F366712

General Info

Members Datasets Scaffolds Average Seq Length
256 127 512 169

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0155028|Ga0466972_0155028_332_910
Length 192
Sequence MTHTVEEHPSRNDGFLGKTTGGPLMAEAKTQDAIALLKEDHRTVAKLFKEFEEAKGEGRKEKLAQRICLELTIHTKLEEEIFYPACEGKIEEDLLKEAFVEHDSAKLLMAEIEAGNGQSDEFFDAKVQVLSEQIEHHVEEEEKELFPQVRKAELDLKVLGEQLAERKKELMKEYKASGVPEPELQTMDEVSI

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 1.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.34
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0155028 3300044658 Bacteria 1076
2 JGI24740J21852_10062468 3300001979 Bacteria 1022
3 JGI24737J22298_10022832 3300001990 Bacteria 1987
4 JGI24735J21928_10063193 3300002067 Bacteria 1063
5 JGI24735J21928_10114655 3300002067 Bacteria 775
6 rootH2_10071403 3300003320 Bacteria 1085
7 rootL2_10328240 3300003322 Bacteria 1288
8 Ga0055536_1017453 3300003781 Bacteria 2349
9 Ga0058863_11315494 3300004799 Unclassified 736
10 Ga0070658_10053931 3300005327 Bacteria 3264
11 Ga0070658_10123565 3300005327 Bacteria 2152
12 Ga0070658_10133568 3300005327 Bacteria 2069
13 Ga0070658_10156854 3300005327 Bacteria 1908
14 Ga0070658_10647664 3300005327 Bacteria 917
15 Ga0070683_100028957 3300005329 Bacteria 5009
16 Ga0070666_10314005 3300005335 Bacteria 1117
17 Ga0070680_100139718 3300005336 Bacteria 2031
18 Ga0070682_100159497 3300005337 Bacteria 1556
19 Ga0070660_100246364 3300005339 Bacteria 1456
20 Ga0070661_100599344 3300005344 Bacteria 890
21 Ga0070692_10000390 3300005345 Bacteria 13062
22 Ga0070671_101701464 3300005355 Bacteria 560
23 Ga0070659_100003770 3300005366 Bacteria 10815
24 Ga0070714_100048367 3300005435 Bacteria 3617
25 Ga0070714_100143610 3300005435 Unclassified 2145
26 Ga0070714_100300169 3300005435 Bacteria 1497
27 Ga0070714_100417485 3300005435 Bacteria 1271
28 Ga0070714_101228706 3300005435 Bacteria 731
29 Ga0070713_100018074 3300005436 Bacteria 5354
30 Ga0070694_100046329 3300005444 Bacteria 2918
31 Ga0070663_100138667 3300005455 Bacteria 1854
32 Ga0070662_100039727 3300005457 Bacteria 3347
33 Ga0070662_100335116 3300005457 Bacteria 1236
34 Ga0070679_100293992 3300005530 Bacteria 1575
35 Ga0070684_100012821 3300005535 Bacteria 6732
36 Ga0068853_100172311 3300005539 Bacteria 1959
37 Ga0068853_100282456 3300005539 Bacteria 1530
38 Ga0070672_100118475 3300005543 Bacteria 2165
39 Ga0070693_100748623 3300005547 Bacteria 720
40 Ga0070665_100188429 3300005548 Bacteria 2064
41 Ga0068855_100035980 3300005563 Bacteria 5895
42 Ga0068855_100062530 3300005563 Bacteria 4346
43 Ga0068857_100012685 3300005577 Bacteria 7344
44 Ga0068857_100061768 3300005577 Bacteria 3329
45 Ga0068857_100140709 3300005577 Bacteria 2181
46 Ga0068854_100221689 3300005578 Bacteria 1496
47 Ga0068856_100024493 3300005614 Bacteria 5877
48 Ga0068852_100245462 3300005616 Bacteria 1713
49 Ga0068851_10164953 3300005834 Bacteria 1219
50 Ga0068851_10198789 3300005834 Bacteria 1118
51 Ga0068858_100239601 3300005842 Bacteria 1721
52 Ga0068858_100314542 3300005842 Bacteria 1496
53 Ga0068860_100377275 3300005843 Bacteria 1399
54 Ga0068862_100579744 3300005844 Bacteria 1074
55 Ga0070717_10009496 3300006028 Bacteria 7314
56 Ga0070716_100015876 3300006173 Bacteria 3880
57 Ga0097621_100068056 3300006237 Bacteria 2936
58 Ga0068871_100342171 3300006358 Bacteria 1321
59 Ga0105240_11364992 3300009093 Bacteria 746
60 Ga0105241_10286204 3300009174 Bacteria 1409
61 Ga0105248_10011320 3300009177 Bacteria 9833
62 Ga0105248_10487674 3300009177 Bacteria 1389
63 Ga0105237_10258245 3300009545 Bacteria 1745
64 Ga0105238_10792672 3300009551 Bacteria 963
65 Ga0105249_10300248 3300009553 Bacteria 1610
66 Ga0105239_10039204 3300010375 Bacteria 5190
67 Ga0105239_10355427 3300010375 Bacteria 1654
68 Ga0157373_10215968 3300013100 Bacteria 1352
69 Ga0157373_10267971 3300013100 Bacteria 1209
70 Ga0157371_10188027 3300013102 Bacteria 1478
71 Ga0157371_10351966 3300013102 Bacteria 1072
72 Ga0157370_10343241 3300013104 Bacteria 1376
73 Ga0157369_10027713 3300013105 Bacteria 6277
74 Ga0157374_10005509 3300013296 Bacteria 10636
75 Ga0157374_10271339 3300013296 Bacteria 1673
76 Ga0163162_10063504 3300013306 Bacteria 3736
77 Ga0163162_10179218 3300013306 Bacteria 2245
78 Ga0157372_10973153 3300013307 Bacteria 983
79 Ga0157379_10293855 3300014968 Bacteria 1480
80 Ga0163161_10927590 3300017792 Bacteria 739
81 Ga0206356_10885578 3300020070 Bacteria 731
82 Ga0154015_1002086 3300020610 Bacteria 680
83 Ga0224712_10172884 3300022467 Bacteria 970
84 Ga0207656_10024072 3300025321 Bacteria 2458
85 Ga0207656_10103376 3300025321 Bacteria 1308
86 Ga0207647_10001423 3300025904 Bacteria 18343
87 Ga0207647_10216157 3300025904 Bacteria 1106
88 Ga0207705_10159348 3300025909 Bacteria 1695
89 Ga0207705_10420533 3300025909 Bacteria 1035
90 Ga0207705_10779744 3300025909 Bacteria 742
91 Ga0207671_10706419 3300025914 Bacteria 802
92 Ga0207657_10008076 3300025919 Bacteria 10731
93 Ga0207657_10131243 3300025919 Bacteria 2053
94 Ga0207649_10193424 3300025920 Bacteria 1432
95 Ga0207700_10035636 3300025928 Bacteria 3586
96 Ga0207700_10987867 3300025928 Bacteria 753
97 Ga0207664_10130028 3300025929 Bacteria 2119
98 Ga0207664_10371387 3300025929 Bacteria 1269
99 Ga0207644_11202366 3300025931 Bacteria 637
100 Ga0207690_10007888 3300025932 Bacteria 6325
101 Ga0207690_10570818 3300025932 Bacteria 921
102 Ga0207706_10027495 3300025933 Bacteria 5086
103 Ga0207706_10185124 3300025933 Bacteria 1829
104 Ga0207686_10262405 3300025934 Bacteria 1267
105 Ga0207709_10619822 3300025935 Bacteria 858
106 Ga0207665_10048193 3300025939 Bacteria 2859
107 Ga0207691_10039918 3300025940 Bacteria 4341
108 Ga0207711_10014686 3300025941 Bacteria 6508
109 Ga0207711_10036119 3300025941 Bacteria 4192
110 Ga0207661_10010193 3300025944 Bacteria 6757
111 Ga0207667_10004508 3300025949 Bacteria 17062
112 Ga0207667_10029704 3300025949 Bacteria 5922
113 Ga0207712_10001181 3300025961 Bacteria 18076
114 Ga0207640_10165890 3300025981 Bacteria 1640
115 Ga0207658_10211263 3300025986 Bacteria 1626
116 Ga0207703_10627079 3300026035 Bacteria 1018
117 Ga0207703_10778874 3300026035 Bacteria 912
118 Ga0207639_10084311 3300026041 Bacteria 2524
119 Ga0207639_11180765 3300026041 Bacteria 718
120 Ga0207678_10068838 3300026067 Bacteria 3036
121 Ga0207702_10029637 3300026078 Bacteria 4555
122 Ga0207674_10016662 3300026116 Bacteria 8032
123 Ga0207674_10115906 3300026116 Bacteria 2651
124 Ga0207698_10045863 3300026142 Bacteria 3296
125 Ga0207698_10093650 3300026142 Bacteria 2467
126 Ga0207698_10525654 3300026142 Bacteria 1155
127 Ga0268265_10305841 3300028380 Bacteria 1433
128 Ga0268264_10014735 3300028381 Bacteria 6424
129 Ga0307408_100070526 3300031548 Bacteria 2580
130 Ga0307408_100776147 3300031548 Bacteria 868
131 Ga0307405_10169058 3300031731 Bacteria 1558
132 Ga0307405_10631270 3300031731 Bacteria 878
133 Ga0307413_10014591 3300031824 Bacteria 3996
134 Ga0307410_10030364 3300031852 Bacteria 3453
135 Ga0307410_10421026 3300031852 Bacteria 1083
136 Ga0307406_10031720 3300031901 Bacteria 3219
137 Ga0307407_10042601 3300031903 Bacteria 2546
138 Ga0307412_10455044 3300031911 Bacteria 1055
139 Ga0307412_10766304 3300031911 Bacteria 834
140 Ga0307409_100095240 3300031995 Bacteria 2452
141 Ga0307409_100255386 3300031995 Bacteria 1605
142 Ga0307409_100304165 3300031995 Bacteria 1485
143 Ga0307409_100828046 3300031995 Bacteria 935
144 Ga0307416_100179731 3300032002 Bacteria 1981
145 Ga0307416_100281575 3300032002 Bacteria 1640
146 Ga0307416_101425377 3300032002 Bacteria 798
147 Ga0307416_103145490 3300032002 Bacteria 552
148 Ga0307414_10165786 3300032004 Bacteria 1760
149 Ga0307414_10411381 3300032004 Bacteria 1177
150 Ga0307411_10374265 3300032005 Bacteria 1169
151 Ga0307415_100036809 3300032126 Bacteria 3210
152 Ga0307415_100103450 3300032126 Bacteria 2095
153 Ga0307415_100625410 3300032126 Bacteria 962
154 Ga0307415_101443242 3300032126 Bacteria 656
155 Ga0395899_0000103 3300037312 Bacteria 147274
156 Ga0395899_0004311 3300037312 Bacteria 11107
157 Ga0395899_0021015 3300037312 Bacteria 4949
158 Ga0395899_0025761 3300037312 Bacteria 4439
159 Ga0395899_0114988 3300037312 Bacteria 1932
160 Ga0395900_0000093 3300037418 Bacteria 166505
161 Ga0395900_0002862 3300037418 Bacteria 18816
162 Ga0395900_0003176 3300037418 Bacteria 17816
163 Ga0395900_0005309 3300037418 Bacteria 13501
164 Ga0395900_0040449 3300037418 Bacteria 4804
165 Ga0395900_0173694 3300037418 Bacteria 2192
166 Ga0395900_0207980 3300037418 Bacteria 1977
167 Ga0395900_0225295 3300037418 Unclassified 1888
168 Ga0395900_0341213 3300037418 Bacteria 1473
169 Ga0395900_0518962 3300037418 Bacteria 1140
170 Ga0395900_1342122 3300037418 Bacteria 629
171 Ga0395898_0000053 3300037466 Bacteria 279600
172 Ga0395898_0005334 3300037466 Bacteria 13898
173 Ga0395898_0083317 3300037466 Bacteria 3082
174 Ga0395898_1371958 3300037466 Bacteria 635
175 Ga0395905_0000031 3300037471 Bacteria 286757
176 Ga0395905_0002517 3300037471 Bacteria 20238
177 Ga0395905_0002942 3300037471 Bacteria 18509
178 Ga0395905_0011303 3300037471 Bacteria 8632
179 Ga0395905_0016570 3300037471 Bacteria 7005
180 Ga0395905_0053214 3300037471 Bacteria 3789
181 Ga0395905_0065793 3300037471 Bacteria 3394
182 Ga0395905_0100207 3300037471 Bacteria 2720
183 Ga0395905_0120271 3300037471 Bacteria 2469
184 Ga0395905_0217009 3300037471 Bacteria 1791
185 Ga0395905_0491830 3300037471 Bacteria 1126
186 Ga0395905_0619106 3300037471 Bacteria 984
187 Ga0395905_0637864 3300037471 Unclassified 967
188 Ga0395905_0931785 3300037471 Bacteria 771
189 Ga0395901_0001246 3300038443 Bacteria 27128
190 Ga0395901_0011922 3300038443 Bacteria 8815
191 Ga0395901_0014555 3300038443 Bacteria 7998
192 Ga0395901_0024024 3300038443 Bacteria 6252
193 Ga0395901_0034237 3300038443 Bacteria 5245
194 Ga0395901_0046424 3300038443 Bacteria 4512
195 Ga0395901_0052419 3300038443 Bacteria 4240
196 Ga0395901_0195380 3300038443 Bacteria 2121
197 Ga0395901_0239909 3300038443 Bacteria 1891
198 Ga0395901_0459215 3300038443 Bacteria 1302
199 Ga0395901_0638400 3300038443 Bacteria 1069
200 Ga0395901_0840748 3300038443 Bacteria 904
201 Ga0395901_0928242 3300038443 Bacteria 850
202 Ga0395901_1376379 3300038443 Bacteria 665
203 Ga0395901_1572891 3300038443 Bacteria 611
204 Ga0439434_0182274 3300042435 Bacteria 704
205 Ga0466972_0057675 3300044658 Bacteria 1865
206 Ga0466972_0317004 3300044658 Bacteria 728
207 Ga0466965_0172838 3300044683 Bacteria 1137
208 Ga0466965_0310895 3300044683 Bacteria 857
209 Ga0466965_0343855 3300044683 Bacteria 816
210 Ga0466966_0139574 3300044684 Bacteria 1481
211 Ga0466966_0365250 3300044684 Bacteria 867
212 Ga0466961_0079108 3300044693 Bacteria 2082
213 Ga0466961_0091986 3300044693 Bacteria 1915
214 Ga0466961_0206989 3300044693 Bacteria 1212
215 Ga0466963_0246865 3300044694 Bacteria 1252
216 Ga0466963_0400101 3300044694 Bacteria 968
217 Ga0466963_0576364 3300044694 Bacteria 795
218 Ga0466963_0865300 3300044694 Bacteria 637
219 Ga0466964_0155864 3300044706 Bacteria 1063
220 Ga0466971_0005583 3300044719 Bacteria 5467
221 Ga0466971_0092424 3300044719 Bacteria 1386
222 Ga0466971_0118895 3300044719 Bacteria 1222
223 Ga0466970_0063871 3300044765 Bacteria 1974
224 Ga0466970_0072774 3300044765 Bacteria 1849
225 Ga0466970_0129578 3300044765 Bacteria 1385
226 Ga0466970_0353385 3300044765 Bacteria 834
227 Ga0466957_0017134 3300044842 Bacteria 4240
228 Ga0466957_0018323 3300044842 Bacteria 4111
229 Ga0466957_0120284 3300044842 Bacteria 1673
230 Ga0466957_0503634 3300044842 Bacteria 840
231 Ga0466957_0606117 3300044842 Bacteria 767
232 Ga0466957_0625081 3300044842 Bacteria 755
233 Ga0466960_0128600 3300044901 Bacteria 1334
234 Ga0466960_0203076 3300044901 Bacteria 1084
235 Ga0466959_0074178 3300045049 Bacteria 2460
236 Ga0466959_0082963 3300045049 Bacteria 2309
237 Ga0466959_0262464 3300045049 Bacteria 1189
238 Ga0466958_0174949 3300045836 Bacteria 1360
239 Ga0466958_0242517 3300045836 Bacteria 1152
240 Ga0466958_0587285 3300045836 Bacteria 724
241 Ga0466958_0833379 3300045836 Bacteria 601
242 Ga0466967_0080254 3300045976 Bacteria 2943
243 Ga0466967_0112724 3300045976 Bacteria 2500
244 Ga0466967_0323860 3300045976 Bacteria 1487
245 Ga0466967_0379467 3300045976 Bacteria 1372
246 Ga0466967_0484366 3300045976 Bacteria 1212
247 Ga0466967_0643450 3300045976 Bacteria 1048
248 Ga0466967_1910842 3300045976 Bacteria 590
249 Ga0495669_0026909 3300046684 Bacteria 2514
250 Ga0496108_0827418 3300048911 Bacteria 798
251 Ga0496110_0270643 3300048913 Bacteria 1547
252 Ga0496112_0003026 3300048915 Bacteria 13744
253 Ga0496112_0206099 3300048915 Bacteria 1924
254 Ga0496113_0011123 3300048916 Bacteria 5987
255 Ga0496114_0000092 3300048917 Bacteria 64974
256 Ga0466962_0091096 3300061719 Bacteria 1461
257 Ga0466972_0155028
258 JGI24740J21852_10062468
259 JGI24737J22298_10022832
260 JGI24735J21928_10063193
261 JGI24735J21928_10114655
262 rootH2_10071403
263 rootL2_10328240
264 Ga0055536_1017453
265 Ga0058863_11315494
266 Ga0070658_10053931
267 Ga0070658_10123565
268 Ga0070658_10133568
269 Ga0070658_10156854
270 Ga0070658_10647664
271 Ga0070683_100028957
272 Ga0070666_10314005
273 Ga0070680_100139718
274 Ga0070682_100159497
275 Ga0070660_100246364
276 Ga0070661_100599344
277 Ga0070692_10000390
278 Ga0070671_101701464
279 Ga0070659_100003770
280 Ga0070714_100048367
281 Ga0070714_100143610
282 Ga0070714_100300169
283 Ga0070714_100417485
284 Ga0070714_101228706
285 Ga0070713_100018074
286 Ga0070694_100046329
287 Ga0070663_100138667
288 Ga0070662_100039727
289 Ga0070662_100335116
290 Ga0070679_100293992
291 Ga0070684_100012821
292 Ga0068853_100172311
293 Ga0068853_100282456
294 Ga0070672_100118475
295 Ga0070693_100748623
296 Ga0070665_100188429
297 Ga0068855_100035980
298 Ga0068855_100062530
299 Ga0068857_100012685
300 Ga0068857_100061768
301 Ga0068857_100140709
302 Ga0068854_100221689
303 Ga0068856_100024493
304 Ga0068852_100245462
305 Ga0068851_10164953
306 Ga0068851_10198789
307 Ga0068858_100239601
308 Ga0068858_100314542
309 Ga0068860_100377275
310 Ga0068862_100579744
311 Ga0070717_10009496
312 Ga0070716_100015876
313 Ga0097621_100068056
314 Ga0068871_100342171
315 Ga0105240_11364992
316 Ga0105241_10286204
317 Ga0105248_10011320
318 Ga0105248_10487674
319 Ga0105237_10258245
320 Ga0105238_10792672
321 Ga0105249_10300248
322 Ga0105239_10039204
323 Ga0105239_10355427
324 Ga0157373_10215968
325 Ga0157373_10267971
326 Ga0157371_10188027
327 Ga0157371_10351966
328 Ga0157370_10343241
329 Ga0157369_10027713
330 Ga0157374_10005509
331 Ga0157374_10271339
332 Ga0163162_10063504
333 Ga0163162_10179218
334 Ga0157372_10973153
335 Ga0157379_10293855
336 Ga0163161_10927590
337 Ga0206356_10885578
338 Ga0154015_1002086
339 Ga0224712_10172884
340 Ga0207656_10024072
341 Ga0207656_10103376
342 Ga0207647_10001423
343 Ga0207647_10216157
344 Ga0207705_10159348
345 Ga0207705_10420533
346 Ga0207705_10779744
347 Ga0207671_10706419
348 Ga0207657_10008076
349 Ga0207657_10131243
350 Ga0207649_10193424
351 Ga0207700_10035636
352 Ga0207700_10987867
353 Ga0207664_10130028
354 Ga0207664_10371387
355 Ga0207644_11202366
356 Ga0207690_10007888
357 Ga0207690_10570818
358 Ga0207706_10027495
359 Ga0207706_10185124
360 Ga0207686_10262405
361 Ga0207709_10619822
362 Ga0207665_10048193
363 Ga0207691_10039918
364 Ga0207711_10014686
365 Ga0207711_10036119
366 Ga0207661_10010193
367 Ga0207667_10004508
368 Ga0207667_10029704
369 Ga0207712_10001181
370 Ga0207640_10165890
371 Ga0207658_10211263
372 Ga0207703_10627079
373 Ga0207703_10778874
374 Ga0207639_10084311
375 Ga0207639_11180765
376 Ga0207678_10068838
377 Ga0207702_10029637
378 Ga0207674_10016662
379 Ga0207674_10115906
380 Ga0207698_10045863
381 Ga0207698_10093650
382 Ga0207698_10525654
383 Ga0268265_10305841
384 Ga0268264_10014735
385 Ga0307408_100070526
386 Ga0307408_100776147
387 Ga0307405_10169058
388 Ga0307405_10631270
389 Ga0307413_10014591
390 Ga0307410_10030364
391 Ga0307410_10421026
392 Ga0307406_10031720
393 Ga0307407_10042601
394 Ga0307412_10455044
395 Ga0307412_10766304
396 Ga0307409_100095240
397 Ga0307409_100255386
398 Ga0307409_100304165
399 Ga0307409_100828046
400 Ga0307416_100179731
401 Ga0307416_100281575
402 Ga0307416_101425377
403 Ga0307416_103145490
404 Ga0307414_10165786
405 Ga0307414_10411381
406 Ga0307411_10374265
407 Ga0307415_100036809
408 Ga0307415_100103450
409 Ga0307415_100625410
410 Ga0307415_101443242
411 Ga0395899_0000103
412 Ga0395899_0004311
413 Ga0395899_0021015
414 Ga0395899_0025761
415 Ga0395899_0114988
416 Ga0395900_0000093
417 Ga0395900_0002862
418 Ga0395900_0003176
419 Ga0395900_0005309
420 Ga0395900_0040449
421 Ga0395900_0173694
422 Ga0395900_0207980
423 Ga0395900_0225295
424 Ga0395900_0341213
425 Ga0395900_0518962
426 Ga0395900_1342122
427 Ga0395898_0000053
428 Ga0395898_0005334
429 Ga0395898_0083317
430 Ga0395898_1371958
431 Ga0395905_0000031
432 Ga0395905_0002517
433 Ga0395905_0002942
434 Ga0395905_0011303
435 Ga0395905_0016570
436 Ga0395905_0053214
437 Ga0395905_0065793
438 Ga0395905_0100207
439 Ga0395905_0120271
440 Ga0395905_0217009
441 Ga0395905_0491830
442 Ga0395905_0619106
443 Ga0395905_0637864
444 Ga0395905_0931785
445 Ga0395901_0001246
446 Ga0395901_0011922
447 Ga0395901_0014555
448 Ga0395901_0024024
449 Ga0395901_0034237
450 Ga0395901_0046424
451 Ga0395901_0052419
452 Ga0395901_0195380
453 Ga0395901_0239909
454 Ga0395901_0459215
455 Ga0395901_0638400
456 Ga0395901_0840748
457 Ga0395901_0928242
458 Ga0395901_1376379
459 Ga0395901_1572891
460 Ga0439434_0182274
461 Ga0466972_0057675
462 Ga0466972_0317004
463 Ga0466965_0172838
464 Ga0466965_0310895
465 Ga0466965_0343855
466 Ga0466966_0139574
467 Ga0466966_0365250
468 Ga0466961_0079108
469 Ga0466961_0091986
470 Ga0466961_0206989
471 Ga0466963_0246865
472 Ga0466963_0400101
473 Ga0466963_0576364
474 Ga0466963_0865300
475 Ga0466964_0155864
476 Ga0466971_0005583
477 Ga0466971_0092424
478 Ga0466971_0118895
479 Ga0466970_0063871
480 Ga0466970_0072774
481 Ga0466970_0129578
482 Ga0466970_0353385
483 Ga0466957_0017134
484 Ga0466957_0018323
485 Ga0466957_0120284
486 Ga0466957_0503634
487 Ga0466957_0606117
488 Ga0466957_0625081
489 Ga0466960_0128600
490 Ga0466960_0203076
491 Ga0466959_0074178
492 Ga0466959_0082963
493 Ga0466959_0262464
494 Ga0466958_0174949
495 Ga0466958_0242517
496 Ga0466958_0587285
497 Ga0466958_0833379
498 Ga0466967_0080254
499 Ga0466967_0112724
500 Ga0466967_0323860
501 Ga0466967_0379467
502 Ga0466967_0484366
503 Ga0466967_0643450
504 Ga0466967_1910842
505 Ga0495669_0026909
506 Ga0496108_0827418
507 Ga0496110_0270643
508 Ga0496112_0003026
509 Ga0496112_0206099
510 Ga0496113_0011123
511 Ga0496114_0000092
512 Ga0466962_0091096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01814

Hemerythrin

Hemerythrin HHE cation binding domain

32

149

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jbi-assembly1.cif.gz_V mdff model of the vinculin tail domain bound to f-actin 0.7739 13 122
6u3l-assembly1.cif.gz_A crystal structure of hemerythrin hhe cation binding domain-containing protein: rv2633c homolog from mycobacterium kansasii 0.7731 13 151
5a7d-assembly4.cif.gz_N tetrameric assembly of lgn with inscuteable 0.7577 1 109
8den-assembly2.cif.gz_D-2 heme-free cytochrome variant apocyt 0.7385 13 116
5tud-assembly2.cif.gz_D structural insights into the extracellular recognition of the human serotonin 2b receptor by an antibody 0.717 6 142
ID Description Score Start End Superfamily
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.8552 5 145 1.20.120.520
af_Q9URY9_21_165_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.828 5 145 1.20.120.520
af_P9WL59_1_138_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7212 8 144 1.20.120.520
3pf0A00 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;M75 peptidase, HXXE motif 0.7204 34 126 1.20.1420.20
af_A0A1D6N6L5_139_312_1.20.120.520 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);nmb1532 protein domain like 0.7185 5 139 1.20.120.520
ID Description Score Start End GO Terms
AF-A0A317J8P2-F1-model_v4 Hemerythrin HHE cation-binding protein 0.9465 10 124
AF-A0A6G7ZDW5-F1-model_v4 Hemerythrin domain-containing protein 0.9216 8 154
AF-A0A0G3BXQ3-F1-model_v4 Regulator of cell morphogenesis and NO signaling 0.9188 8 144
AF-A0A4Y9T445-F1-model_v4 Hemerythrin domain-containing protein 0.9118 6 154
AF-A0A2N5JV28-F1-model_v4 deleted 0.9091 8 151

Map