F366729

General Info

Members Datasets Scaffolds Average Seq Length
256 151 512 67

Family's Representative Sequence

Representative Sequence 3300045836|Ga0466958_0430695|Ga0466958_0430695_86_316
Length 76
Sequence MAGEFQDIRARLEAIAEELADLAIERLRESIDAGGSELPVDERRLTRARRAVERAAAILAEPDDFDRRVGFDPDLD

Samples

Sample ID Description Type Environment
1 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
62 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
63 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
72 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
73 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
74 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
75 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
76 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
77 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
87 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
88 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
101 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
147 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 0
Rhizoplane 3.52
Rhizosphere 78.52
Stem 0
Stem Tuber 0
Unclassified 11.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466958_0430695 3300045836 Unclassified 853
2 Ga0070683_100952051 3300005329 Bacteria 824
3 Ga0070683_101983231 3300005329 Bacteria 559
4 Ga0070714_100238869 3300005435 Bacteria 1676
5 Ga0070714_100922417 3300005435 Unclassified 848
6 Ga0070678_100334429 3300005456 Bacteria 1297
7 Ga0070681_10989796 3300005458 Bacteria 761
8 Ga0070706_101986336 3300005467 Bacteria 527
9 Ga0070695_101861404 3300005545 Bacteria 505
10 Ga0070665_101243946 3300005548 Bacteria 755
11 Ga0068855_100091235 3300005563 Bacteria 3515
12 Ga0068855_102275799 3300005563 Unclassified 543
13 Ga0068856_101850047 3300005614 Unclassified 615
14 Ga0068866_10459279 3300005718 Bacteria 835
15 Ga0068861_100697061 3300005719 Bacteria 943
16 Ga0068858_100584975 3300005842 Bacteria 1082
17 Ga0081455_10083767 3300005937 Bacteria 2605
18 Ga0081455_10268838 3300005937 Bacteria 1238
19 Ga0075365_10010403 3300006038 Bacteria 5417
20 Ga0075365_10138402 3300006038 Bacteria 1689
21 Ga0075365_10159591 3300006038 Bacteria 1571
22 Ga0075365_10224575 3300006038 Bacteria 1318
23 Ga0075365_10338729 3300006038 Bacteria 1060
24 Ga0075368_10216430 3300006042 Bacteria 813
25 Ga0075363_100354961 3300006048 Bacteria 857
26 Ga0075363_100513612 3300006048 Unclassified 712
27 Ga0075364_10060543 3300006051 Bacteria 2483
28 Ga0075364_10324655 3300006051 Bacteria 1048
29 Ga0075364_10573262 3300006051 Bacteria 771
30 Ga0075362_10578258 3300006177 Bacteria 579
31 Ga0075367_10102601 3300006178 Bacteria 1750
32 Ga0075369_10350981 3300006186 Bacteria 692
33 Ga0068871_101480096 3300006358 Bacteria 641
34 Ga0075428_100001476 3300006844 Bacteria 25154
35 Ga0075428_100004330 3300006844 Bacteria 15652
36 Ga0075428_100811240 3300006844 Unclassified 994
37 Ga0075428_101771481 3300006844 Bacteria 643
38 Ga0075430_100003006 3300006846 Bacteria 14108
39 Ga0075430_100046108 3300006846 Bacteria 3681
40 Ga0075430_100682778 3300006846 Unclassified 846
41 Ga0075431_100033644 3300006847 Bacteria 5281
42 Ga0075431_100279482 3300006847 Bacteria 1690
43 Ga0075429_100000318 3300006880 Bacteria 34563
44 Ga0075429_100143959 3300006880 Bacteria 2086
45 Ga0075429_100764301 3300006880 Unclassified 846
46 Ga0111539_10022308 3300009094 Bacteria 7780
47 Ga0105245_10145420 3300009098 Bacteria 2236
48 Ga0105245_10388548 3300009098 Bacteria 1391
49 Ga0105245_11281623 3300009098 Bacteria 781
50 Ga0114129_10000100 3300009147 Bacteria 84154
51 Ga0114129_10101573 3300009147 Bacteria 3979
52 Ga0114129_10412865 3300009147 Bacteria 1777
53 Ga0105243_11811068 3300009148 Bacteria 642
54 Ga0105243_12790154 3300009148 Bacteria 529
55 Ga0105237_11619270 3300009545 Bacteria 654
56 Ga0105237_11662887 3300009545 Bacteria 645
57 Ga0105238_12176394 3300009551 Bacteria 589
58 Ga0105249_11188735 3300009553 Bacteria 833
59 Ga0105246_10171032 3300011119 Bacteria 1664
60 Ga0105246_11748276 3300011119 Bacteria 592
61 Ga0157369_10476462 3300013105 Bacteria 1292
62 Ga0163162_11023991 3300013306 Bacteria 934
63 Ga0163162_12128519 3300013306 Bacteria 644
64 Ga0157375_10408656 3300013308 Bacteria 1524
65 Ga0157375_13331471 3300013308 Unclassified 535
66 Ga0157380_10305024 3300014326 Bacteria 1469
67 Ga0213873_10007623 3300021358 Bacteria 2177
68 Ga0213876_10005862 3300021384 Bacteria 6726
69 Ga0213876_10015275 3300021384 Bacteria 4066
70 Ga0213876_10047165 3300021384 Bacteria 2278
71 Ga0213875_10073953 3300021388 Bacteria 1590
72 Ga0213875_10672713 3300021388 Bacteria 502
73 Ga0207707_10704448 3300025912 Unclassified 848
74 Ga0207693_10630426 3300025915 Bacteria 833
75 Ga0207694_11316564 3300025924 Bacteria 611
76 Ga0207687_10264871 3300025927 Bacteria 1371
77 Ga0207687_10813498 3300025927 Bacteria 797
78 Ga0207664_10229230 3300025929 Unclassified 1614
79 Ga0207661_11009743 3300025944 Bacteria 766
80 Ga0207661_11375811 3300025944 Bacteria 648
81 Ga0207667_10089647 3300025949 Bacteria 3178
82 Ga0207712_12042811 3300025961 Bacteria 513
83 Ga0207703_10479333 3300026035 Bacteria 1166
84 Ga0207702_10948232 3300026078 Bacteria 853
85 Ga0207675_100874792 3300026118 Bacteria 914
86 Ga0207683_10887257 3300026121 Bacteria 828
87 Ga0209813_10232520 3300027866 Bacteria 694
88 Ga0207428_10125823 3300027907 Bacteria 1963
89 Ga0268266_10371704 3300028379 Bacteria 1347
90 Ga0268266_11723347 3300028379 Bacteria 602
91 Ga0268264_10413063 3300028381 Bacteria 1300
92 Ga0265334_10146289 3300028573 Bacteria 835
93 Ga0265338_10211360 3300028800 Bacteria 1456
94 Ga0265327_10155869 3300031251 Bacteria 1058
95 Ga0265327_10375260 3300031251 Unclassified 619
96 Ga0316575_10080271 3300031665 Bacteria 1316
97 Ga0316576_10084204 3300031727 Bacteria 2363
98 Ga0316578_10071525 3300031728 Unclassified 2054
99 Ga0307405_10100856 3300031731 Bacteria 1936
100 Ga0307410_10271765 3300031852 Bacteria 1326
101 Ga0307407_11672485 3300031903 Bacteria 506
102 Ga0307409_100147814 3300031995 Bacteria 2035
103 Ga0307416_101690778 3300032002 Bacteria 738
104 Ga0307411_10050769 3300032005 Bacteria 2703
105 Ga0307411_10928934 3300032005 Bacteria 775
106 Ga0307415_100241900 3300032126 Bacteria 1460
107 Ga0307415_100645033 3300032126 Bacteria 948
108 Ga0307415_101920039 3300032126 Bacteria 575
109 Ga0307415_102079425 3300032126 Bacteria 554
110 Ga0307415_102343642 3300032126 Unclassified 524
111 Ga0316585_10308665 3300032137 Unclassified 526
112 Ga0373930_0026963 3300034816 Bacteria 1161
113 Ga0373928_0000339 3300035084 Bacteria 9374
114 Ga0373929_0009964 3300035085 Bacteria 1768
115 Ga0373932_0004604 3300035112 Bacteria 3257
116 Ga0373941_0303548 3300035115 Bacteria 638
117 Ga0316574_0064171 3300035398 Bacteria 2311
118 Ga0316574_0200722 3300035398 Bacteria 1281
119 Ga0373931_0000005 3300035691 Bacteria 480485
120 Ga0373931_0014511 3300035691 Bacteria 3852
121 Ga0316584_0267034 3300036712 Bacteria 1246
122 Ga0373925_1423170 3300037068 Bacteria 568
123 Ga0436364_0232550 3300037853 Unclassified 836
124 Ga0436364_0620230 3300037853 Bacteria 511
125 Ga0436364_1113919 3300037853 Unclassified 1118
126 Ga0436364_1534535 3300037853 Bacteria 1622
127 Ga0400483_239268 3300039062 Bacteria 1007
128 Ga0436365_0817468 3300039437 Bacteria 4099
129 Ga0436365_1171488 3300039437 Bacteria 23892
130 Ga0436365_1465899 3300039437 Bacteria 8688
131 Ga0436360_1027226 3300039438 Bacteria 1462
132 Ga0436361_0337452 3300039447 Unclassified 2054
133 Ga0436363_1010643 3300039450 Unclassified 549
134 Ga0451789_0339646 3300041443 Bacteria 558
135 Ga0450902_068549 3300042137 Bacteria 617
136 Ga0466966_0155708 3300044684 Bacteria 1392
137 Ga0466961_0597657 3300044693 Bacteria 664
138 Ga0466959_1071583 3300045049 Bacteria 536
139 Ga0466958_1100728 3300045836 Unclassified 519
140 Ga0466967_1582418 3300045976 Bacteria 653
141 Ga0495628_0451260 3300046516 Bacteria 934
142 Ga0495630_0211047 3300046517 Bacteria 1482
143 Ga0495642_0330278 3300046528 Unclassified 669
144 Ga0495658_0064681 3300046683 Unclassified 2108
145 Ga0495658_0400100 3300046683 Bacteria 875
146 Ga0495658_0497086 3300046683 Bacteria 780
147 Ga0495600_0295957 3300046809 Bacteria 1022
148 Ga0495604_0862423 3300047317 Bacteria 567
149 Ga0495680_0277886 3300047322 Bacteria 1181
150 Ga0496101_1075267 3300048904 Bacteria 632
151 Ga0496102_1215781 3300048905 Bacteria 673
152 Ga0496105_1411756 3300048908 Bacteria 504
153 Ga0496109_0932949 3300048912 Bacteria 806
154 Ga0496110_1533936 3300048913 Bacteria 576
155 Ga0496111_0584670 3300048914 Bacteria 818
156 Ga0496114_0263403 3300048917 Bacteria 1518
157 Ga0496114_0647162 3300048917 Bacteria 930
158 Ga0501031_0007634 3300049568 Bacteria 7040
159 Ga0501032_0029310 3300049569 Bacteria 3777
160 Ga0501032_0870121 3300049569 Bacteria 568
161 Ga0501033_0000788 3300049570 Bacteria 29039
162 Ga0501033_0038917 3300049570 Bacteria 3553
163 Ga0501034_0000312 3300049571 Bacteria 86122
164 Ga0501034_0003672 3300049571 Bacteria 17351
165 Ga0501034_0412581 3300049571 Bacteria 1272
166 Ga0501036_0016168 3300049572 Bacteria 6233
167 Ga0501036_0189240 3300049572 Bacteria 1732
168 Ga0501037_0040792 3300049573 Bacteria 3415
169 Ga0501037_0218408 3300049573 Bacteria 1342
170 Ga0501039_0005355 3300049575 Bacteria 9707
171 Ga0501039_0874671 3300049575 Bacteria 700
172 Ga0501040_0002098 3300049576 Bacteria 12847
173 Ga0501042_0029044 3300049578 Bacteria 3900
174 Ga0501043_1194969 3300049579 Bacteria 534
175 Ga0501046_0010229 3300049580 Bacteria 8074
176 Ga0501047_0108463 3300049581 Bacteria 2659
177 Ga0501048_0021737 3300049582 Bacteria 4695
178 Ga0501067_0250405 3300049583 Bacteria 986
179 Ga0501068_0003592 3300049584 Bacteria 8383
180 Ga0501068_0015171 3300049584 Bacteria 4420
181 Ga0501068_0919651 3300049584 Unclassified 576
182 Ga0501069_0001671 3300049585 Bacteria 11028
183 Ga0501070_0022964 3300049586 Bacteria 5221
184 Ga0501070_0172066 3300049586 Bacteria 1784
185 Ga0501070_0181794 3300049586 Bacteria 1730
186 Ga0501071_0002740 3300049587 Bacteria 10806
187 Ga0501071_0015380 3300049587 Bacteria 5252
188 Ga0501071_0159295 3300049587 Bacteria 1686
189 Ga0501071_0352790 3300049587 Bacteria 1120
190 Ga0501072_0001981 3300049588 Bacteria 15253
191 Ga0501072_0004882 3300049588 Bacteria 10200
192 Ga0501072_0022053 3300049588 Bacteria 4941
193 Ga0501072_0085816 3300049588 Bacteria 2497
194 Ga0501072_0975047 3300049588 Bacteria 661
195 Ga0501073_0000331 3300049589 Bacteria 31798
196 Ga0501073_0001388 3300049589 Bacteria 17858
197 Ga0501073_0213908 3300049589 Bacteria 1332
198 Ga0501074_0000214 3300049590 Bacteria 31807
199 Ga0501074_0810751 3300049590 Unclassified 659
200 Ga0501075_0002837 3300049591 Bacteria 11621
201 Ga0501076_0001050 3300049592 Bacteria 18122
202 Ga0501076_0284744 3300049592 Bacteria 1354
203 Ga0501077_0006851 3300049593 Bacteria 7011
204 Ga0501079_0013830 3300049741 Bacteria 6155
205 Ga0501079_0112658 3300049741 Bacteria 2114
206 Ga0501080_0002125 3300049742 Bacteria 17212
207 Ga0501080_0002625 3300049742 Bacteria 15738
208 Ga0501080_0269715 3300049742 Bacteria 1549
209 Ga0501083_0000155 3300049744 Bacteria 45460
210 Ga0501083_0084511 3300049744 Bacteria 2101
211 Ga0501083_0284611 3300049744 Bacteria 1075
212 Ga0501044_0000319 3300049823 Bacteria 60713
213 Ga0501044_0646649 3300049823 Unclassified 947
214 Ga0501044_0792620 3300049823 Bacteria 827
215 Ga0501045_0002637 3300049824 Bacteria 12222
216 Ga0501045_0376067 3300049824 Unclassified 1057
217 nmdc:mga03n38_268085_c1 3300050490 Bacteria 907
218 nmdc:mga03n38_668359_c1 3300050490 Bacteria 596
219 nmdc:mga03n38_881397_c1 3300050490 Unclassified 525
220 nmdc:mga00v17_226271_c1 3300050491 Bacteria 1211
221 nmdc:mga00v17_492254_c1 3300050491 Bacteria 795
222 nmdc:mga00v17_826939_c1 3300050491 Bacteria 589
223 nmdc:mga0yw44_220051_c1 3300050492 Bacteria 1258
224 nmdc:mga0yw44_268673_c1 3300050492 Unclassified 1138
225 nmdc:mga0yw44_320243_c1 3300050492 Bacteria 1041
226 nmdc:mga0yw44_367553_c1 3300050492 Bacteria 970
227 nmdc:mga0yw44_410_c1 3300050492 Bacteria 14991
228 nmdc:mga0yw44_452109_c1 3300050492 Bacteria 870
229 nmdc:mga0yw44_51908_c1 3300050492 Bacteria 2484
230 nmdc:mga06z11_78954_c1 3300050494 Bacteria 1760
231 nmdc:mga04h51_256427_c1 3300050495 Bacteria 702
232 nmdc:mga05p37_133271_c1 3300050507 Bacteria 3048
233 nmdc:mga05p37_32247_c1 3300050507 Bacteria 1840
234 nmdc:mga05p37_336995_c1 3300050507 Bacteria 1780
235 nmdc:mga09592_108806_c1 3300050508 Bacteria 2378
236 nmdc:mga09592_2828_c1 3300050508 Bacteria 14070
237 nmdc:mga09592_5374_c1 3300050508 Bacteria 10414
238 nmdc:mga0qj67_11894_c1 3300050509 Bacteria 6538
239 nmdc:mga0qj67_349800_c1 3300050509 Bacteria 1195
240 nmdc:mga0qj67_49780_c1 3300050509 Bacteria 3312
241 nmdc:mga0qj67_58198_c1 3300050509 Bacteria 3064
242 nmdc:mga06r32_133696_c1 3300050510 Bacteria 2454
243 nmdc:mga06r32_1633162_c1 3300050510 Unclassified 583
244 nmdc:mga06r32_1633171_c1 3300050510 Unclassified 583
245 nmdc:mga06r32_532_c1 3300050510 Bacteria 32919
246 nmdc:mga06r32_53313_c1 3300050510 Bacteria 3875
247 nmdc:mga08y16_96772_c1 3300050511 Bacteria 3074
248 Ga0500635_0032650 3300053080 Bacteria 1693
249 Ga0495619_0562385 3300053085 Bacteria 782
250 Ga0500566_0000183 3300053094 Bacteria 32338
251 Ga0501084_0000314 3300054114 Bacteria 36782
252 Ga0501084_0048775 3300054114 Bacteria 3544
253 Ga0501082_0040934 3300060353 Bacteria 3995
254 Ga0501082_0153435 3300060353 Bacteria 2001
255 Ga0530510_0051516 3300061734 Bacteria 2974
256 Ga0530510_1566418 3300061734 Bacteria 506
257 Ga0466958_0430695
258 Ga0070683_100952051
259 Ga0070683_101983231
260 Ga0070714_100238869
261 Ga0070714_100922417
262 Ga0070678_100334429
263 Ga0070681_10989796
264 Ga0070706_101986336
265 Ga0070695_101861404
266 Ga0070665_101243946
267 Ga0068855_100091235
268 Ga0068855_102275799
269 Ga0068856_101850047
270 Ga0068866_10459279
271 Ga0068861_100697061
272 Ga0068858_100584975
273 Ga0081455_10083767
274 Ga0081455_10268838
275 Ga0075365_10010403
276 Ga0075365_10138402
277 Ga0075365_10159591
278 Ga0075365_10224575
279 Ga0075365_10338729
280 Ga0075368_10216430
281 Ga0075363_100354961
282 Ga0075363_100513612
283 Ga0075364_10060543
284 Ga0075364_10324655
285 Ga0075364_10573262
286 Ga0075362_10578258
287 Ga0075367_10102601
288 Ga0075369_10350981
289 Ga0068871_101480096
290 Ga0075428_100001476
291 Ga0075428_100004330
292 Ga0075428_100811240
293 Ga0075428_101771481
294 Ga0075430_100003006
295 Ga0075430_100046108
296 Ga0075430_100682778
297 Ga0075431_100033644
298 Ga0075431_100279482
299 Ga0075429_100000318
300 Ga0075429_100143959
301 Ga0075429_100764301
302 Ga0111539_10022308
303 Ga0105245_10145420
304 Ga0105245_10388548
305 Ga0105245_11281623
306 Ga0114129_10000100
307 Ga0114129_10101573
308 Ga0114129_10412865
309 Ga0105243_11811068
310 Ga0105243_12790154
311 Ga0105237_11619270
312 Ga0105237_11662887
313 Ga0105238_12176394
314 Ga0105249_11188735
315 Ga0105246_10171032
316 Ga0105246_11748276
317 Ga0157369_10476462
318 Ga0163162_11023991
319 Ga0163162_12128519
320 Ga0157375_10408656
321 Ga0157375_13331471
322 Ga0157380_10305024
323 Ga0213873_10007623
324 Ga0213876_10005862
325 Ga0213876_10015275
326 Ga0213876_10047165
327 Ga0213875_10073953
328 Ga0213875_10672713
329 Ga0207707_10704448
330 Ga0207693_10630426
331 Ga0207694_11316564
332 Ga0207687_10264871
333 Ga0207687_10813498
334 Ga0207664_10229230
335 Ga0207661_11009743
336 Ga0207661_11375811
337 Ga0207667_10089647
338 Ga0207712_12042811
339 Ga0207703_10479333
340 Ga0207702_10948232
341 Ga0207675_100874792
342 Ga0207683_10887257
343 Ga0209813_10232520
344 Ga0207428_10125823
345 Ga0268266_10371704
346 Ga0268266_11723347
347 Ga0268264_10413063
348 Ga0265334_10146289
349 Ga0265338_10211360
350 Ga0265327_10155869
351 Ga0265327_10375260
352 Ga0316575_10080271
353 Ga0316576_10084204
354 Ga0316578_10071525
355 Ga0307405_10100856
356 Ga0307410_10271765
357 Ga0307407_11672485
358 Ga0307409_100147814
359 Ga0307416_101690778
360 Ga0307411_10050769
361 Ga0307411_10928934
362 Ga0307415_100241900
363 Ga0307415_100645033
364 Ga0307415_101920039
365 Ga0307415_102079425
366 Ga0307415_102343642
367 Ga0316585_10308665
368 Ga0373930_0026963
369 Ga0373928_0000339
370 Ga0373929_0009964
371 Ga0373932_0004604
372 Ga0373941_0303548
373 Ga0316574_0064171
374 Ga0316574_0200722
375 Ga0373931_0000005
376 Ga0373931_0014511
377 Ga0316584_0267034
378 Ga0373925_1423170
379 Ga0436364_0232550
380 Ga0436364_0620230
381 Ga0436364_1113919
382 Ga0436364_1534535
383 Ga0400483_239268
384 Ga0436365_0817468
385 Ga0436365_1171488
386 Ga0436365_1465899
387 Ga0436360_1027226
388 Ga0436361_0337452
389 Ga0436363_1010643
390 Ga0451789_0339646
391 Ga0450902_068549
392 Ga0466966_0155708
393 Ga0466961_0597657
394 Ga0466959_1071583
395 Ga0466958_1100728
396 Ga0466967_1582418
397 Ga0495628_0451260
398 Ga0495630_0211047
399 Ga0495642_0330278
400 Ga0495658_0064681
401 Ga0495658_0400100
402 Ga0495658_0497086
403 Ga0495600_0295957
404 Ga0495604_0862423
405 Ga0495680_0277886
406 Ga0496101_1075267
407 Ga0496102_1215781
408 Ga0496105_1411756
409 Ga0496109_0932949
410 Ga0496110_1533936
411 Ga0496111_0584670
412 Ga0496114_0263403
413 Ga0496114_0647162
414 Ga0501031_0007634
415 Ga0501032_0029310
416 Ga0501032_0870121
417 Ga0501033_0000788
418 Ga0501033_0038917
419 Ga0501034_0000312
420 Ga0501034_0003672
421 Ga0501034_0412581
422 Ga0501036_0016168
423 Ga0501036_0189240
424 Ga0501037_0040792
425 Ga0501037_0218408
426 Ga0501039_0005355
427 Ga0501039_0874671
428 Ga0501040_0002098
429 Ga0501042_0029044
430 Ga0501043_1194969
431 Ga0501046_0010229
432 Ga0501047_0108463
433 Ga0501048_0021737
434 Ga0501067_0250405
435 Ga0501068_0003592
436 Ga0501068_0015171
437 Ga0501068_0919651
438 Ga0501069_0001671
439 Ga0501070_0022964
440 Ga0501070_0172066
441 Ga0501070_0181794
442 Ga0501071_0002740
443 Ga0501071_0015380
444 Ga0501071_0159295
445 Ga0501071_0352790
446 Ga0501072_0001981
447 Ga0501072_0004882
448 Ga0501072_0022053
449 Ga0501072_0085816
450 Ga0501072_0975047
451 Ga0501073_0000331
452 Ga0501073_0001388
453 Ga0501073_0213908
454 Ga0501074_0000214
455 Ga0501074_0810751
456 Ga0501075_0002837
457 Ga0501076_0001050
458 Ga0501076_0284744
459 Ga0501077_0006851
460 Ga0501079_0013830
461 Ga0501079_0112658
462 Ga0501080_0002125
463 Ga0501080_0002625
464 Ga0501080_0269715
465 Ga0501083_0000155
466 Ga0501083_0084511
467 Ga0501083_0284611
468 Ga0501044_0000319
469 Ga0501044_0646649
470 Ga0501044_0792620
471 Ga0501045_0002637
472 Ga0501045_0376067
473 nmdc:mga03n38_268085_c1
474 nmdc:mga03n38_668359_c1
475 nmdc:mga03n38_881397_c1
476 nmdc:mga00v17_226271_c1
477 nmdc:mga00v17_492254_c1
478 nmdc:mga00v17_826939_c1
479 nmdc:mga0yw44_220051_c1
480 nmdc:mga0yw44_268673_c1
481 nmdc:mga0yw44_320243_c1
482 nmdc:mga0yw44_367553_c1
483 nmdc:mga0yw44_410_c1
484 nmdc:mga0yw44_452109_c1
485 nmdc:mga0yw44_51908_c1
486 nmdc:mga06z11_78954_c1
487 nmdc:mga04h51_256427_c1
488 nmdc:mga05p37_133271_c1
489 nmdc:mga05p37_32247_c1
490 nmdc:mga05p37_336995_c1
491 nmdc:mga09592_108806_c1
492 nmdc:mga09592_2828_c1
493 nmdc:mga09592_5374_c1
494 nmdc:mga0qj67_11894_c1
495 nmdc:mga0qj67_349800_c1
496 nmdc:mga0qj67_49780_c1
497 nmdc:mga0qj67_58198_c1
498 nmdc:mga06r32_133696_c1
499 nmdc:mga06r32_1633162_c1
500 nmdc:mga06r32_1633171_c1
501 nmdc:mga06r32_532_c1
502 nmdc:mga06r32_53313_c1
503 nmdc:mga08y16_96772_c1
504 Ga0500635_0032650
505 Ga0495619_0562385
506 Ga0500566_0000183
507 Ga0501084_0000314
508 Ga0501084_0048775
509 Ga0501082_0040934
510 Ga0501082_0153435
511 Ga0530510_0051516
512 Ga0530510_1566418

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rkh-assembly1.cif.gz_A-2 crystal structure of a putative apha-like transcription factor (zp_00208345.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution 0.9018 2 59
4ohf-assembly1.cif.gz_A crystal structure of cytosolic nucleotidase ii (lpg0095) in complex with gmp from legionella pneumophila, northeast structural genomics consortium target lgr1 0.9006 2 59
5j10-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.8949 2 59
8szz-assembly1.cif.gz_y cryoem structure of computationally designed nanocage o32-zl4 0.8895 2 59
6v92-assembly1.cif.gz_O rsc-ncp 0.8875 13 58
ID Description Score Start End Superfamily
af_C7G036_1295_1678_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9178 2 61 3.40.50.300
af_Q5TKI6_211_365_1.20.1250.10 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;; 0.9142 1 61 1.20.1250.10
af_K7MP21_179_338_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9135 3 61 2.130.10.10
4ohfA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9006 2 59 1.20.58.1160
4ohfD03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8824 2 59 1.20.58.1160
ID Description Score Start End GO Terms
AF-A0A382BDJ8-F1-model_v4 Uncharacterized protein 1.006 1 59
AF-A0A7K2CST1-F1-model_v4 Uncharacterized protein 1.005 5 59
AF-A0A356WGB5-F1-model_v4 Uncharacterized protein 1.004 2 61
AF-A0A0R2R6C9-F1-model_v4 Uncharacterized protein 0.9997 2 59
AF-A1WSY3-F1-model_v4 Mobilisation protein 0.9918 2 59

Map