F366851

General Info

Members Datasets Scaffolds Average Seq Length
256 135 512 314

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0027792|Ga0501040_0027792_2598_3611
Length 337
Sequence MTSNTDSASPGADDPGSESRAPITGTIHVLGIDAGGTKTVCQLADGQGTLVAEVRGPGANLQAAGELHVEKVIHDLMDEAIGDRDVRPAAICLGIAGVDRQDDAAIVRGIMKRIGFKARVLVVNDALVALEAGIPGQPGVVIISGTGSIAYGRNRDNEAARAGGWGYVLGDEGSGYWIGRAALRAVLRASDERGPRTALTPLLLRHFGVSQAQSLLHEVYHTNLKPSAIGALARCVQQAFGEGDQVAIGILRSAADELEGSGLSVSRRLGLLGQAFEFVLSGGIFLAVPWLKDELQRRLPVSARGSSVRLLDREPAAGAVALALQEARGGARIPRYP

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
88 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
120 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
121 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.3
Nodule 0
Rhizoplane 2.34
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 9.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0027792 3300049576 Bacteria 3810
2 Ga0070676_10132561 3300005328 Bacteria 1577
3 Ga0070683_100041304 3300005329 Bacteria 4243
4 Ga0070683_100042003 3300005329 Bacteria 4210
5 Ga0070670_100006018 3300005331 Bacteria 10258
6 Ga0070670_100055388 3300005331 Bacteria 3404
7 Ga0070670_100136623 3300005331 Bacteria 2118
8 Ga0068869_100244814 3300005334 Bacteria 1430
9 Ga0070666_10016577 3300005335 Bacteria 4714
10 Ga0070669_100013573 3300005353 Bacteria 5791
11 Ga0070669_100183409 3300005353 Bacteria 1638
12 Ga0070675_100024292 3300005354 Bacteria 4854
13 Ga0070675_100263387 3300005354 Unclassified 1511
14 Ga0070671_100034655 3300005355 Bacteria 4179
15 Ga0070674_100040968 3300005356 Bacteria 3136
16 Ga0070674_100082262 3300005356 Bacteria 2303
17 Ga0070674_100109464 3300005356 Bacteria 2026
18 Ga0070673_100023467 3300005364 Bacteria 4507
19 Ga0070673_100306141 3300005364 Bacteria 1400
20 Ga0070688_100094998 3300005365 Bacteria 1956
21 Ga0070659_100279419 3300005366 Bacteria 1389
22 Ga0070701_10040653 3300005438 Bacteria 2365
23 Ga0070705_100022327 3300005440 Bacteria 3381
24 Ga0070700_100090430 3300005441 Bacteria 1996
25 Ga0068867_100004967 3300005459 Bacteria 9372
26 Ga0070672_100130911 3300005543 Bacteria 2061
27 Ga0070686_100024056 3300005544 Bacteria 3648
28 Ga0070665_100086015 3300005548 Bacteria 3150
29 Ga0070665_100472250 3300005548 Bacteria 1265
30 Ga0070702_100243316 3300005615 Bacteria 1215
31 Ga0068859_100205885 3300005617 Bacteria 2052
32 Ga0068866_10062625 3300005718 Bacteria 1936
33 Ga0068861_100114880 3300005719 Bacteria 2162
34 Ga0068858_100091195 3300005842 Bacteria 2836
35 Ga0075365_10011159 3300006038 Bacteria 5272
36 Ga0075365_10047579 3300006038 Bacteria 2820
37 Ga0075368_10005591 3300006042 Bacteria 4334
38 Ga0075363_100062945 3300006048 Bacteria 2001
39 Ga0075364_10044958 3300006051 Bacteria 2873
40 Ga0075367_10006502 3300006178 Bacteria 5908
41 Ga0075366_10104518 3300006195 Bacteria 1701
42 Ga0075370_10005347 3300006353 Bacteria 6370
43 Ga0075370_10024786 3300006353 Bacteria 3317
44 Ga0075428_100006680 3300006844 Bacteria 12835
45 Ga0075428_100031953 3300006844 Bacteria 5815
46 Ga0075428_100037693 3300006844 Bacteria 5320
47 Ga0075428_100353149 3300006844 Unclassified 1578
48 Ga0075430_100003992 3300006846 Bacteria 12437
49 Ga0075430_100006132 3300006846 Bacteria 10129
50 Ga0075430_100112110 3300006846 Bacteria 2274
51 Ga0075430_100178582 3300006846 Bacteria 1766
52 Ga0075431_100031728 3300006847 Bacteria 5442
53 Ga0075431_100165217 3300006847 Bacteria 2275
54 Ga0075431_100185114 3300006847 Bacteria 2136
55 Ga0075431_100196870 3300006847 Archaea 2063
56 Ga0075431_100237937 3300006847 Bacteria 1853
57 Ga0075431_100289260 3300006847 Bacteria 1658
58 Ga0075433_10033706 3300006852 Bacteria 4392
59 Ga0075433_10104362 3300006852 Bacteria 2511
60 Ga0075429_100044991 3300006880 Bacteria 3840
61 Ga0075429_100171735 3300006880 Bacteria 1899
62 Ga0097620_100205896 3300006931 Bacteria 2052
63 Ga0075435_100024505 3300007076 Bacteria 4685
64 Ga0075435_100025281 3300007076 Bacteria 4621
65 Ga0075435_100231121 3300007076 Unclassified 1571
66 Ga0111539_10008612 3300009094 Bacteria 12958
67 Ga0111539_10393880 3300009094 Bacteria 1613
68 Ga0105245_10081500 3300009098 Bacteria 2959
69 Ga0114129_10011611 3300009147 Bacteria 12540
70 Ga0114129_10012839 3300009147 Bacteria 11920
71 Ga0114129_10014515 3300009147 Bacteria 11227
72 Ga0114129_10050110 3300009147 Bacteria 5866
73 Ga0114129_10057699 3300009147 Bacteria 5431
74 Ga0114129_10062018 3300009147 Bacteria 5224
75 Ga0114129_10108426 3300009147 Bacteria 3834
76 Ga0114129_10857415 3300009147 Unclassified 1154
77 Ga0105248_10025289 3300009177 Bacteria 6601
78 Ga0105249_10008015 3300009553 Bacteria 9206
79 Ga0105249_10032600 3300009553 Bacteria 4714
80 Ga0105249_10292847 3300009553 Bacteria 1630
81 Ga0105239_10262266 3300010375 Bacteria 1942
82 Ga0157380_10114223 3300014326 Bacteria 2275
83 Ga0157380_10275740 3300014326 Unclassified 1536
84 Ga0157380_10343118 3300014326 Bacteria 1394
85 Ga0207697_10001271 3300025315 Bacteria 13836
86 Ga0207688_10010667 3300025901 Bacteria 4998
87 Ga0207688_10029617 3300025901 Bacteria 3015
88 Ga0207645_10010162 3300025907 Bacteria 6470
89 Ga0207662_10002662 3300025918 Bacteria 9007
90 Ga0207657_10306356 3300025919 Bacteria 1258
91 Ga0207650_10031685 3300025925 Bacteria 3819
92 Ga0207650_10183311 3300025925 Unclassified 1669
93 Ga0207659_10095095 3300025926 Bacteria 2234
94 Ga0207659_10285776 3300025926 Bacteria 1350
95 Ga0207709_10017990 3300025935 Bacteria 3952
96 Ga0207709_10104617 3300025935 Unclassified 1879
97 Ga0207670_10061170 3300025936 Bacteria 2569
98 Ga0207669_10436723 3300025937 Bacteria 1034
99 Ga0207691_10155465 3300025940 Bacteria 2009
100 Ga0207691_10301358 3300025940 Unclassified 1377
101 Ga0207689_10018486 3300025942 Bacteria 5882
102 Ga0207661_10022308 3300025944 Bacteria 4765
103 Ga0207679_10332784 3300025945 Bacteria 1318
104 Ga0207651_10148228 3300025960 Bacteria 1822
105 Ga0207712_10046139 3300025961 Bacteria 3020
106 Ga0207712_10306164 3300025961 Bacteria 1306
107 Ga0207648_10005581 3300026089 Bacteria 12655
108 Ga0207674_10026790 3300026116 Bacteria 6114
109 Ga0207675_100069414 3300026118 Bacteria 3294
110 Ga0207675_100110074 3300026118 Bacteria 2599
111 Ga0207683_10157760 3300026121 Bacteria 2050
112 Ga0207428_10033255 3300027907 Unclassified 4236
113 Ga0307408_100032700 3300031548 Unclassified 3628
114 Ga0307408_100058884 3300031548 Bacteria 2794
115 Ga0307408_100438754 3300031548 Bacteria 1130
116 Ga0316579_10019118 3300031691 Bacteria 3023
117 Ga0307405_10011964 3300031731 Bacteria 4573
118 Ga0307405_10016324 3300031731 Bacteria 4048
119 Ga0307413_10026877 3300031824 Bacteria 3179
120 Ga0307413_10057301 3300031824 Bacteria 2382
121 Ga0307413_10084258 3300031824 Bacteria 2048
122 Ga0307410_10010870 3300031852 Bacteria 5182
123 Ga0307406_10067849 3300031901 Bacteria 2327
124 Ga0307407_10018150 3300031903 Bacteria 3551
125 Ga0307407_10019875 3300031903 Bacteria 3428
126 Ga0307407_10117025 3300031903 Bacteria 1683
127 Ga0307412_10308118 3300031911 Bacteria 1254
128 Ga0307409_100011903 3300031995 Bacteria 5513
129 Ga0307409_100013723 3300031995 Bacteria 5232
130 Ga0307409_100056533 3300031995 Bacteria 3035
131 Ga0307409_100103534 3300031995 Unclassified 2368
132 Ga0307409_100377163 3300031995 Bacteria 1347
133 Ga0307416_100009195 3300032002 Bacteria 6447
134 Ga0307416_100043634 3300032002 Bacteria 3513
135 Ga0307416_100082584 3300032002 Bacteria 2722
136 Ga0307416_100603242 3300032002 Bacteria 1178
137 Ga0307414_10045437 3300032004 Bacteria 3008
138 Ga0307411_10019232 3300032005 Bacteria 3941
139 Ga0307411_10141248 3300032005 Bacteria 1776
140 Ga0307411_10153372 3300032005 Bacteria 1715
141 Ga0307415_100265810 3300032126 Bacteria 1402
142 Ga0373947_0060863 3300035725 Bacteria 2293
143 Ga0373937_0026124 3300036401 Bacteria 5276
144 Ga0373937_0178171 3300036401 Bacteria 1996
145 Ga0316582_0053224 3300036647 Bacteria 2574
146 Ga0373925_0239694 3300037068 Bacteria 1452
147 Ga0451853_0355932 3300041512 Bacteria 1342
148 Ga0439431_0004825 3300041997 Bacteria 2971
149 Ga0439433_0008823 3300041999 Bacteria 2192
150 Ga0439451_023342 3300042009 Bacteria 1246
151 Ga0439457_038439 3300042014 Bacteria 1065
152 Ga0439446_0021368 3300042156 Unclassified 1829
153 Ga0439435_0018589 3300042436 Bacteria 1771
154 Ga0439435_0023356 3300042436 Bacteria 1624
155 Ga0439435_0035737 3300042436 Bacteria 1371
156 Ga0495667_0213475 3300046559 Bacteria 1233
157 Ga0495674_0290114 3300047319 Bacteria 1338
158 Ga0496106_0074664 3300048909 Bacteria 2596
159 Ga0496106_0249107 3300048909 Unclassified 1420
160 Ga0496110_0132230 3300048913 Bacteria 2254
161 Ga0496112_0009831 3300048915 Bacteria 8643
162 Ga0496113_0279914 3300048916 Bacteria 1334
163 Ga0496113_0368898 3300048916 Bacteria 1152
164 Ga0501031_0094576 3300049568 Unclassified 1950
165 Ga0501031_0114855 3300049568 Bacteria 1759
166 Ga0501034_0012708 3300049571 Bacteria 8684
167 Ga0501036_0187201 3300049572 Bacteria 1742
168 Ga0501038_0136073 3300049574 Unclassified 2013
169 Ga0501038_0147512 3300049574 Bacteria 1920
170 Ga0501039_0043362 3300049575 Bacteria 3475
171 Ga0501040_0046963 3300049576 Bacteria 2948
172 Ga0501040_0062462 3300049576 Bacteria 2563
173 Ga0501041_0192479 3300049577 Bacteria 1278
174 Ga0501041_0208277 3300049577 Bacteria 1226
175 Ga0501042_0338615 3300049578 Bacteria 1087
176 Ga0501046_0074428 3300049580 Bacteria 2635
177 Ga0501046_0254015 3300049580 Bacteria 1293
178 Ga0501048_0086391 3300049582 Bacteria 2213
179 Ga0501067_0020995 3300049583 Bacteria 3613
180 Ga0501069_0227647 3300049585 Bacteria 1085
181 Ga0501071_0061224 3300049587 Bacteria 2726
182 Ga0501072_0016720 3300049588 Bacteria 5637
183 Ga0501072_0053560 3300049588 Bacteria 3178
184 Ga0501072_0108919 3300049588 Unclassified 2204
185 Ga0501072_0146161 3300049588 Bacteria 1885
186 Ga0501072_0158922 3300049588 Unclassified 1803
187 Ga0501072_0270035 3300049588 Unclassified 1353
188 Ga0501073_0082757 3300049589 Bacteria 2233
189 Ga0501074_0282545 3300049590 Bacteria 1180
190 Ga0501075_0025594 3300049591 Bacteria 4336
191 Ga0501075_0039207 3300049591 Bacteria 3545
192 Ga0501075_0047288 3300049591 Bacteria 3233
193 Ga0501075_0108537 3300049591 Bacteria 2110
194 Ga0501075_0338594 3300049591 Bacteria 1146
195 Ga0501076_0020060 3300049592 Bacteria 5113
196 Ga0501076_0051601 3300049592 Bacteria 3256
197 Ga0501076_0052802 3300049592 Bacteria 3220
198 Ga0501076_0138468 3300049592 Bacteria 1977
199 Ga0501076_0465413 3300049592 Bacteria 1041
200 Ga0501077_0143964 3300049593 Bacteria 1512
201 Ga0501077_0206399 3300049593 Bacteria 1248
202 Ga0501079_0111283 3300049741 Bacteria 2128
203 Ga0501080_0025433 3300049742 Bacteria 5495
204 Ga0501080_0123553 3300049742 Bacteria 2398
205 Ga0501080_0427806 3300049742 Bacteria 1189
206 Ga0501080_0572976 3300049742 Unclassified 1004
207 Ga0501081_0084368 3300049743 Bacteria 2228
208 Ga0501081_0090337 3300049743 Bacteria 2153
209 Ga0501081_0092512 3300049743 Bacteria 2128
210 Ga0501081_0210795 3300049743 Bacteria 1411
211 Ga0501081_0221014 3300049743 Bacteria 1378
212 Ga0501273_006328 3300049770 Bacteria 1367
213 Ga0501045_0025540 3300049824 Bacteria 4248
214 Ga0501045_0052076 3300049824 Bacteria 2988
215 nmdc:mga0yw44_1144_c1 3300050492 Bacteria 10268
216 nmdc:mga07m45_2332_c1 3300050496 Bacteria 8893
217 nmdc:mga05p37_116951_c1 3300050507 Bacteria 3277
218 nmdc:mga05p37_192175_c1 3300050507 Bacteria 2477
219 nmdc:mga05p37_2672_c1 3300050507 Bacteria 20758
220 nmdc:mga05p37_29217_c1 3300050507 Bacteria 6729
221 nmdc:mga05p37_43626_c1 3300050507 Bacteria 5517
222 nmdc:mga05p37_665551_c1 3300050507 Unclassified 1163
223 nmdc:mga05p37_99924_c1 3300050507 Bacteria 3573
224 nmdc:mga09592_107528_c1 3300050508 Unclassified 2392
225 nmdc:mga09592_14356_c1 3300050508 Bacteria 6466
226 nmdc:mga09592_147770_c1 3300050508 Bacteria 2027
227 nmdc:mga0qj67_3954_c1 3300050509 Bacteria 10725
228 nmdc:mga0qj67_44945_c1 3300050509 Bacteria 3484
229 nmdc:mga06r32_139137_c1 3300050510 Bacteria 2403
230 nmdc:mga06r32_14953_c1 3300050510 Bacteria 7044
231 nmdc:mga06r32_17635_c1 3300050510 Bacteria 2373
232 nmdc:mga06r32_228702_c1 3300050510 Archaea 1848
233 nmdc:mga06r32_333445_c1 3300050510 Bacteria 1502
234 nmdc:mga08y16_120434_c1 3300050511 Unclassified 2731
235 nmdc:mga08y16_7334_c1 3300050511 Bacteria 11568
236 nmdc:mga0n895_131250_c1 3300050512 Bacteria 2530
237 nmdc:mga0n895_172975_c1 3300050512 Bacteria 2191
238 nmdc:mga0n895_2406_c1 3300050512 Bacteria 14584
239 nmdc:mga0rr50_118083_c1 3300050513 Unclassified 2107
240 nmdc:mga0rr50_28645_c1 3300050513 Bacteria 3918
241 nmdc:mga0a205_155044_c1 3300050515 Unclassified 2189
242 nmdc:mga0a205_37209_c1 3300050515 Bacteria 4680
243 nmdc:mga0a205_78309_c1 3300050515 Bacteria 3194
244 Ga0501084_0022526 3300054114 Bacteria 5257
245 Ga0501084_0023011 3300054114 Bacteria 5202
246 Ga0501084_0068020 3300054114 Bacteria 2982
247 Ga0501084_0264458 3300054114 Bacteria 1452
248 Ga0501084_0379818 3300054114 Bacteria 1194
249 Ga0590071_001051 3300059421 Bacteria 7479
250 Ga0590075_000296 3300059424 Bacteria 14075
251 Ga0590075_026683 3300059424 Bacteria 1455
252 Ga0501082_0025243 3300060353 Bacteria 5121
253 Ga0501082_0048069 3300060353 Bacteria 3677
254 Ga0501082_0053758 3300060353 Bacteria 3471
255 Ga0501082_0081369 3300060353 Bacteria 2795
256 Ga0530510_0075394 3300061734 Unclassified 2450
257 Ga0501040_0027792
258 Ga0070676_10132561
259 Ga0070683_100041304
260 Ga0070683_100042003
261 Ga0070670_100006018
262 Ga0070670_100055388
263 Ga0070670_100136623
264 Ga0068869_100244814
265 Ga0070666_10016577
266 Ga0070669_100013573
267 Ga0070669_100183409
268 Ga0070675_100024292
269 Ga0070675_100263387
270 Ga0070671_100034655
271 Ga0070674_100040968
272 Ga0070674_100082262
273 Ga0070674_100109464
274 Ga0070673_100023467
275 Ga0070673_100306141
276 Ga0070688_100094998
277 Ga0070659_100279419
278 Ga0070701_10040653
279 Ga0070705_100022327
280 Ga0070700_100090430
281 Ga0068867_100004967
282 Ga0070672_100130911
283 Ga0070686_100024056
284 Ga0070665_100086015
285 Ga0070665_100472250
286 Ga0070702_100243316
287 Ga0068859_100205885
288 Ga0068866_10062625
289 Ga0068861_100114880
290 Ga0068858_100091195
291 Ga0075365_10011159
292 Ga0075365_10047579
293 Ga0075368_10005591
294 Ga0075363_100062945
295 Ga0075364_10044958
296 Ga0075367_10006502
297 Ga0075366_10104518
298 Ga0075370_10005347
299 Ga0075370_10024786
300 Ga0075428_100006680
301 Ga0075428_100031953
302 Ga0075428_100037693
303 Ga0075428_100353149
304 Ga0075430_100003992
305 Ga0075430_100006132
306 Ga0075430_100112110
307 Ga0075430_100178582
308 Ga0075431_100031728
309 Ga0075431_100165217
310 Ga0075431_100185114
311 Ga0075431_100196870
312 Ga0075431_100237937
313 Ga0075431_100289260
314 Ga0075433_10033706
315 Ga0075433_10104362
316 Ga0075429_100044991
317 Ga0075429_100171735
318 Ga0097620_100205896
319 Ga0075435_100024505
320 Ga0075435_100025281
321 Ga0075435_100231121
322 Ga0111539_10008612
323 Ga0111539_10393880
324 Ga0105245_10081500
325 Ga0114129_10011611
326 Ga0114129_10012839
327 Ga0114129_10014515
328 Ga0114129_10050110
329 Ga0114129_10057699
330 Ga0114129_10062018
331 Ga0114129_10108426
332 Ga0114129_10857415
333 Ga0105248_10025289
334 Ga0105249_10008015
335 Ga0105249_10032600
336 Ga0105249_10292847
337 Ga0105239_10262266
338 Ga0157380_10114223
339 Ga0157380_10275740
340 Ga0157380_10343118
341 Ga0207697_10001271
342 Ga0207688_10010667
343 Ga0207688_10029617
344 Ga0207645_10010162
345 Ga0207662_10002662
346 Ga0207657_10306356
347 Ga0207650_10031685
348 Ga0207650_10183311
349 Ga0207659_10095095
350 Ga0207659_10285776
351 Ga0207709_10017990
352 Ga0207709_10104617
353 Ga0207670_10061170
354 Ga0207669_10436723
355 Ga0207691_10155465
356 Ga0207691_10301358
357 Ga0207689_10018486
358 Ga0207661_10022308
359 Ga0207679_10332784
360 Ga0207651_10148228
361 Ga0207712_10046139
362 Ga0207712_10306164
363 Ga0207648_10005581
364 Ga0207674_10026790
365 Ga0207675_100069414
366 Ga0207675_100110074
367 Ga0207683_10157760
368 Ga0207428_10033255
369 Ga0307408_100032700
370 Ga0307408_100058884
371 Ga0307408_100438754
372 Ga0316579_10019118
373 Ga0307405_10011964
374 Ga0307405_10016324
375 Ga0307413_10026877
376 Ga0307413_10057301
377 Ga0307413_10084258
378 Ga0307410_10010870
379 Ga0307406_10067849
380 Ga0307407_10018150
381 Ga0307407_10019875
382 Ga0307407_10117025
383 Ga0307412_10308118
384 Ga0307409_100011903
385 Ga0307409_100013723
386 Ga0307409_100056533
387 Ga0307409_100103534
388 Ga0307409_100377163
389 Ga0307416_100009195
390 Ga0307416_100043634
391 Ga0307416_100082584
392 Ga0307416_100603242
393 Ga0307414_10045437
394 Ga0307411_10019232
395 Ga0307411_10141248
396 Ga0307411_10153372
397 Ga0307415_100265810
398 Ga0373947_0060863
399 Ga0373937_0026124
400 Ga0373937_0178171
401 Ga0316582_0053224
402 Ga0373925_0239694
403 Ga0451853_0355932
404 Ga0439431_0004825
405 Ga0439433_0008823
406 Ga0439451_023342
407 Ga0439457_038439
408 Ga0439446_0021368
409 Ga0439435_0018589
410 Ga0439435_0023356
411 Ga0439435_0035737
412 Ga0495667_0213475
413 Ga0495674_0290114
414 Ga0496106_0074664
415 Ga0496106_0249107
416 Ga0496110_0132230
417 Ga0496112_0009831
418 Ga0496113_0279914
419 Ga0496113_0368898
420 Ga0501031_0094576
421 Ga0501031_0114855
422 Ga0501034_0012708
423 Ga0501036_0187201
424 Ga0501038_0136073
425 Ga0501038_0147512
426 Ga0501039_0043362
427 Ga0501040_0046963
428 Ga0501040_0062462
429 Ga0501041_0192479
430 Ga0501041_0208277
431 Ga0501042_0338615
432 Ga0501046_0074428
433 Ga0501046_0254015
434 Ga0501048_0086391
435 Ga0501067_0020995
436 Ga0501069_0227647
437 Ga0501071_0061224
438 Ga0501072_0016720
439 Ga0501072_0053560
440 Ga0501072_0108919
441 Ga0501072_0146161
442 Ga0501072_0158922
443 Ga0501072_0270035
444 Ga0501073_0082757
445 Ga0501074_0282545
446 Ga0501075_0025594
447 Ga0501075_0039207
448 Ga0501075_0047288
449 Ga0501075_0108537
450 Ga0501075_0338594
451 Ga0501076_0020060
452 Ga0501076_0051601
453 Ga0501076_0052802
454 Ga0501076_0138468
455 Ga0501076_0465413
456 Ga0501077_0143964
457 Ga0501077_0206399
458 Ga0501079_0111283
459 Ga0501080_0025433
460 Ga0501080_0123553
461 Ga0501080_0427806
462 Ga0501080_0572976
463 Ga0501081_0084368
464 Ga0501081_0090337
465 Ga0501081_0092512
466 Ga0501081_0210795
467 Ga0501081_0221014
468 Ga0501273_006328
469 Ga0501045_0025540
470 Ga0501045_0052076
471 nmdc:mga0yw44_1144_c1
472 nmdc:mga07m45_2332_c1
473 nmdc:mga05p37_116951_c1
474 nmdc:mga05p37_192175_c1
475 nmdc:mga05p37_2672_c1
476 nmdc:mga05p37_29217_c1
477 nmdc:mga05p37_43626_c1
478 nmdc:mga05p37_665551_c1
479 nmdc:mga05p37_99924_c1
480 nmdc:mga09592_107528_c1
481 nmdc:mga09592_14356_c1
482 nmdc:mga09592_147770_c1
483 nmdc:mga0qj67_3954_c1
484 nmdc:mga0qj67_44945_c1
485 nmdc:mga06r32_139137_c1
486 nmdc:mga06r32_14953_c1
487 nmdc:mga06r32_17635_c1
488 nmdc:mga06r32_228702_c1
489 nmdc:mga06r32_333445_c1
490 nmdc:mga08y16_120434_c1
491 nmdc:mga08y16_7334_c1
492 nmdc:mga0n895_131250_c1
493 nmdc:mga0n895_172975_c1
494 nmdc:mga0n895_2406_c1
495 nmdc:mga0rr50_118083_c1
496 nmdc:mga0rr50_28645_c1
497 nmdc:mga0a205_155044_c1
498 nmdc:mga0a205_37209_c1
499 nmdc:mga0a205_78309_c1
500 Ga0501084_0022526
501 Ga0501084_0023011
502 Ga0501084_0068020
503 Ga0501084_0264458
504 Ga0501084_0379818
505 Ga0590071_001051
506 Ga0590075_000296
507 Ga0590075_026683
508 Ga0501082_0025243
509 Ga0501082_0048069
510 Ga0501082_0053758
511 Ga0501082_0081369
512 Ga0530510_0075394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01869

BcrAD_BadFG

BadF/BadG/BcrA/BcrD ATPase family

30

323

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e2o-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii hexokinase in complex with glucose 0.8555 1 302
2e2o-assembly1.cif.gz_A crystal structure of sulfolobus tokodaii hexokinase in complex with glucose 0.8244 1 302
1zc6-assembly1.cif.gz_A crystal structure of putative n-acetylglucosamine kinase from chromobacterium violaceum. northeast structural genomics target cvr23. 0.8213 1 300
1zc6-assembly1.cif.gz_A crystal structure of putative n-acetylglucosamine kinase from chromobacterium violaceum. northeast structural genomics target cvr23. 0.8109 1 300
2ch5-assembly1.cif.gz_A crystal structure of human n-acetylglucosamine kinase in complex with n-acetylglucosamine 0.8068 2 315
ID Description Score Start End Superfamily
af_Q54PM7_128_317_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9282 115 301 3.30.420.40
af_A0A0R0GHR8_84_264_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9188 117 290 3.30.420.40
af_Q54PM7_128_294_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9137 115 279 3.30.420.40
af_A0A1D6DWZ1_6_279_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9112 2 32 3.30.420.40
af_Q54PM7_128_317_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9097 115 301 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A317HTF7-F1-model_v4 ATPase BadF/BadG/BcrA/BcrD type domain-containing protein 0.9603 99 313
AF-A0A317HTF7-F1-model_v4 ATPase BadF/BadG/BcrA/BcrD type domain-containing protein 0.956 99 313
AF-A0A2R6C3C6-F1-model_v4 ATPase BadF/BadG/BcrA/BcrD type domain-containing protein 0.9507 2 138
AF-A0A7Y5U546-F1-model_v4 ATPase 0.9499 144 315
AF-A0A2V7TWW1-F1-model_v4 ATPase 0.9477 1 301

Map