F366860

General Info

Members Datasets Scaffolds Average Seq Length
256 151 512 251

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0200727|Ga0501067_0200727_323_1060
Length 245
Sequence MAHTVALAAHAVTKRYGAVLALDGVSLEVRRGESVALIGESGSGKTTLLRCFNRLTDPDAGRAEVDGTDVATVDPVALRRRVGYVPQEGGLLPHWRVRRNVALVPWLRGLDDAPVLADRALQLVGLEPGVGERWPRDLSGGQRQRVAVARSLAARPDIVLLDEPFGALDAITRADLQNTFRDLRRELALTTLLVTHDLSEAFLLADRIAVMHHGRVEQFAPGDELRTAPATEYVRALLARARVRP

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
150 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 8.2
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0200727 3300049583 Bacteria 1111
2 Ga0065715_10013328 3300005293 Bacteria 2672
3 Ga0070676_10005065 3300005328 Bacteria 6989
4 Ga0070676_10062731 3300005328 Bacteria 2212
5 Ga0070676_10066091 3300005328 Bacteria 2160
6 Ga0070683_100081482 3300005329 Bacteria 3030
7 Ga0070683_100133255 3300005329 Bacteria 2352
8 Ga0070680_100003608 3300005336 Bacteria 11556
9 Ga0070680_100016641 3300005336 Bacteria 5789
10 Ga0070680_100019627 3300005336 Bacteria 5361
11 Ga0070680_100172188 3300005336 Bacteria 1822
12 Ga0070682_100034371 3300005337 Bacteria 3087
13 Ga0070682_100040934 3300005337 Bacteria 2853
14 Ga0068868_100030195 3300005338 Bacteria 4155
15 Ga0068868_100051450 3300005338 Bacteria 3240
16 Ga0070691_10077733 3300005341 Bacteria 1620
17 Ga0070661_100001371 3300005344 Bacteria 17006
18 Ga0070661_100011198 3300005344 Bacteria 6249
19 Ga0070661_100039490 3300005344 Bacteria 3439
20 Ga0070692_10029076 3300005345 Bacteria 2753
21 Ga0070692_10051468 3300005345 Bacteria 2142
22 Ga0070668_100052211 3300005347 Bacteria 3151
23 Ga0070669_100026305 3300005353 Bacteria 4186
24 Ga0070674_100224658 3300005356 Bacteria 1462
25 Ga0070659_100035175 3300005366 Bacteria 3900
26 Ga0070709_10016019 3300005434 Bacteria 4272
27 Ga0070709_10300557 3300005434 Bacteria 1172
28 Ga0070714_100010575 3300005435 Bacteria 7298
29 Ga0070710_10010977 3300005437 Bacteria 4464
30 Ga0070701_10112793 3300005438 Bacteria 1521
31 Ga0070711_100031291 3300005439 Bacteria 3532
32 Ga0070700_100022726 3300005441 Bacteria 3663
33 Ga0070694_100045316 3300005444 Bacteria 2947
34 Ga0070694_100143331 3300005444 Bacteria 1738
35 Ga0070708_100000071 3300005445 Bacteria 67454
36 Ga0070708_100645257 3300005445 Bacteria 998
37 Ga0070662_100000044 3300005457 Bacteria 69006
38 Ga0070662_100094848 3300005457 Bacteria 2247
39 Ga0070662_100187332 3300005457 Bacteria 1634
40 Ga0070681_10026070 3300005458 Bacteria 5877
41 Ga0070681_10035260 3300005458 Bacteria 5026
42 Ga0070681_10048906 3300005458 Bacteria 4224
43 Ga0070681_10082493 3300005458 Bacteria 3170
44 Ga0068867_100429118 3300005459 Bacteria 1121
45 Ga0070685_10050880 3300005466 Bacteria 2395
46 Ga0070706_100171998 3300005467 Bacteria 2023
47 Ga0070706_100273479 3300005467 Bacteria 1576
48 Ga0070706_100312620 3300005467 Bacteria 1465
49 Ga0070707_100001133 3300005468 Bacteria 26210
50 Ga0070707_100289791 3300005468 Bacteria 1591
51 Ga0070698_100149332 3300005471 Bacteria 2285
52 Ga0070699_100006790 3300005518 Bacteria 9958
53 Ga0070699_100346628 3300005518 Bacteria 1337
54 Ga0070699_100494535 3300005518 Bacteria 1111
55 Ga0070679_100003310 3300005530 Bacteria 14757
56 Ga0070679_100005680 3300005530 Bacteria 11568
57 Ga0070679_100041210 3300005530 Bacteria 4595
58 Ga0070679_100091151 3300005530 Bacteria 3036
59 Ga0070679_100101960 3300005530 Bacteria 2856
60 Ga0070679_100111240 3300005530 Bacteria 2725
61 Ga0070679_100129433 3300005530 Bacteria 2506
62 Ga0070684_100108542 3300005535 Bacteria 2487
63 Ga0070697_100041480 3300005536 Bacteria 3725
64 Ga0070697_100079703 3300005536 Bacteria 2696
65 Ga0070697_100171651 3300005536 Bacteria 1835
66 Ga0070697_100571820 3300005536 Bacteria 992
67 Ga0070697_100676668 3300005536 Bacteria 910
68 Ga0068853_100048871 3300005539 Bacteria 3634
69 Ga0070672_100093128 3300005543 Bacteria 2434
70 Ga0070672_100347299 3300005543 Bacteria 1264
71 Ga0070686_100000019 3300005544 Bacteria 139615
72 Ga0070686_100038515 3300005544 Bacteria 2973
73 Ga0070695_100428876 3300005545 Bacteria 1008
74 Ga0070696_100002892 3300005546 Bacteria 11417
75 Ga0070696_100033168 3300005546 Bacteria 3546
76 Ga0070693_100048514 3300005547 Bacteria 2419
77 Ga0070693_100070618 3300005547 Bacteria 2055
78 Ga0070693_100119218 3300005547 Bacteria 1634
79 Ga0070704_100062143 3300005549 Bacteria 2676
80 Ga0070704_100235496 3300005549 Bacteria 1496
81 Ga0068855_100080842 3300005563 Bacteria 3769
82 Ga0068855_100222973 3300005563 Bacteria 2113
83 Ga0070664_100001511 3300005564 Bacteria 18545
84 Ga0068857_100002547 3300005577 Bacteria 14927
85 Ga0068854_100036052 3300005578 Bacteria 3465
86 Ga0068854_100128712 3300005578 Bacteria 1931
87 Ga0070716_100008332 3300006173 Bacteria 5141
88 Ga0070716_100253572 3300006173 Bacteria 1200
89 Ga0070712_100451877 3300006175 Bacteria 1070
90 Ga0075428_100419348 3300006844 Bacteria 1434
91 Ga0075431_100462464 3300006847 Bacteria 1263
92 Ga0075433_10004145 3300006852 Bacteria 11249
93 Ga0075433_10054311 3300006852 Bacteria 3495
94 Ga0075433_10154279 3300006852 Bacteria 2043
95 Ga0075434_100160458 3300006871 Bacteria 2268
96 Ga0075434_100520764 3300006871 Bacteria 1209
97 Ga0068865_100054930 3300006881 Bacteria 2770
98 Ga0075436_100278397 3300006914 Bacteria 1196
99 Ga0105240_10887273 3300009093 Bacteria 960
100 Ga0105245_10014244 3300009098 Bacteria 6929
101 Ga0105245_10044087 3300009098 Bacteria 3980
102 Ga0114129_10152243 3300009147 Bacteria 3165
103 Ga0114129_10243552 3300009147 Bacteria 2416
104 Ga0105242_10306073 3300009176 Bacteria 1452
105 Ga0105238_10000012 3300009551 Bacteria 258862
106 Ga0105238_10014319 3300009551 Bacteria 8017
107 Ga0105249_10000009 3300009553 Bacteria 313866
108 Ga0157373_10207645 3300013100 Bacteria 1381
109 Ga0157370_10031539 3300013104 Bacteria 5182
110 Ga0157369_10071631 3300013105 Bacteria 3720
111 Ga0157378_10041068 3300013297 Bacteria 4103
112 Ga0157372_10183126 3300013307 Bacteria 2425
113 Ga0163163_10125222 3300014325 Bacteria 2607
114 Ga0182008_10009255 3300014497 Bacteria 5324
115 Ga0213876_10052671 3300021384 Bacteria 2151
116 Ga0207699_10002029 3300025906 Bacteria 9557
117 Ga0207684_10398868 3300025910 Bacteria 1183
118 Ga0207707_10000149 3300025912 Bacteria 72889
119 Ga0207707_10001411 3300025912 Bacteria 22250
120 Ga0207707_10009597 3300025912 Bacteria 8395
121 Ga0207707_10092844 3300025912 Bacteria 2637
122 Ga0207707_10193192 3300025912 Bacteria 1775
123 Ga0207695_10044714 3300025913 Bacteria 4708
124 Ga0207693_10059924 3300025915 Bacteria 2982
125 Ga0207663_10077894 3300025916 Bacteria 2159
126 Ga0207660_10009608 3300025917 Bacteria 6262
127 Ga0207660_10046356 3300025917 Bacteria 3067
128 Ga0207660_10066984 3300025917 Bacteria 2599
129 Ga0207660_10126613 3300025917 Bacteria 1940
130 Ga0207662_10042733 3300025918 Bacteria 2672
131 Ga0207649_10003605 3300025920 Bacteria 8460
132 Ga0207649_10065849 3300025920 Bacteria 2295
133 Ga0207649_10072865 3300025920 Bacteria 2199
134 Ga0207652_10005342 3300025921 Bacteria 10417
135 Ga0207652_10035473 3300025921 Bacteria 4210
136 Ga0207652_10052719 3300025921 Bacteria 3493
137 Ga0207652_10054952 3300025921 Bacteria 3424
138 Ga0207652_10103779 3300025921 Bacteria 2514
139 Ga0207652_10114887 3300025921 Bacteria 2391
140 Ga0207652_10122478 3300025921 Bacteria 2314
141 Ga0207652_10218427 3300025921 Bacteria 1717
142 Ga0207652_10289683 3300025921 Bacteria 1477
143 Ga0207646_10000213 3300025922 Bacteria 79744
144 Ga0207646_10048073 3300025922 Bacteria 3825
145 Ga0207646_10438171 3300025922 Bacteria 1179
146 Ga0207694_10000025 3300025924 Bacteria 258871
147 Ga0207687_10732044 3300025927 Bacteria 841
148 Ga0207664_10012750 3300025929 Bacteria 6017
149 Ga0207690_10054256 3300025932 Bacteria 2694
150 Ga0207706_10000104 3300025933 Bacteria 88824
151 Ga0207706_10007544 3300025933 Bacteria 10069
152 Ga0207706_10191525 3300025933 Bacteria 1795
153 Ga0207665_10000074 3300025939 Bacteria 64828
154 Ga0207665_10110211 3300025939 Bacteria 1933
155 Ga0207665_10284559 3300025939 Bacteria 1231
156 Ga0207661_10001584 3300025944 Bacteria 15481
157 Ga0207661_10057227 3300025944 Bacteria 3134
158 Ga0207661_10139470 3300025944 Bacteria 2085
159 Ga0207679_10006592 3300025945 Bacteria 7341
160 Ga0207712_10000077 3300025961 Bacteria 119803
161 Ga0207640_10037208 3300025981 Bacteria 3061
162 Ga0207640_10242623 3300025981 Bacteria 1393
163 Ga0207677_10008129 3300026023 Bacteria 5842
164 Ga0207639_10040877 3300026041 Bacteria 3465
165 Ga0207639_10176671 3300026041 Bacteria 1813
166 Ga0207678_10142026 3300026067 Bacteria 2049
167 Ga0207708_10004819 3300026075 Bacteria 9937
168 Ga0207708_10016134 3300026075 Bacteria 5611
169 Ga0207702_10529161 3300026078 Bacteria 1151
170 Ga0207641_10159185 3300026088 Bacteria 2051
171 Ga0207648_10011707 3300026089 Bacteria 8251
172 Ga0207676_10033278 3300026095 Bacteria 3893
173 Ga0207676_10093614 3300026095 Bacteria 2474
174 Ga0207674_10009709 3300026116 Bacteria 10969
175 Ga0207675_100310108 3300026118 Bacteria 1539
176 Ga0207675_100696241 3300026118 Bacteria 1025
177 Ga0207698_10002180 3300026142 Bacteria 11583
178 Ga0209995_1010502 3300027471 Bacteria 1502
179 Ga0209968_1003368 3300027526 Bacteria 2399
180 Ga0307408_100040379 3300031548 Bacteria 3304
181 Ga0307410_10003669 3300031852 Bacteria 7758
182 Ga0307406_10404833 3300031901 Bacteria 1083
183 Ga0307412_10310639 3300031911 Bacteria 1250
184 Ga0307412_10395904 3300031911 Bacteria 1123
185 Ga0307409_100071975 3300031995 Bacteria 2751
186 Ga0307416_100122450 3300032002 Bacteria 2322
187 Ga0307414_10040789 3300032004 Bacteria 3138
188 Ga0307414_10040951 3300032004 Bacteria 3133
189 Ga0307414_10229288 3300032004 Bacteria 1530
190 Ga0307411_10032460 3300032005 Bacteria 3226
191 Ga0307411_10280374 3300032005 Bacteria 1326
192 Ga0307415_100187475 3300032126 Bacteria 1629
193 Ga0307415_100327547 3300032126 Bacteria 1280
194 Ga0373940_0028483 3300035088 Bacteria 1475
195 Ga0373941_0016993 3300035115 Bacteria 1987
196 Ga0373941_0043289 3300035115 Bacteria 1401
197 Ga0373960_0023366 3300035121 Bacteria 1664
198 Ga0373960_0037161 3300035121 Bacteria 1390
199 Ga0373960_0064140 3300035121 Bacteria 1121
200 Ga0373931_0242929 3300035691 Bacteria 1092
201 Ga0395899_0074325 3300037312 Bacteria 2483
202 Ga0395900_0260314 3300037418 Bacteria 1733
203 Ga0395898_0902448 3300037466 Bacteria 822
204 Ga0395905_0043750 3300037471 Bacteria 4200
205 Ga0395905_0374640 3300037471 Bacteria 1317
206 Ga0395901_0020456 3300038443 Bacteria 6773
207 Ga0395901_0419501 3300038443 Bacteria 1372
208 Ga0436365_0016383 3300039437 Bacteria 4701
209 Ga0436365_0885859 3300039437 Bacteria 9621
210 Ga0439446_0055717 3300042156 Bacteria 1187
211 Ga0466961_0002914 3300044693 Bacteria 10623
212 Ga0451576_0075966 3300045051 Bacteria 3496
213 Ga0466967_0692393 3300045976 Bacteria 1009
214 Ga0495643_0000083 3300046522 Bacteria 158660
215 Ga0496102_0021730 3300048905 Bacteria 5678
216 Ga0496102_0106721 3300048905 Bacteria 2607
217 Ga0496102_0384499 3300048905 Bacteria 1321
218 Ga0496104_0005100 3300048907 Bacteria 11463
219 Ga0496105_0078889 3300048908 Bacteria 2719
220 Ga0496108_0001725 3300048911 Bacteria 17346
221 Ga0496108_0032936 3300048911 Bacteria 4305
222 Ga0496109_0006008 3300048912 Bacteria 10198
223 Ga0496109_0009003 3300048912 Bacteria 8501
224 Ga0496109_0139379 3300048912 Bacteria 2268
225 Ga0496109_0260876 3300048912 Bacteria 1632
226 Ga0496110_0040799 3300048913 Bacteria 4046
227 Ga0496110_0064285 3300048913 Bacteria 3242
228 Ga0496110_0530770 3300048913 Bacteria 1070
229 Ga0496111_0183292 3300048914 Bacteria 1556
230 Ga0496112_0005108 3300048915 Bacteria 11276
231 Ga0496113_0009112 3300048916 Bacteria 6504
232 Ga0496113_0023910 3300048916 Bacteria 4337
233 Ga0496113_0056728 3300048916 Bacteria 2942
234 Ga0496114_0345490 3300048917 Bacteria 1316
235 Ga0496114_0397642 3300048917 Bacteria 1220
236 Ga0501033_0317013 3300049570 Bacteria 1096
237 Ga0501038_0338043 3300049574 Bacteria 1175
238 Ga0501042_0274361 3300049578 Bacteria 1217
239 Ga0501067_0061419 3300049583 Bacteria 2080
240 Ga0501068_0201952 3300049584 Bacteria 1261
241 Ga0501074_0137506 3300049590 Bacteria 1748
242 Ga0501077_0003559 3300049593 Bacteria 9363
243 Ga0501080_0181237 3300049742 Bacteria 1938
244 Ga0501081_0060352 3300049743 Bacteria 2627
245 Ga0501045_0037791 3300049824 Bacteria 3510
246 nmdc:mga05p37_452790_c1 3300050507 Bacteria 1485
247 nmdc:mga06r32_392615_c1 3300050510 Bacteria 1370
248 nmdc:mga0n895_162081_c1 3300050512 Bacteria 2268
249 nmdc:mga0n895_395716_c1 3300050512 Bacteria 1397
250 nmdc:mga0rr50_233489_c1 3300050513 Bacteria 1522
251 nmdc:mga0rr50_95635_c1 3300050513 Bacteria 1725
252 nmdc:mga0a205_343887_c1 3300050515 Bacteria 1360
253 nmdc:mga0a205_49883_c1 3300050515 Bacteria 4041
254 Ga0500628_001212 3300053129 Bacteria 4478
255 Ga0590074_032362 3300059423 Bacteria 926
256 Ga0501082_0194609 3300060353 Bacteria 1764
257 Ga0501067_0200727
258 Ga0065715_10013328
259 Ga0070676_10005065
260 Ga0070676_10062731
261 Ga0070676_10066091
262 Ga0070683_100081482
263 Ga0070683_100133255
264 Ga0070680_100003608
265 Ga0070680_100016641
266 Ga0070680_100019627
267 Ga0070680_100172188
268 Ga0070682_100034371
269 Ga0070682_100040934
270 Ga0068868_100030195
271 Ga0068868_100051450
272 Ga0070691_10077733
273 Ga0070661_100001371
274 Ga0070661_100011198
275 Ga0070661_100039490
276 Ga0070692_10029076
277 Ga0070692_10051468
278 Ga0070668_100052211
279 Ga0070669_100026305
280 Ga0070674_100224658
281 Ga0070659_100035175
282 Ga0070709_10016019
283 Ga0070709_10300557
284 Ga0070714_100010575
285 Ga0070710_10010977
286 Ga0070701_10112793
287 Ga0070711_100031291
288 Ga0070700_100022726
289 Ga0070694_100045316
290 Ga0070694_100143331
291 Ga0070708_100000071
292 Ga0070708_100645257
293 Ga0070662_100000044
294 Ga0070662_100094848
295 Ga0070662_100187332
296 Ga0070681_10026070
297 Ga0070681_10035260
298 Ga0070681_10048906
299 Ga0070681_10082493
300 Ga0068867_100429118
301 Ga0070685_10050880
302 Ga0070706_100171998
303 Ga0070706_100273479
304 Ga0070706_100312620
305 Ga0070707_100001133
306 Ga0070707_100289791
307 Ga0070698_100149332
308 Ga0070699_100006790
309 Ga0070699_100346628
310 Ga0070699_100494535
311 Ga0070679_100003310
312 Ga0070679_100005680
313 Ga0070679_100041210
314 Ga0070679_100091151
315 Ga0070679_100101960
316 Ga0070679_100111240
317 Ga0070679_100129433
318 Ga0070684_100108542
319 Ga0070697_100041480
320 Ga0070697_100079703
321 Ga0070697_100171651
322 Ga0070697_100571820
323 Ga0070697_100676668
324 Ga0068853_100048871
325 Ga0070672_100093128
326 Ga0070672_100347299
327 Ga0070686_100000019
328 Ga0070686_100038515
329 Ga0070695_100428876
330 Ga0070696_100002892
331 Ga0070696_100033168
332 Ga0070693_100048514
333 Ga0070693_100070618
334 Ga0070693_100119218
335 Ga0070704_100062143
336 Ga0070704_100235496
337 Ga0068855_100080842
338 Ga0068855_100222973
339 Ga0070664_100001511
340 Ga0068857_100002547
341 Ga0068854_100036052
342 Ga0068854_100128712
343 Ga0070716_100008332
344 Ga0070716_100253572
345 Ga0070712_100451877
346 Ga0075428_100419348
347 Ga0075431_100462464
348 Ga0075433_10004145
349 Ga0075433_10054311
350 Ga0075433_10154279
351 Ga0075434_100160458
352 Ga0075434_100520764
353 Ga0068865_100054930
354 Ga0075436_100278397
355 Ga0105240_10887273
356 Ga0105245_10014244
357 Ga0105245_10044087
358 Ga0114129_10152243
359 Ga0114129_10243552
360 Ga0105242_10306073
361 Ga0105238_10000012
362 Ga0105238_10014319
363 Ga0105249_10000009
364 Ga0157373_10207645
365 Ga0157370_10031539
366 Ga0157369_10071631
367 Ga0157378_10041068
368 Ga0157372_10183126
369 Ga0163163_10125222
370 Ga0182008_10009255
371 Ga0213876_10052671
372 Ga0207699_10002029
373 Ga0207684_10398868
374 Ga0207707_10000149
375 Ga0207707_10001411
376 Ga0207707_10009597
377 Ga0207707_10092844
378 Ga0207707_10193192
379 Ga0207695_10044714
380 Ga0207693_10059924
381 Ga0207663_10077894
382 Ga0207660_10009608
383 Ga0207660_10046356
384 Ga0207660_10066984
385 Ga0207660_10126613
386 Ga0207662_10042733
387 Ga0207649_10003605
388 Ga0207649_10065849
389 Ga0207649_10072865
390 Ga0207652_10005342
391 Ga0207652_10035473
392 Ga0207652_10052719
393 Ga0207652_10054952
394 Ga0207652_10103779
395 Ga0207652_10114887
396 Ga0207652_10122478
397 Ga0207652_10218427
398 Ga0207652_10289683
399 Ga0207646_10000213
400 Ga0207646_10048073
401 Ga0207646_10438171
402 Ga0207694_10000025
403 Ga0207687_10732044
404 Ga0207664_10012750
405 Ga0207690_10054256
406 Ga0207706_10000104
407 Ga0207706_10007544
408 Ga0207706_10191525
409 Ga0207665_10000074
410 Ga0207665_10110211
411 Ga0207665_10284559
412 Ga0207661_10001584
413 Ga0207661_10057227
414 Ga0207661_10139470
415 Ga0207679_10006592
416 Ga0207712_10000077
417 Ga0207640_10037208
418 Ga0207640_10242623
419 Ga0207677_10008129
420 Ga0207639_10040877
421 Ga0207639_10176671
422 Ga0207678_10142026
423 Ga0207708_10004819
424 Ga0207708_10016134
425 Ga0207702_10529161
426 Ga0207641_10159185
427 Ga0207648_10011707
428 Ga0207676_10033278
429 Ga0207676_10093614
430 Ga0207674_10009709
431 Ga0207675_100310108
432 Ga0207675_100696241
433 Ga0207698_10002180
434 Ga0209995_1010502
435 Ga0209968_1003368
436 Ga0307408_100040379
437 Ga0307410_10003669
438 Ga0307406_10404833
439 Ga0307412_10310639
440 Ga0307412_10395904
441 Ga0307409_100071975
442 Ga0307416_100122450
443 Ga0307414_10040789
444 Ga0307414_10040951
445 Ga0307414_10229288
446 Ga0307411_10032460
447 Ga0307411_10280374
448 Ga0307415_100187475
449 Ga0307415_100327547
450 Ga0373940_0028483
451 Ga0373941_0016993
452 Ga0373941_0043289
453 Ga0373960_0023366
454 Ga0373960_0037161
455 Ga0373960_0064140
456 Ga0373931_0242929
457 Ga0395899_0074325
458 Ga0395900_0260314
459 Ga0395898_0902448
460 Ga0395905_0043750
461 Ga0395905_0374640
462 Ga0395901_0020456
463 Ga0395901_0419501
464 Ga0436365_0016383
465 Ga0436365_0885859
466 Ga0439446_0055717
467 Ga0466961_0002914
468 Ga0451576_0075966
469 Ga0466967_0692393
470 Ga0495643_0000083
471 Ga0496102_0021730
472 Ga0496102_0106721
473 Ga0496102_0384499
474 Ga0496104_0005100
475 Ga0496105_0078889
476 Ga0496108_0001725
477 Ga0496108_0032936
478 Ga0496109_0006008
479 Ga0496109_0009003
480 Ga0496109_0139379
481 Ga0496109_0260876
482 Ga0496110_0040799
483 Ga0496110_0064285
484 Ga0496110_0530770
485 Ga0496111_0183292
486 Ga0496112_0005108
487 Ga0496113_0009112
488 Ga0496113_0023910
489 Ga0496113_0056728
490 Ga0496114_0345490
491 Ga0496114_0397642
492 Ga0501033_0317013
493 Ga0501038_0338043
494 Ga0501042_0274361
495 Ga0501067_0061419
496 Ga0501068_0201952
497 Ga0501074_0137506
498 Ga0501077_0003559
499 Ga0501080_0181237
500 Ga0501081_0060352
501 Ga0501045_0037791
502 nmdc:mga05p37_452790_c1
503 nmdc:mga06r32_392615_c1
504 nmdc:mga0n895_162081_c1
505 nmdc:mga0n895_395716_c1
506 nmdc:mga0rr50_233489_c1
507 nmdc:mga0rr50_95635_c1
508 nmdc:mga0a205_343887_c1
509 nmdc:mga0a205_49883_c1
510 Ga0500628_001212
511 Ga0590074_032362
512 Ga0501082_0194609

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

166

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9545 34 268
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.951 33 263
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9494 34 250
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9474 34 268
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9469 34 269
ID Description Score Start End Superfamily
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9813 34 266 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9805 34 265 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9762 34 269 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9601 46 265 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9601 34 269 3.40.50.300
ID Description Score Start End GO Terms
AF-V6KM77-F1-model_v4 deleted 0.9828 34 266
AF-A0A1C5EWI0-F1-model_v4 Osmoprotectant transport system ATP-binding protein 0.9826 34 266 GO:0005524
GO:0016020
GO:0016887
GO:0031460
AF-F0L4B4-F1-model_v4 deleted 0.9809 34 268
AF-A0A603BF62-F1-model_v4 ABC transporter ATP-binding protein 0.9802 34 269 GO:0005524
GO:0016887
AF-A0A6N6XD81-F1-model_v4 deleted 0.9746 34 269

Map