F366576

General Info

Members Datasets Scaffolds Average Seq Length
256 172 512 128

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10464994|Ga0207678_104649942
Length 139
Sequence MARLSWPPMRLVIVRHAEAAEGTPDELRRLTSRGREQARALGRRLREEGLEPDAVVSSPLLRARETADAIARELGVPAEPVDLLAPGASDTDLLAAVDGRGATVVTVGHQPDCGQIVAALAGGPEPSFPPGGVVRLELG

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
47 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
96 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
97 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
98 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.91
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 3.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10464994 3300026067 Bacteria 1100
2 Ga0070658_10127970 3300005327 Bacteria 2115
3 Ga0070658_10156933 3300005327 Bacteria 1908
4 Ga0070658_10336325 3300005327 Bacteria 1291
5 Ga0070658_10554580 3300005327 Bacteria 995
6 Ga0070683_100417948 3300005329 Unclassified 1279
7 Ga0068869_100998494 3300005334 Bacteria 728
8 Ga0070680_100098235 3300005336 Bacteria 2428
9 Ga0070680_100993068 3300005336 Bacteria 725
10 Ga0070680_101041155 3300005336 Unclassified 707
11 Ga0070660_100024163 3300005339 Bacteria 4507
12 Ga0070660_100385043 3300005339 Bacteria 1158
13 Ga0070660_101874772 3300005339 Bacteria 511
14 Ga0070674_100168736 3300005356 Bacteria 1667
15 Ga0070659_101445457 3300005366 Bacteria 612
16 Ga0070714_101265920 3300005435 Bacteria 720
17 Ga0070714_102187541 3300005435 Archaea 539
18 Ga0070713_100430729 3300005436 Bacteria 1236
19 Ga0070713_101509817 3300005436 Bacteria 652
20 Ga0070710_10676438 3300005437 Bacteria 726
21 Ga0070711_100194450 3300005439 Bacteria 1561
22 Ga0070711_100381730 3300005439 Bacteria 1139
23 Ga0070705_101179619 3300005440 Bacteria 630
24 Ga0070708_100105543 3300005445 Bacteria 2585
25 Ga0070678_100406993 3300005456 Bacteria 1183
26 Ga0070678_100823590 3300005456 Bacteria 844
27 Ga0070681_10021526 3300005458 Bacteria 6462
28 Ga0070706_101450108 3300005467 Bacteria 628
29 Ga0070707_100669139 3300005468 Bacteria 1001
30 Ga0070707_101041634 3300005468 Bacteria 784
31 Ga0070698_101256689 3300005471 Bacteria 690
32 Ga0070699_100928611 3300005518 Bacteria 797
33 Ga0070679_100023050 3300005530 Bacteria 6089
34 Ga0070684_100765103 3300005535 Bacteria 902
35 Ga0070672_100216313 3300005543 Bacteria 1606
36 Ga0070693_100022592 3300005547 Bacteria 3347
37 Ga0070704_101265461 3300005549 Bacteria 674
38 Ga0068855_100159356 3300005563 Bacteria 2562
39 Ga0068855_101296791 3300005563 Bacteria 754
40 Ga0070664_101268474 3300005564 Bacteria 696
41 Ga0068857_100165589 3300005577 Bacteria 2007
42 Ga0081455_10240465 3300005937 Bacteria 1331
43 Ga0070717_11110734 3300006028 Bacteria 720
44 Ga0070712_100231474 3300006175 Bacteria 1468
45 Ga0070712_100586989 3300006175 Bacteria 942
46 Ga0070712_101654978 3300006175 Bacteria 560
47 Ga0075431_100702379 3300006847 Bacteria 989
48 Ga0068865_100449784 3300006881 Bacteria 1065
49 Ga0075435_100059841 3300007076 Bacteria 3088
50 Ga0105240_10748317 3300009093 Bacteria 1063
51 Ga0114129_11761233 3300009147 Unclassified 754
52 Ga0105243_10947668 3300009148 Bacteria 860
53 Ga0105241_10662809 3300009174 Bacteria 949
54 Ga0105249_10920790 3300009553 Bacteria 941
55 Ga0157327_1022197 3300012512 Bacteria 726
56 Ga0157369_11453887 3300013105 Bacteria 697
57 Ga0157372_10125531 3300013307 Bacteria 2950
58 Ga0163163_11655429 3300014325 Bacteria 701
59 Ga0163163_11721541 3300014325 Bacteria 687
60 Ga0157377_10091679 3300014745 Bacteria 1795
61 Ga0206354_10374278 3300020081 Bacteria 738
62 Ga0213871_10091882 3300021441 Bacteria 880
63 Ga0207688_10483743 3300025901 Bacteria 774
64 Ga0207705_10138980 3300025909 Bacteria 1813
65 Ga0207705_10234385 3300025909 Bacteria 1397
66 Ga0207707_10282948 3300025912 Bacteria 1436
67 Ga0207693_10461813 3300025915 Bacteria 992
68 Ga0207693_10935120 3300025915 Bacteria 664
69 Ga0207663_10122426 3300025916 Bacteria 1783
70 Ga0207663_10425657 3300025916 Bacteria 1020
71 Ga0207660_10107875 3300025917 Bacteria 2090
72 Ga0207657_10044083 3300025919 Bacteria 3924
73 Ga0207657_10291116 3300025919 Bacteria 1295
74 Ga0207657_10504915 3300025919 Bacteria 947
75 Ga0207652_10319296 3300025921 Bacteria 1402
76 Ga0207652_10321054 3300025921 Bacteria 1398
77 Ga0207646_10541188 3300025922 Bacteria 1048
78 Ga0207700_10867612 3300025928 Bacteria 808
79 Ga0207664_10199868 3300025929 Bacteria 1725
80 Ga0207690_10846533 3300025932 Bacteria 757
81 Ga0207669_10066313 3300025937 Bacteria 2244
82 Ga0207665_11233454 3300025939 Bacteria 597
83 Ga0207665_11385274 3300025939 Unclassified 560
84 Ga0207691_10219907 3300025940 Bacteria 1647
85 Ga0207661_10520699 3300025944 Bacteria 1088
86 Ga0207661_10966309 3300025944 Bacteria 785
87 Ga0207679_10763921 3300025945 Unclassified 880
88 Ga0207679_11295564 3300025945 Bacteria 669
89 Ga0207667_10700709 3300025949 Bacteria 1015
90 Ga0207667_12015015 3300025949 Bacteria 537
91 Ga0207677_10678778 3300026023 Bacteria 912
92 Ga0207677_11407504 3300026023 Bacteria 642
93 Ga0207641_11654300 3300026088 Bacteria 642
94 Ga0207674_10292367 3300026116 Bacteria 1578
95 Ga0207675_100526655 3300026118 Bacteria 1179
96 Ga0265319_1005405 3300028563 Bacteria 6112
97 Ga0265334_10050225 3300028573 Bacteria 1602
98 Ga0265318_10016930 3300028577 Bacteria 3001
99 Ga0265318_10240305 3300028577 Bacteria 661
100 Ga0265338_10004822 3300028800 Bacteria 18025
101 Ga0265338_10286255 3300028800 Bacteria 1202
102 Ga0265338_10561393 3300028800 Bacteria 798
103 Ga0265330_10022607 3300031235 Bacteria 2861
104 Ga0265332_10073315 3300031238 Bacteria 1457
105 Ga0265325_10130416 3300031241 Bacteria 1204
106 Ga0265329_10038581 3300031242 Bacteria 1536
107 Ga0265340_10028999 3300031247 Bacteria 2781
108 Ga0265339_10117975 3300031249 Bacteria 1366
109 Ga0265327_10023128 3300031251 Bacteria 3689
110 Ga0265327_10099603 3300031251 Bacteria 1404
111 Ga0265327_10102014 3300031251 Bacteria 1383
112 Ga0265327_10224279 3300031251 Bacteria 844
113 Ga0265327_10263028 3300031251 Bacteria 766
114 Ga0265316_10007568 3300031344 Bacteria 10219
115 Ga0265314_10008018 3300031711 Bacteria 9108
116 Ga0265342_10008775 3300031712 Bacteria 7209
117 Ga0307415_100107942 3300032126 Bacteria 2058
118 Ga0373944_0010590 3300035089 Bacteria 2515
119 Ga0373936_0077468 3300035113 Bacteria 1379
120 Ga0373945_0023257 3300035116 Bacteria 2140
121 Ga0373943_0005081 3300035170 Bacteria 5931
122 Ga0373946_0093953 3300035171 Bacteria 1333
123 Ga0373924_0056289 3300035410 Bacteria 1638
124 Ga0373927_0013984 3300035695 Bacteria 5321
125 Ga0373947_0006796 3300035725 Bacteria 6632
126 Ga0395899_0320324 3300037312 Bacteria 1045
127 Ga0395900_0158702 3300037418 Bacteria 2308
128 Ga0395898_0040837 3300037466 Bacteria 4585
129 Ga0395898_0106067 3300037466 Bacteria 2695
130 Ga0395898_1110952 3300037466 Bacteria 724
131 Ga0395901_0077838 3300038443 Bacteria 3461
132 Ga0395901_0332059 3300038443 Bacteria 1572
133 Ga0395901_0604852 3300038443 Bacteria 1105
134 Ga0395901_0861300 3300038443 Bacteria 891
135 Ga0395901_1556154 3300038443 Bacteria 616
136 Ga0395901_1915207 3300038443 Bacteria 540
137 Ga0436360_0972802 3300039438 Bacteria 911
138 Ga0439445_0036748 3300042004 Bacteria 1290
139 Ga0439455_0161832 3300042012 Bacteria 640
140 Ga0466969_0197889 3300044656 Bacteria 917
141 Ga0466965_0386282 3300044683 Bacteria 772
142 Ga0466965_0539897 3300044683 Bacteria 657
143 Ga0466966_0082771 3300044684 Bacteria 1997
144 Ga0466963_0008868 3300044694 Bacteria 6035
145 Ga0466963_0156388 3300044694 Bacteria 1585
146 Ga0466963_0213448 3300044694 Bacteria 1351
147 Ga0466963_0675144 3300044694 Bacteria 729
148 Ga0466963_0683759 3300044694 Bacteria 724
149 Ga0466964_0002361 3300044706 Bacteria 6706
150 Ga0466964_0043740 3300044706 Bacteria 1818
151 Ga0466964_0620667 3300044706 Bacteria 595
152 Ga0466968_0038154 3300044735 Bacteria 2018
153 Ga0466957_0228672 3300044842 Bacteria 1231
154 Ga0466957_0246971 3300044842 Bacteria 1186
155 Ga0466957_0320943 3300044842 Bacteria 1045
156 Ga0466960_0001992 3300044901 Bacteria 7575
157 Ga0466960_0028389 3300044901 Bacteria 2560
158 Ga0466967_0002535 3300045976 Bacteria 11434
159 Ga0466967_0018713 3300045976 Bacteria 5546
160 Ga0466967_0023616 3300045976 Bacteria 5043
161 Ga0466967_0100480 3300045976 Bacteria 2643
162 Ga0466967_0149206 3300045976 Bacteria 2184
163 Ga0466967_0172343 3300045976 Bacteria 2037
164 Ga0466967_0695229 3300045976 Unclassified 1007
165 Ga0466967_1348776 3300045976 Bacteria 710
166 Ga0495592_0023596 3300046454 Bacteria 4680
167 Ga0495629_0000769 3300046459 Bacteria 25883
168 Ga0495629_0019955 3300046459 Bacteria 4782
169 Ga0495629_0126603 3300046459 Bacteria 1780
170 Ga0495629_0675281 3300046459 Bacteria 687
171 Ga0495641_0000416 3300046461 Bacteria 35566
172 Ga0495651_0058868 3300046462 Bacteria 2947
173 Ga0495653_0052718 3300046463 Bacteria 3117
174 Ga0495582_0015742 3300046473 Bacteria 4148
175 Ga0495639_0003265 3300046475 Bacteria 7040
176 Ga0495664_0018289 3300046477 Bacteria 4013
177 Ga0495664_0673815 3300046477 Bacteria 612
178 Ga0495596_0135932 3300046500 Bacteria 954
179 Ga0495608_0036543 3300046511 Bacteria 3307
180 Ga0495608_0239679 3300046511 Bacteria 1133
181 Ga0495628_0066284 3300046516 Bacteria 2822
182 Ga0495630_0030264 3300046517 Bacteria 4026
183 Ga0495630_0184872 3300046517 Bacteria 1590
184 Ga0495631_0284519 3300046518 Bacteria 704
185 Ga0495644_0062092 3300046523 Bacteria 1404
186 Ga0495652_0032703 3300046529 Bacteria 4546
187 Ga0495652_1061246 3300046529 Bacteria 527
188 Ga0495665_0000917 3300046531 Bacteria 15541
189 Ga0495640_0080619 3300046533 Bacteria 2164
190 Ga0495586_0150613 3300046535 Bacteria 1309
191 Ga0495587_0299747 3300046536 Bacteria 899
192 Ga0495645_0262711 3300046543 Bacteria 1142
193 Ga0495667_0257745 3300046559 Bacteria 1109
194 Ga0495656_0013863 3300046615 Bacteria 3009
195 Ga0495634_0077681 3300046642 Bacteria 2176
196 Ga0495634_0081393 3300046642 Bacteria 2117
197 Ga0495634_0158538 3300046642 Bacteria 1428
198 Ga0495635_0024460 3300046663 Bacteria 4209
199 Ga0495635_0028481 3300046663 Bacteria 3883
200 Ga0495635_0601588 3300046663 Bacteria 718
201 Ga0495635_1072826 3300046663 Unclassified 511
202 Ga0495599_0031074 3300046678 Bacteria 3352
203 Ga0495599_0386000 3300046678 Unclassified 836
204 Ga0495646_0023253 3300046680 Bacteria 3903
205 Ga0495646_0437393 3300046680 Bacteria 677
206 Ga0495647_0013989 3300046681 Bacteria 2789
207 Ga0495658_0001205 3300046683 Bacteria 13598
208 Ga0495658_0064356 3300046683 Bacteria 2113
209 Ga0495613_0008571 3300046689 Bacteria 7589
210 Ga0495589_0046498 3300046794 Bacteria 2154
211 Ga0495600_0071025 3300046809 Bacteria 2275
212 Ga0495581_0001888 3300047315 Bacteria 11726
213 Ga0495674_0052992 3300047319 Bacteria 3568
214 Ga0495676_0002838 3300047321 Bacteria 15613
215 Ga0495680_0005259 3300047322 Bacteria 12219
216 Ga0495680_0465080 3300047322 Bacteria 863
217 Ga0495675_0099149 3300047444 Bacteria 1825
218 Ga0495684_0005875 3300047471 Bacteria 9535
219 Ga0495684_0226010 3300047471 Bacteria 1370
220 Ga0495602_0184261 3300048088 Bacteria 1607
221 Ga0495614_0021122 3300048089 Bacteria 2814
222 Ga0496102_0017031 3300048905 Bacteria 6360
223 Ga0496102_0907546 3300048905 Bacteria 803
224 Ga0496103_0155559 3300048906 Bacteria 1465
225 Ga0496109_0429308 3300048912 Bacteria 1248
226 Ga0496110_0534300 3300048913 Bacteria 1066
227 Ga0496112_0004745 3300048915 Bacteria 11585
228 Ga0496112_0008949 3300048915 Bacteria 8990
229 Ga0496112_0058000 3300048915 Bacteria 3812
230 Ga0496112_0068414 3300048915 Bacteria 3506
231 Ga0496112_0586969 3300048915 Bacteria 1047
232 Ga0501031_0303704 3300049568 Bacteria 1034
233 Ga0501031_0979282 3300049568 Bacteria 541
234 Ga0501048_0525964 3300049582 Bacteria 848
235 Ga0501067_0144361 3300049583 Bacteria 1326
236 Ga0501069_0024498 3300049585 Bacteria 3292
237 Ga0501070_0000104 3300049586 Bacteria 74572
238 Ga0501071_0092230 3300049587 Bacteria 2226
239 Ga0501074_0382878 3300049590 Bacteria 998
240 Ga0501075_0483143 3300049591 Bacteria 945
241 Ga0501080_0480849 3300049742 Bacteria 1111
242 Ga0501045_0113665 3300049824 Bacteria 2008
243 nmdc:mga06r32_782702_c1 3300050510 Bacteria 915
244 nmdc:mga08y16_1354897_c1 3300050511 Bacteria 676
245 nmdc:mga0rr50_59236_c1 3300050513 Bacteria 2874
246 nmdc:mga08x19_892607_c1 3300050514 Bacteria 631
247 nmdc:mga0a205_1171728_c1 3300050515 Unclassified 616
248 Ga0495601_0176314 3300053077 Bacteria 1397
249 Ga0495601_0257019 3300053077 Bacteria 1140
250 Ga0495612_0068902 3300053078 Bacteria 1473
251 Ga0495655_0002183 3300053083 Bacteria 3087
252 Ga0495595_0013861 3300053084 Bacteria 3411
253 Ga0495619_0011101 3300053085 Bacteria 5664
254 Ga0495619_0014028 3300053085 Bacteria 5055
255 Ga0495619_0629453 3300053085 Bacteria 733
256 Ga0466962_0265273 3300061719 Bacteria 846
257 Ga0207678_10464994
258 Ga0070658_10127970
259 Ga0070658_10156933
260 Ga0070658_10336325
261 Ga0070658_10554580
262 Ga0070683_100417948
263 Ga0068869_100998494
264 Ga0070680_100098235
265 Ga0070680_100993068
266 Ga0070680_101041155
267 Ga0070660_100024163
268 Ga0070660_100385043
269 Ga0070660_101874772
270 Ga0070674_100168736
271 Ga0070659_101445457
272 Ga0070714_101265920
273 Ga0070714_102187541
274 Ga0070713_100430729
275 Ga0070713_101509817
276 Ga0070710_10676438
277 Ga0070711_100194450
278 Ga0070711_100381730
279 Ga0070705_101179619
280 Ga0070708_100105543
281 Ga0070678_100406993
282 Ga0070678_100823590
283 Ga0070681_10021526
284 Ga0070706_101450108
285 Ga0070707_100669139
286 Ga0070707_101041634
287 Ga0070698_101256689
288 Ga0070699_100928611
289 Ga0070679_100023050
290 Ga0070684_100765103
291 Ga0070672_100216313
292 Ga0070693_100022592
293 Ga0070704_101265461
294 Ga0068855_100159356
295 Ga0068855_101296791
296 Ga0070664_101268474
297 Ga0068857_100165589
298 Ga0081455_10240465
299 Ga0070717_11110734
300 Ga0070712_100231474
301 Ga0070712_100586989
302 Ga0070712_101654978
303 Ga0075431_100702379
304 Ga0068865_100449784
305 Ga0075435_100059841
306 Ga0105240_10748317
307 Ga0114129_11761233
308 Ga0105243_10947668
309 Ga0105241_10662809
310 Ga0105249_10920790
311 Ga0157327_1022197
312 Ga0157369_11453887
313 Ga0157372_10125531
314 Ga0163163_11655429
315 Ga0163163_11721541
316 Ga0157377_10091679
317 Ga0206354_10374278
318 Ga0213871_10091882
319 Ga0207688_10483743
320 Ga0207705_10138980
321 Ga0207705_10234385
322 Ga0207707_10282948
323 Ga0207693_10461813
324 Ga0207693_10935120
325 Ga0207663_10122426
326 Ga0207663_10425657
327 Ga0207660_10107875
328 Ga0207657_10044083
329 Ga0207657_10291116
330 Ga0207657_10504915
331 Ga0207652_10319296
332 Ga0207652_10321054
333 Ga0207646_10541188
334 Ga0207700_10867612
335 Ga0207664_10199868
336 Ga0207690_10846533
337 Ga0207669_10066313
338 Ga0207665_11233454
339 Ga0207665_11385274
340 Ga0207691_10219907
341 Ga0207661_10520699
342 Ga0207661_10966309
343 Ga0207679_10763921
344 Ga0207679_11295564
345 Ga0207667_10700709
346 Ga0207667_12015015
347 Ga0207677_10678778
348 Ga0207677_11407504
349 Ga0207641_11654300
350 Ga0207674_10292367
351 Ga0207675_100526655
352 Ga0265319_1005405
353 Ga0265334_10050225
354 Ga0265318_10016930
355 Ga0265318_10240305
356 Ga0265338_10004822
357 Ga0265338_10286255
358 Ga0265338_10561393
359 Ga0265330_10022607
360 Ga0265332_10073315
361 Ga0265325_10130416
362 Ga0265329_10038581
363 Ga0265340_10028999
364 Ga0265339_10117975
365 Ga0265327_10023128
366 Ga0265327_10099603
367 Ga0265327_10102014
368 Ga0265327_10224279
369 Ga0265327_10263028
370 Ga0265316_10007568
371 Ga0265314_10008018
372 Ga0265342_10008775
373 Ga0307415_100107942
374 Ga0373944_0010590
375 Ga0373936_0077468
376 Ga0373945_0023257
377 Ga0373943_0005081
378 Ga0373946_0093953
379 Ga0373924_0056289
380 Ga0373927_0013984
381 Ga0373947_0006796
382 Ga0395899_0320324
383 Ga0395900_0158702
384 Ga0395898_0040837
385 Ga0395898_0106067
386 Ga0395898_1110952
387 Ga0395901_0077838
388 Ga0395901_0332059
389 Ga0395901_0604852
390 Ga0395901_0861300
391 Ga0395901_1556154
392 Ga0395901_1915207
393 Ga0436360_0972802
394 Ga0439445_0036748
395 Ga0439455_0161832
396 Ga0466969_0197889
397 Ga0466965_0386282
398 Ga0466965_0539897
399 Ga0466966_0082771
400 Ga0466963_0008868
401 Ga0466963_0156388
402 Ga0466963_0213448
403 Ga0466963_0675144
404 Ga0466963_0683759
405 Ga0466964_0002361
406 Ga0466964_0043740
407 Ga0466964_0620667
408 Ga0466968_0038154
409 Ga0466957_0228672
410 Ga0466957_0246971
411 Ga0466957_0320943
412 Ga0466960_0001992
413 Ga0466960_0028389
414 Ga0466967_0002535
415 Ga0466967_0018713
416 Ga0466967_0023616
417 Ga0466967_0100480
418 Ga0466967_0149206
419 Ga0466967_0172343
420 Ga0466967_0695229
421 Ga0466967_1348776
422 Ga0495592_0023596
423 Ga0495629_0000769
424 Ga0495629_0019955
425 Ga0495629_0126603
426 Ga0495629_0675281
427 Ga0495641_0000416
428 Ga0495651_0058868
429 Ga0495653_0052718
430 Ga0495582_0015742
431 Ga0495639_0003265
432 Ga0495664_0018289
433 Ga0495664_0673815
434 Ga0495596_0135932
435 Ga0495608_0036543
436 Ga0495608_0239679
437 Ga0495628_0066284
438 Ga0495630_0030264
439 Ga0495630_0184872
440 Ga0495631_0284519
441 Ga0495644_0062092
442 Ga0495652_0032703
443 Ga0495652_1061246
444 Ga0495665_0000917
445 Ga0495640_0080619
446 Ga0495586_0150613
447 Ga0495587_0299747
448 Ga0495645_0262711
449 Ga0495667_0257745
450 Ga0495656_0013863
451 Ga0495634_0077681
452 Ga0495634_0081393
453 Ga0495634_0158538
454 Ga0495635_0024460
455 Ga0495635_0028481
456 Ga0495635_0601588
457 Ga0495635_1072826
458 Ga0495599_0031074
459 Ga0495599_0386000
460 Ga0495646_0023253
461 Ga0495646_0437393
462 Ga0495647_0013989
463 Ga0495658_0001205
464 Ga0495658_0064356
465 Ga0495613_0008571
466 Ga0495589_0046498
467 Ga0495600_0071025
468 Ga0495581_0001888
469 Ga0495674_0052992
470 Ga0495676_0002838
471 Ga0495680_0005259
472 Ga0495680_0465080
473 Ga0495675_0099149
474 Ga0495684_0005875
475 Ga0495684_0226010
476 Ga0495602_0184261
477 Ga0495614_0021122
478 Ga0496102_0017031
479 Ga0496102_0907546
480 Ga0496103_0155559
481 Ga0496109_0429308
482 Ga0496110_0534300
483 Ga0496112_0004745
484 Ga0496112_0008949
485 Ga0496112_0058000
486 Ga0496112_0068414
487 Ga0496112_0586969
488 Ga0501031_0303704
489 Ga0501031_0979282
490 Ga0501048_0525964
491 Ga0501067_0144361
492 Ga0501069_0024498
493 Ga0501070_0000104
494 Ga0501071_0092230
495 Ga0501074_0382878
496 Ga0501075_0483143
497 Ga0501080_0480849
498 Ga0501045_0113665
499 nmdc:mga06r32_782702_c1
500 nmdc:mga08y16_1354897_c1
501 nmdc:mga0rr50_59236_c1
502 nmdc:mga08x19_892607_c1
503 nmdc:mga0a205_1171728_c1
504 Ga0495601_0176314
505 Ga0495601_0257019
506 Ga0495612_0068902
507 Ga0495655_0002183
508 Ga0495595_0013861
509 Ga0495619_0011101
510 Ga0495619_0014028
511 Ga0495619_0629453
512 Ga0466962_0265273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

11

85

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.882 1 127
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8757 1 127
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8427 2 126
3fjy-assembly1.cif.gz_B crystal structure of a probable mutt1 protein from bifidobacterium adolescentis 0.8421 2 112
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8332 2 126
ID Description Score Start End Superfamily
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8823 1 127 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8759 1 127 3.40.50.1240
af_O44899_1_131_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8567 6 74 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8519 2 120 3.40.50.1240
af_Q9BL94_4_220_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8383 2 124 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7W0WBF6-F1-model_v4 Histidine phosphatase family protein 0.9892 6 89
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9799 1 125 GO:0005737
GO:0036211
GO:0101006
AF-A0A7V9UXZ1-F1-model_v4 Histidine phosphatase family protein 0.969 1 127
AF-A0A7V9UXZ1-F1-model_v4 Histidine phosphatase family protein 0.9616 1 127
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9572 1 125 GO:0005737
GO:0036211
GO:0101006

Map