10963373 3300013297 Unclassified 886
129 Ga0157378_11336627 3300013297 Unclassified 758
130 Ga0163162_10020126 3300013306 Bacteria 6552
131 Ga0163162_10557957 3300013306 Bacteria 1273
132 Ga0157375_10000537 3300013308 Bacteria 34014
133 Ga0157375_10202992 3300013308 Bacteria 2138
134 Ga0157375_10737067 3300013308 Bacteria 1137
135 Ga0157375_11639061 3300013308 Bacteria 761
136 Ga0163163_10003633 3300014325 Bacteria 13116
137 Ga0163163_10066343 3300014325 Bacteria 3584
138 Ga0163163_10960688 3300014325 Bacteria 918
139 Ga0163163_11305287 3300014325 Bacteria 788
140 Ga0157380_10118891 3300014326 Unclassified 2235
141 Ga0157380_10160974 3300014326 Unclassified 1951
142 Ga0157380_10647442 3300014326 Bacteria 1053
143 Ga0157380_11402073 3300014326 Unclassified 749
144 Ga0157377_10174686 3300014745 Unclassified 1346
145 Ga0157377_10400763 3300014745 Bacteria 934
146 Ga0157379_10000108 3300014968 Bacteria 57317
147 Ga0157376_10455291 3300014969 Bacteria 1249
148 Ga0157376_10581047 3300014969 Unclassified 1113
149 Ga0163161_10454285 3300017792 Bacteria 1036
150 Ga0163161_10738312 3300017792 Bacteria 823
151 Ga0207680_10089220 3300025903 Bacteria 1957
152 Ga0207680_10095571 3300025903 Bacteria 1899
153 Ga0207662_10129724 3300025918 Bacteria 1588
154 Ga0207681_10039303 3300025923 Unclassified 3141
155 Ga0207681_10132364 3300025923 Bacteria 1846
156 Ga0207681_11218656 3300025923 Bacteria 632
157 Ga0207650_10573008 3300025925 Unclassified 948
158 Ga0207659_10001427 3300025926 Bacteria 14232
159 Ga0207659_10001608 3300025926 Bacteria 13372
160 Ga0207659_10001711 3300025926 Bacteria 13023
161 Ga0207659_10398763 3300025926 Unclassified 1150
162 Ga0207644_10015339 3300025931 Bacteria 5140
163 Ga0207706_10331406 3300025933 Bacteria 1324
164 Ga0207669_10190578 3300025937 Bacteria 1479
165 Ga0207704_10135062 3300025938 Bacteria 1715
166 Ga0207704_10304302 3300025938 Bacteria 1223
167 Ga0207691_10067584 3300025940 Bacteria 3231
168 Ga0207691_10097687 3300025940 Bacteria 2624
169 Ga0207691_11326771 3300025940 Unclassified 593
170 Ga0207711_10001329 3300025941 Bacteria 23394
171 Ga0207711_10496252 3300025941 Bacteria 1138
172 Ga0207711_11460456 3300025941 Bacteria 627
173 Ga0207679_10008025 3300025945 Bacteria 6713
174 Ga0207679_10281259 3300025945 Bacteria 1427
175 Ga0207651_10069351 3300025960 Unclassified 2489
176 Ga0207651_10975720 3300025960 Unclassified 757
177 Ga0207712_10315047 3300025961 Bacteria 1289
178 Ga0207712_10978611 3300025961 Bacteria 750
179 Ga0207668_10601112 3300025972 Unclassified 958
180 Ga0207668_10705716 3300025972 Bacteria 887
181 Ga0207658_10004642 3300025986 Bacteria 9524
182 Ga0207677_10506734 3300026023 Bacteria 1045
183 Ga0207677_11019459 3300026023 Bacteria 751
184 Ga0207703_10102813 3300026035 Unclassified 2425
185 Ga0207678_10151336 3300026067 Bacteria 1981
186 Ga0207708_10158156 3300026075 Unclassified 1788
187 Ga0207708_10170624 3300026075 Bacteria 1723
188 Ga0207708_10543080 3300026075 Archaea 979
189 Ga0207641_10001976 3300026088 Bacteria 19585
190 Ga0207676_10528109 3300026095 Bacteria 1124
191 Ga0207676_11261684 3300026095 Unclassified 733
192 Ga0207674_10159925 3300026116 Unclassified 2207
193 Ga0207674_10863009 3300026116 Unclassified 873
194 Ga0207675_100001234 3300026118 Bacteria 25527
195 Ga0207675_100431603 3300026118 Unclassified 1303
196 Ga0207675_101643495 3300026118 Unclassified 663
197 Ga0207683_10705904 3300026121 Bacteria 935
198 Ga0207698_12268810 3300026142 Bacteria 555
199 Ga0210002_1050903 3300027617 Bacteria 714
200 Ga0207428_10378775 3300027907 Bacteria 1038
201 Ga0207428_10396530 3300027907 Bacteria 1011
202 Ga0268266_10869841 3300028379 Bacteria 871
203 Ga0268265_10847348 3300028380 Unclassified 894
204 Ga0268265_11676593 3300028380 Unclassified 641
205 Ga0268264_10001542 3300028381 Bacteria 21426
206 Ga0316575_10013512 3300031665 Bacteria 3051
207 Ga0316576_10157324 3300031727 Unclassified 1713
208 Ga0316576_10209493 3300031727 Unclassified 1467
209 Ga0316576_10694626 3300031727 Unclassified 738
210 Ga0316576_10793575 3300031727 Bacteria 682
211 Ga0316576_10839062 3300031727 Bacteria 660
212 Ga0316578_10013819 3300031728 Unclassified 4292
213 Ga0307415_100379113 3300032126 Bacteria 1200
214 Ga0373955_0621845 3300035172 Unclassified 662
215 Ga0373933_0023381 3300035724 Unclassified 3530
216 Ga0400487_18085 3300039110 Unclassified 2056
217 Ga0453683_0215997 3300044673 Bacteria 1219
218 Ga0453684_1107312 3300044712 Bacteria 836
219 Ga0451576_0383080 3300045051 Bacteria 1474
220 Ga0451576_2121004 3300045051 Unclassified 578
221 Ga0495586_0201401 3300046535 Bacteria 1129
222 Ga0495636_0160410 3300047318 Unclassified 1013
223 Ga0495636_0432017 3300047318 Unclassified 631
224 Ga0496109_1273927 3300048912 Bacteria 671
225 Ga0501034_0081707 3300049571 Bacteria 3234
226 Ga0501071_0592787 3300049587 Bacteria 852
227 Ga0501077_0012623 3300049593 Bacteria 5289
228 nmdc:mga0k408_140724_c1 3300050493 Bacteria 1435
229 nmdc:mga0k408_167754_c1 3300050493 Bacteria 1308
230 nmdc:mga05p37_122503_c1 3300050507 Bacteria 3194
231 nmdc:mga05p37_209921_c1 3300050507 Unclassified 2354
232 nmdc:mga05p37_21025_c2 3300050507 Bacteria 1219
233 nmdc:mga05p37_537071_c1 3300050507 Unclassified 1334
234 nmdc:mga05p37_78862_c1 3300050507 Unclassified 4055
235 nmdc:mga09592_847709_c1 3300050508 Unclassified 771
236 nmdc:mga0qj67_203268_c1 3300050509 Bacteria 1609
237 nmdc:mga0qj67_446824_c1 3300050509 Bacteria 1041
238 nmdc:mga0qj67_562708_c1 3300050509 Bacteria 914
239 nmdc:mga0qj67_873090_c1 3300050509 Bacteria 710
240 nmdc:mga06r32_102483_c1 3300050510 Bacteria 2810
241 nmdc:mga06r32_1228087_c1 3300050510 Bacteria 695
242 nmdc:mga06r32_243326_c1 3300050510 Unclassified 1786
243 nmdc:mga06r32_298281_c1 3300050510 Unclassified 1598
244 nmdc:mga06r32_89965_c1 3300050510 Bacteria 2998
245 nmdc:mga08y16_215152_c1 3300050511 Bacteria 1990
246 nmdc:mga08y16_75527_c1 3300050511 Unclassified 3513
247 nmdc:mga0n895_1178509_c1 3300050512 Bacteria 741
248 nmdc:mga0n895_378110_c1 3300050512 Unclassified 1433
249 nmdc:mga0n895_762036_c1 3300050512 Bacteria 960
250 nmdc:mga0rr50_303673_c1 3300050513 Bacteria 1335
251 nmdc:mga0a205_134555_c1 3300050515 Bacteria 2372
252 nmdc:mga0a205_712_c1 3300050515 Bacteria 26711
253 Ga0500588_0117519 3300053146 Bacteria 934
254 Ga0587072_109001 3300059643 Bacteria 630
255 Ga0501082_0678596 3300060353 Bacteria 902
256 Ga0530510_0244344 3300061734 Bacteria 1337

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100007669 Ga0070670_1000076696 126
2 3300005295 Ga0065707_10252312 Ga0065707_102523121 127
3 3300014326 Ga0157380_11402073 Ga0157380_114020732 135
4 3300047318 Ga0495636_0160410 Ga0495636_0160410_313_798 136
5 3300005340 Ga0070689_100843291 Ga0070689_1008432911 138
6 3300013297 Ga0157378_11336627 Ga0157378_113366272 138
7 3300005354 Ga0070675_100092313 Ga0070675_1000923133 139
8 3300005564 Ga0070664_100205833 Ga0070664_1002058332 139
9 3300005577 Ga0068857_100086547 Ga0068857_1000865473 139
10 3300006871 Ga0075434_101347494 Ga0075434_1013474941 139
11 3300025945 Ga0207679_10281259 Ga0207679_102812592 139
12 3300026116 Ga0207674_10863009 Ga0207674_108630092 139
13 3300050512 nmdc:mga0n895_1178509_c1 nmdc:mga0n895_1178509_c1_136_639 139
14 3300005335 Ga0070666_10031030 Ga0070666_100310303 140
15 3300005343 Ga0070687_100072297 Ga0070687_1000722972 140
16 3300005354 Ga0070675_100000186 Ga0070675_10000018612 140
17 3300005355 Ga0070671_100025878 Ga0070671_1000258783 140
18 3300005364 Ga0070673_100035216 Ga0070673_1000352162 140
19 3300005365 Ga0070688_100023348 Ga0070688_1000233483 140
20 3300005367 Ga0070667_100004413 Ga0070667_1000044137 140
21 3300005456 Ga0070678_100232618 Ga0070678_1002326182 140
22 3300005466 Ga0070685_10021429 Ga0070685_100214293 140
23 3300005543 Ga0070672_100009476 Ga0070672_1000094769 140
24 3300005544 Ga0070686_100028159 Ga0070686_1000281595 140
25 3300005564 Ga0070664_100001428 Ga0070664_1000014286 140
26 3300005616 Ga0068852_102414085 Ga0068852_1024140851 140
27 3300005617 Ga0068859_100054690 Ga0068859_1000546902 140
28 3300005618 Ga0068864_100601395 Ga0068864_1006013952 140
29 3300005841 Ga0068863_100000691 Ga0068863_1000006918 140
30 3300005842 Ga0068858_100019033 Ga0068858_1000190335 140
31 3300005843 Ga0068860_100010281 Ga0068860_1000102813 140
32 3300006237 Ga0097621_100001239 Ga0097621_10000123911 140
33 3300006358 Ga0068871_100023796 Ga0068871_1000237962 140
34 3300006931 Ga0097620_100054690 Ga0097620_1000546902 140
35 3300009177 Ga0105248_10000316 Ga0105248_1000031626 140
36 3300013296 Ga0157374_10119571 Ga0157374_101195712 140
37 3300013297 Ga0157378_10059665 Ga0157378_100596652 140
38 3300013306 Ga0163162_10020126 Ga0163162_100201266 140
39 3300013308 Ga0157375_10000537 Ga0157375_1000053728 140
40 3300014325 Ga0163163_10003633 Ga0163163_100036338 140
41 3300014968 Ga0157379_10000108 Ga0157379_1000010828 140
42 3300014969 Ga0157376_10455291 Ga0157376_104552912 140
43 3300017792 Ga0163161_10454285 Ga0163161_104542852 140
44 3300025903 Ga0207680_10095571 Ga0207680_100955712 140
45 3300025926 Ga0207659_10001427 Ga0207659_100014276 140
46 3300025931 Ga0207644_10015339 Ga0207644_100153392 140
47 3300025940 Ga0207691_10067584 Ga0207691_100675842 140
48 3300025941 Ga0207711_10001329 Ga0207711_1000132915 140
49 3300025945 Ga0207679_10008025 Ga0207679_100080255 140
50 3300025960 Ga0207651_10069351 Ga0207651_100693513 140
51 3300025986 Ga0207658_10004642 Ga0207658_100046423 140
52 3300026023 Ga0207677_10506734 Ga0207677_105067342 140
53 3300026035 Ga0207703_10102813 Ga0207703_101028133 140
54 3300026088 Ga0207641_10001976 Ga0207641_100019767 140
55 3300026095 Ga0207676_10528109 Ga0207676_105281092 140
56 3300026121 Ga0207683_10705904 Ga0207683_107059042 140
57 3300026142 Ga0207698_12268810 Ga0207698_122688101 140
58 3300028381 Ga0268264_10001542 Ga0268264_100015426 140
59 3300048912 Ga0496109_1273927 Ga0496109_1273927_131_616 140
60 3300005365 Ga0070688_100003875 Ga0070688_1000038755 142
61 3300005617 Ga0068859_100002963 Ga0068859_1000029636 142
62 3300006852 Ga0075433_11174971 Ga0075433_111749711 142
63 3300006931 Ga0097620_100002963 Ga0097620_1000029636 142
64 3300009094 Ga0111539_10329443 Ga0111539_103294432 142
65 3300009147 Ga0114129_10121077 Ga0114129_101210772 142
66 3300009177 Ga0105248_10702764 Ga0105248_107027642 142
67 3300009553 Ga0105249_10465560 Ga0105249_104655602 142
68 3300011119 Ga0105246_11423749 Ga0105246_114237492 142
69 3300013297 Ga0157378_10960882 Ga0157378_109608821 142
70 3300013308 Ga0157375_10202992 Ga0157375_102029923 142
71 3300014745 Ga0157377_10400763 Ga0157377_104007632 142
72 3300025903 Ga0207680_10089220 Ga0207680_100892202 142
73 3300025918 Ga0207662_10129724 Ga0207662_101297242 142
74 3300025923 Ga0207681_10132364 Ga0207681_101323642 142
75 3300025926 Ga0207659_10001711 Ga0207659_1000171111 142
76 3300025933 Ga0207706_10331406 Ga0207706_103314062 142
77 3300025940 Ga0207691_10097687 Ga0207691_100976874 142
78 3300025941 Ga0207711_10496252 Ga0207711_104962522 142
79 3300025961 Ga0207712_10315047 Ga0207712_103150472 142
80 3300026116 Ga0207674_10159925 Ga0207674_101599252 142
81 3300026118 Ga0207675_100431603 Ga0207675_1004316032 142
82 3300027907 Ga0207428_10378775 Ga0207428_103787752 142
83 3300028380 Ga0268265_11676593 Ga0268265_116765931 142
84 3300050511 nmdc:mga08y16_215152_c1 nmdc:mga08y16_215152_c1_579_1064 142
85 3300005330 Ga0070690_100053654 Ga0070690_1000536543 143
86 3300005335 Ga0070666_10162055 Ga0070666_101620552 143
87 3300005343 Ga0070687_100312665 Ga0070687_1003126651 143
88 3300005353 Ga0070669_100326708 Ga0070669_1003267082 143
89 3300005441 Ga0070700_100260747 Ga0070700_1002607472 143
90 3300005444 Ga0070694_100952740 Ga0070694_1009527401 143
91 3300005457 Ga0070662_100448820 Ga0070662_1004488201 143
92 3300005459 Ga0068867_100500492 Ga0068867_1005004922 143
93 3300005466 Ga0070685_10003680 Ga0070685_100036805 143
94 3300005840 Ga0068870_10286788 Ga0068870_102867882 143
95 3300006844 Ga0075428_101270897 Ga0075428_1012708972 143
96 3300006881 Ga0068865_100607303 Ga0068865_1006073032 143
97 3300009094 Ga0111539_10206519 Ga0111539_102065194 143
98 3300013308 Ga0157375_11639061 Ga0157375_116390612 143
99 3300014326 Ga0157380_10118891 Ga0157380_101188912 143
100 3300025923 Ga0207681_10039303 Ga0207681_100393034 143
101 3300025938 Ga0207704_10304302 Ga0207704_103043022 143
102 3300026075 Ga0207708_10158156 Ga0207708_101581562 143
103 3300027617 Ga0210002_1050903 Ga0210002_10509031 143
104 3300006847 Ga0075431_100953964 Ga0075431_1009539641 146
105 3300009094 Ga0111539_11010373 Ga0111539_110103732 146
106 3300009147 Ga0114129_11688497 Ga0114129_116884971 146
107 3300050509 nmdc:mga0qj67_562708_c1 nmdc:mga0qj67_562708_c1_52_498 148
108 3300050510 nmdc:mga06r32_102483_c1 nmdc:mga06r32_102483_c1_2010_2456 148
109 3300039110 Ga0400487_18085 Ga0400487_18085_742_1221 150
110 3300045051 Ga0451576_2121004 Ga0451576_2121004_105_557 150
111 3300005328 Ga0070676_10407555 Ga0070676_104075552 153
112 3300005334 Ga0068869_100536378 Ga0068869_1005363781 153
113 3300005334 Ga0068869_101354215 Ga0068869_1013542151 153
114 3300005355 Ga0070671_101787181 Ga0070671_1017871811 153
115 3300005365 Ga0070688_100137982 Ga0070688_1001379823 153
116 3300005438 Ga0070701_10276302 Ga0070701_102763022 153
117 3300005441 Ga0070700_100120179 Ga0070700_1001201791 153
118 3300005455 Ga0070663_100053388 Ga0070663_1000533882 153
119 3300005543 Ga0070672_100236631 Ga0070672_1002366311 153
120 3300005618 Ga0068864_101650237 Ga0068864_1016502371 153
121 3300005719 Ga0068861_100000809 Ga0068861_1000008097 153
122 3300005719 Ga0068861_102358393 Ga0068861_1023583931 153
123 3300005844 Ga0068862_100853959 Ga0068862_1008539591 153
124 3300006237 Ga0097621_101670011 Ga0097621_1016700111 153
125 3300006881 Ga0068865_100143650 Ga0068865_1001436502 153
126 3300009553 Ga0105249_10008303 Ga0105249_100083032 153
127 3300014325 Ga0163163_10066343 Ga0163163_100663432 153
128 3300014325 Ga0163163_10960688 Ga0163163_109606881 153
129 3300014326 Ga0157380_10160974 Ga0157380_101609742 153
130 3300025938 Ga0207704_10135062 Ga0207704_101350621 153
131 3300025972 Ga0207668_10705716 Ga0207668_107057162 153
132 3300026023 Ga0207677_11019459 Ga0207677_110194591 153
133 3300026067 Ga0207678_10151336 Ga0207678_101513362 153
134 3300026075 Ga0207708_10170624 Ga0207708_101706241 153
135 3300026095 Ga0207676_11261684 Ga0207676_112616842 153
136 3300026118 Ga0207675_100001234 Ga0207675_10000123410 153
137 3300026118 Ga0207675_101643495 Ga0207675_1016434951 153
138 3300032126 Ga0307415_100379113 Ga0307415_1003791132 153
139 3300035724 Ga0373933_0023381 Ga0373933_0023381_2687_3157 153
140 3300049593 Ga0501077_0012623 Ga0501077_0012623_4076_4546 153
141 3300050493 nmdc:mga0k408_140724_c1 nmdc:mga0k408_140724_c1_464_934 153
142 3300050493 nmdc:mga0k408_167754_c1 nmdc:mga0k408_167754_c1_48_518 153
143 3300053146 Ga0500588_0117519 Ga0500588_0117519_355_891 153
144 2162886012 MBSR1b_contig_1486547 MBSR1b_0368.00004080 154
145 3300005290 Ga0065712_10511720 Ga0065712_105117201 154
146 3300005331 Ga0070670_100670563 Ga0070670_1006705632 154
147 3300005331 Ga0070670_101153643 Ga0070670_1011536431 154
148 3300005354 Ga0070675_100002661 Ga0070675_1000026617 154
149 3300005354 Ga0070675_100342556 Ga0070675_1003425562 154
150 3300005367 Ga0070667_101253066 Ga0070667_1012530661 154
151 3300005441 Ga0070700_100784822 Ga0070700_1007848221 154
152 3300005445 Ga0070708_101330101 Ga0070708_1013301011 154
153 3300005466 Ga0070685_11050636 Ga0070685_110506361 154
154 3300005548 Ga0070665_101032019 Ga0070665_1010320191 154
155 3300005549 Ga0070704_100469966 Ga0070704_1004699662 154
156 3300005564 Ga0070664_100504628 Ga0070664_1005046281 154
157 3300005719 Ga0068861_100170353 Ga0068861_1001703532 154
158 3300005840 Ga0068870_10313788 Ga0068870_103137882 154
159 3300005843 Ga0068860_100857911 Ga0068860_1008579112 154
160 3300005843 Ga0068860_101092955 Ga0068860_1010929552 154
161 3300006173 Ga0070716_100374005 Ga0070716_1003740051 154
162 3300006358 Ga0068871_100386672 Ga0068871_1003866722 154
163 3300006844 Ga0075428_100056644 Ga0075428_1000566442 154
164 3300006844 Ga0075428_100093050 Ga0075428_1000930502 154
165 3300006844 Ga0075428_100211986 Ga0075428_1002119862 154
166 3300006844 Ga0075428_100527127 Ga0075428_1005271272 154
167 3300006844 Ga0075428_100896579 Ga0075428_1008965791 154
168 3300006844 Ga0075428_101680333 Ga0075428_1016803332 154
169 3300006846 Ga0075430_101306992 Ga0075430_1013069921 154
170 3300006847 Ga0075431_100002061 Ga0075431_10000206117 154
171 3300006847 Ga0075431_100029014 Ga0075431_1000290144 154
172 3300006847 Ga0075431_100233649 Ga0075431_1002336491 154
173 3300006847 Ga0075431_100269080 Ga0075431_1002690802 154
174 3300006852 Ga0075433_10000394 Ga0075433_100003949 154
175 3300006852 Ga0075433_10062028 Ga0075433_100620283 154
176 3300006852 Ga0075433_11265090 Ga0075433_112650902 154
177 3300006852 Ga0075433_11487192 Ga0075433_114871921 154
178 3300006871 Ga0075434_100085379 Ga0075434_1000853794 154
179 3300006871 Ga0075434_100935431 Ga0075434_1009354312 154
180 3300006914 Ga0075436_100185264 Ga0075436_1001852642 154
181 3300007076 Ga0075435_100329940 Ga0075435_1003299402 154
182 3300007265 Ga0099794_10099137 Ga0099794_100991372 154
183 3300009094 Ga0111539_10094435 Ga0111539_100944352 154
184 3300009094 Ga0111539_10611765 Ga0111539_106117652 154
185 3300009094 Ga0111539_11754530 Ga0111539_117545301 154
186 3300009101 Ga0105247_10267766 Ga0105247_102677662 154
187 3300009147 Ga0114129_10029669 Ga0114129_100296693 154
188 3300009147 Ga0114129_10086939 Ga0114129_100869393 154
189 3300009147 Ga0114129_10119213 Ga0114129_101192133 154
190 3300009147 Ga0114129_10180506 Ga0114129_101805063 154
191 3300009147 Ga0114129_10247519 Ga0114129_102475192 154
192 3300009147 Ga0114129_10300253 Ga0114129_103002532 154
193 3300009147 Ga0114129_11869177 Ga0114129_118691771 154
194 3300009176 Ga0105242_10541909 Ga0105242_105419092 154
195 3300009177 Ga0105248_10405670 Ga0105248_104056702 154
196 3300009553 Ga0105249_10554787 Ga0105249_105547872 154
197 3300011119 Ga0105246_10269644 Ga0105246_102696442 154
198 3300013297 Ga0157378_10963373 Ga0157378_109633732 154
199 3300013306 Ga0163162_10557957 Ga0163162_105579572 154
200 3300013308 Ga0157375_10737067 Ga0157375_107370671 154
201 3300014325 Ga0163163_11305287 Ga0163163_113052871 154
202 3300014326 Ga0157380_10647442 Ga0157380_106474422 154
203 3300014745 Ga0157377_10174686 Ga0157377_101746861 154
204 3300014969 Ga0157376_10581047 Ga0157376_105810472 154
205 3300017792 Ga0163161_10738312 Ga0163161_107383121 154
206 3300025923 Ga0207681_11218656 Ga0207681_112186562 154
207 3300025925 Ga0207650_10573008 Ga0207650_105730082 154
208 3300025926 Ga0207659_10001608 Ga0207659_100016089 154
209 3300025926 Ga0207659_10398763 Ga0207659_103987632 154
210 3300025937 Ga0207669_10190578 Ga0207669_101905782 154
211 3300025940 Ga0207691_11326771 Ga0207691_113267711 154
212 3300025941 Ga0207711_11460456 Ga0207711_114604562 154
213 3300025960 Ga0207651_10975720 Ga0207651_109757202 154
214 3300025961 Ga0207712_10978611 Ga0207712_109786111 154
215 3300025972 Ga0207668_10601112 Ga0207668_106011122 154
216 3300026075 Ga0207708_10543080 Ga0207708_105430801 154
217 3300027907 Ga0207428_10396530 Ga0207428_103965302 154
218 3300028379 Ga0268266_10869841 Ga0268266_108698412 154
219 3300028380 Ga0268265_10847348 Ga0268265_108473482 154
220 3300031665 Ga0316575_10013512 Ga0316575_100135123 154
221 3300031727 Ga0316576_10157324 Ga0316576_101573242 154
222 3300031727 Ga0316576_10209493 Ga0316576_102094932 154
223 3300031727 Ga0316576_10694626 Ga0316576_106946261 154
224 3300031727 Ga0316576_10793575 Ga0316576_107935751 154
225 3300031727 Ga0316576_10839062 Ga0316576_108390621 154
226 3300031728 Ga0316578_10013819 Ga0316578_100138194 154
227 3300035172 Ga0373955_0621845 Ga0373955_0621845_72_581 154
228 3300044673 Ga0453683_0215997 Ga0453683_0215997_377_859 154
229 3300044712 Ga0453684_1107312 Ga0453684_1107312_58_543 154
230 3300045051 Ga0451576_0383080 Ga0451576_0383080_577_1053 154
231 3300046535 Ga0495586_0201401 Ga0495586_0201401_79_564 154
232 3300047318 Ga0495636_0432017 Ga0495636_0432017_82_567 154
233 3300049571 Ga0501034_0081707 Ga0501034_0081707_1421_1939 154
234 3300049587 Ga0501071_0592787 Ga0501071_0592787_174_653 154
235 3300050507 nmdc:mga05p37_122503_c1 nmdc:mga05p37_122503_c1_1751_2236 154
236 3300050507 nmdc:mga05p37_209921_c1 nmdc:mga05p37_209921_c1_1800_2297 154
237 3300050507 nmdc:mga05p37_21025_c2 nmdc:mga05p37_21025_c2_184_669 154
238 3300050507 nmdc:mga05p37_537071_c1 nmdc:mga05p37_537071_c1_740_1219 154
239 3300050507 nmdc:mga05p37_78862_c1 nmdc:mga05p37_78862_c1_537_1016 154
240 3300050508 nmdc:mga09592_847709_c1 nmdc:mga09592_847709_c1_95_580 154
241 3300050509 nmdc:mga0qj67_203268_c1 nmdc:mga0qj67_203268_c1_956_1441 154
242 3300050509 nmdc:mga0qj67_446824_c1 nmdc:mga0qj67_446824_c1_480_1007 154
243 3300050509 nmdc:mga0qj67_873090_c1 nmdc:mga0qj67_873090_c1_34_513 154
244 3300050510 nmdc:mga06r32_1228087_c1 nmdc:mga06r32_1228087_c1_86_565 154
245 3300050510 nmdc:mga06r32_243326_c1 nmdc:mga06r32_243326_c1_740_1225 154
246 3300050510 nmdc:mga06r32_298281_c1 nmdc:mga06r32_298281_c1_1030_1515 154
247 3300050510 nmdc:mga06r32_89965_c1 nmdc:mga06r32_89965_c1_2363_2842 154
248 3300050511 nmdc:mga08y16_75527_c1 nmdc:mga08y16_75527_c1_640_1128 154
249 3300050512 nmdc:mga0n895_378110_c1 nmdc:mga0n895_378110_c1_340_825 154
250 3300050512 nmdc:mga0n895_762036_c1 nmdc:mga0n895_762036_c1_34_513 154
251 3300050513 nmdc:mga0rr50_303673_c1 nmdc:mga0rr50_303673_c1_352_831 154
252 3300050515 nmdc:mga0a205_134555_c1 nmdc:mga0a205_134555_c1_1432_1917 154
253 3300050515 nmdc:mga0a205_712_c1 nmdc:mga0a205_712_c1_7869_8348 154
254 3300059643 Ga0587072_109001 Ga0587072_109001_21_599 154
255 3300060353 Ga0501082_0678596 Ga0501082_0678596_41_520 154
256 3300061734 Ga0530510_0244344 Ga0530510_0244344_663_1139 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

28

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7w9h-assembly1.cif.gz_A crystal structure of the receiver domain of the transcription regulator fler from pseudomonas aeruginosa 0.9511 2 117
2qzj-assembly5.cif.gz_E crystal structure of a two-component response regulator from clostridium difficile 0.9501 1 120
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9497 1 124
3hv2-assembly1.cif.gz_B crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5 0.9492 2 123
3crn-assembly1.cif.gz_B crystal structure of response regulator receiver domain protein (chey-like) from methanospirillum hungatei jf-1 0.947 1 123
ID Description Score Start End Superfamily
af_A0A0P0W8Y3_12_90_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9591 3 77 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9569 1 125 3.40.50.2300
3hv2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9492 2 123 3.40.50.2300
2qzjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9483 1 121 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.944 3 126 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2N6C625-F1-model_v4 Two-component system response regulator 0.9832 1 126 GO:0000160
GO:0016787
AF-A0A522VBR5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9784 1 138 GO:0000155
GO:0005886
GO:0009927
AF-A0A7X7WTL7-F1-model_v4 Response regulator 0.9765 1 130 GO:0000160
GO:0016787
AF-A0A533S7D9-F1-model_v4 Response regulator 0.9758 2 131 GO:0000160
GO:0016787
AF-E1QDR0-F1-model_v4 Two component, sigma54 specific, transcriptional regulator, Fis family 0.9739 2 127 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Feature Viewer

pLDDT pTM Quality
90.11 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map