F366571

General Info

Members Datasets Scaffolds Average Seq Length
256 158 512 205

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10727027|Ga0207667_107270271
Length 236
Sequence VKPTRSANSTETSRSPQGLSLIGRIANSQCPAASILVAVNVASRMPQPWRSIVDWVVTIVLAVVFVLAFEAEVAKPYRIPSSSMEPTLHCAKPGAWCEGSYNDRVIANRLAFRFTDPKRGQIVVFKTPARAAQCGPGDGGATFVKRLIGLPGDRVSERNGQVYVNGRKLDEPYVDPALRDHETASWPQVPSGHYFFLGDDRTHSCDSRTWGTVPRSSLIGPVIATYWPPNRIDWLG

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
104 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
152 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
153 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
154 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.47
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 6.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10727027 3300025949 Bacteria 993
2 Ga0070658_10063382 3300005327 Bacteria 3013
3 Ga0070658_10316417 3300005327 Bacteria 1332
4 Ga0070683_100024643 3300005329 Bacteria 5392
5 Ga0070683_100316307 3300005329 Bacteria 1485
6 Ga0070683_100394363 3300005329 Bacteria 1320
7 Ga0068869_100249216 3300005334 Bacteria 1418
8 Ga0070680_100008169 3300005336 Bacteria 7997
9 Ga0070680_100017384 3300005336 Bacteria 5671
10 Ga0070680_100140682 3300005336 Bacteria 2024
11 Ga0070680_100272329 3300005336 Bacteria 1434
12 Ga0070660_100293488 3300005339 Bacteria 1332
13 Ga0070661_100015389 3300005344 Bacteria 5399
14 Ga0070661_100035115 3300005344 Bacteria 3639
15 Ga0070692_10126048 3300005345 Bacteria 1434
16 Ga0070671_100134628 3300005355 Bacteria 2083
17 Ga0070659_100462538 3300005366 Bacteria 1077
18 Ga0070714_100013212 3300005435 Bacteria 6609
19 Ga0070714_100035266 3300005435 Bacteria 4192
20 Ga0070714_100056397 3300005435 Bacteria 3360
21 Ga0070714_100093111 3300005435 Bacteria 2642
22 Ga0070713_100036877 3300005436 Bacteria 3949
23 Ga0070710_10016309 3300005437 Bacteria 3777
24 Ga0070710_10380064 3300005437 Plasmid 942
25 Ga0070662_100038673 3300005457 Bacteria 3390
26 Ga0070681_10004088 3300005458 Bacteria 13788
27 Ga0070681_10018318 3300005458 Bacteria 6998
28 Ga0070681_10051050 3300005458 Bacteria 4125
29 Ga0070681_10147221 3300005458 Bacteria 2283
30 Ga0070706_100578023 3300005467 Bacteria 1045
31 Ga0070707_100000328 3300005468 Bacteria 46683
32 Ga0070698_100169167 3300005471 Bacteria 2127
33 Ga0070698_100532731 3300005471 Bacteria 1113
34 Ga0070699_100980280 3300005518 Unclassified 775
35 Ga0070679_100016132 3300005530 Bacteria 7197
36 Ga0070679_100108310 3300005530 Bacteria 2764
37 Ga0070684_100156930 3300005535 Bacteria 2063
38 Ga0070684_100441719 3300005535 Bacteria 1202
39 Ga0070684_100602452 3300005535 Unclassified 1021
40 Ga0068853_100224960 3300005539 Unclassified 1715
41 Ga0070693_100119608 3300005547 Bacteria 1632
42 Ga0070704_100062201 3300005549 Bacteria 2675
43 Ga0068855_100067069 3300005563 Bacteria 4182
44 Ga0068857_100024043 3300005577 Bacteria 5363
45 Ga0068856_100018823 3300005614 Bacteria 6696
46 Ga0068856_100027647 3300005614 Bacteria 5534
47 Ga0068852_100089665 3300005616 Bacteria 2749
48 Ga0068852_100232736 3300005616 Bacteria 1757
49 Ga0068870_10001672 3300005840 Bacteria 9078
50 Ga0070717_10166049 3300006028 Bacteria 1917
51 Ga0075432_10001201 3300006058 Bacteria 8328
52 Ga0070715_10002679 3300006163 Bacteria 5513
53 Ga0070712_100088953 3300006175 Bacteria 2258
54 Ga0070712_100532772 3300006175 Bacteria 988
55 Ga0075428_100001830 3300006844 Bacteria 22766
56 Ga0075428_100210667 3300006844 Unclassified 2100
57 Ga0075431_100256163 3300006847 Bacteria 1777
58 Ga0075433_10309624 3300006852 Bacteria 1398
59 Ga0105240_10457079 3300009093 Bacteria 1428
60 Ga0111539_10150899 3300009094 Bacteria 2720
61 Ga0105245_10015465 3300009098 Bacteria 6653
62 Ga0105245_10217321 3300009098 Bacteria 1842
63 Ga0105247_10175119 3300009101 Bacteria 1428
64 Ga0114129_10020194 3300009147 Bacteria 9481
65 Ga0114129_10050998 3300009147 Bacteria 5810
66 Ga0105241_10287103 3300009174 Bacteria 1407
67 Ga0105241_10302815 3300009174 Bacteria 1372
68 Ga0105248_10046432 3300009177 Bacteria 4868
69 Ga0105237_10026774 3300009545 Bacteria 5893
70 Ga0105237_10205900 3300009545 Bacteria 1968
71 Ga0105237_10639318 3300009545 Bacteria 1071
72 Ga0105238_10080736 3300009551 Bacteria 3241
73 Ga0105238_10574945 3300009551 Bacteria 1133
74 Ga0105239_10191998 3300010375 Bacteria 2286
75 Ga0105246_10011630 3300011119 Bacteria 5466
76 Ga0157373_10061840 3300013100 Bacteria 2652
77 Ga0157371_10275689 3300013102 Bacteria 1214
78 Ga0157370_10097431 3300013104 Bacteria 2759
79 Ga0157370_10141594 3300013104 Bacteria 2241
80 Ga0157370_10159697 3300013104 Bacteria 2098
81 Ga0157369_10466366 3300013105 Bacteria 1307
82 Ga0157372_10020916 3300013307 Bacteria 7063
83 Ga0157372_10037465 3300013307 Bacteria 5350
84 Ga0157372_10078587 3300013307 Bacteria 3728
85 Ga0157372_10158224 3300013307 Bacteria 2617
86 Ga0197907_10310963 3300020069 Unclassified 1019
87 Ga0206356_11156486 3300020070 Bacteria 1422
88 Ga0206356_11446847 3300020070 Bacteria 1338
89 Ga0207692_10014481 3300025898 Bacteria 3447
90 Ga0207688_10015363 3300025901 Bacteria 4153
91 Ga0207643_10023361 3300025908 Bacteria 3408
92 Ga0207705_10073033 3300025909 Bacteria 2489
93 Ga0207684_10489240 3300025910 Bacteria 1055
94 Ga0207707_10038419 3300025912 Bacteria 4183
95 Ga0207707_10138172 3300025912 Bacteria 2130
96 Ga0207707_10179232 3300025912 Bacteria 1850
97 Ga0207671_10305084 3300025914 Bacteria 1258
98 Ga0207693_10001363 3300025915 Bacteria 21637
99 Ga0207660_10002602 3300025917 Bacteria 11844
100 Ga0207660_10030181 3300025917 Bacteria 3725
101 Ga0207660_10127594 3300025917 Bacteria 1933
102 Ga0207657_10015985 3300025919 Bacteria 7245
103 Ga0207657_10082257 3300025919 Bacteria 2703
104 Ga0207657_10153536 3300025919 Bacteria 1874
105 Ga0207657_10341627 3300025919 Bacteria 1181
106 Ga0207649_10165253 3300025920 Bacteria 1537
107 Ga0207652_10056660 3300025921 Bacteria 3374
108 Ga0207652_10329126 3300025921 Unclassified 1379
109 Ga0207646_10000835 3300025922 Bacteria 40092
110 Ga0207681_10235875 3300025923 Bacteria 1422
111 Ga0207650_10032655 3300025925 Bacteria 3765
112 Ga0207687_10022378 3300025927 Bacteria 4206
113 Ga0207664_10249330 3300025929 Bacteria 1549
114 Ga0207644_10260051 3300025931 Bacteria 1388
115 Ga0207644_10281487 3300025931 Unclassified 1335
116 Ga0207690_10136389 3300025932 Bacteria 1802
117 Ga0207690_10431901 3300025932 Bacteria 1055
118 Ga0207706_10022041 3300025933 Bacteria 5717
119 Ga0207689_10215989 3300025942 Bacteria 1585
120 Ga0207661_10278283 3300025944 Bacteria 1495
121 Ga0207661_10327398 3300025944 Bacteria 1378
122 Ga0207679_10113223 3300025945 Bacteria 2146
123 Ga0207667_10119996 3300025949 Bacteria 2710
124 Ga0207667_10178936 3300025949 Bacteria 2178
125 Ga0207639_10560875 3300026041 Bacteria 1049
126 Ga0207678_10112028 3300026067 Bacteria 2328
127 Ga0207674_10068390 3300026116 Bacteria 3574
128 Ga0207674_10109059 3300026116 Bacteria 2745
129 Ga0207698_10006539 3300026142 Bacteria 7281
130 Ga0207698_10365672 3300026142 Bacteria 1368
131 Ga0209966_1033451 3300027695 Bacteria 1050
132 Ga0207428_10001384 3300027907 Bacteria 25610
133 Ga0373956_0158281 3300035119 Bacteria 1067
134 Ga0395898_1085528 3300037466 Bacteria 734
135 Ga0466969_0001065 3300044656 Bacteria 14824
136 Ga0466972_0013343 3300044658 Bacteria 4125
137 Ga0466965_0248222 3300044683 Unclassified 954
138 Ga0466965_0363725 3300044683 Unclassified 794
139 Ga0466966_0020816 3300044684 Bacteria 4312
140 Ga0466966_0022996 3300044684 Bacteria 4084
141 Ga0466966_0269664 3300044684 Bacteria 1024
142 Ga0466963_0000037 3300044694 Bacteria 42541
143 Ga0466963_0001747 3300044694 Bacteria 11838
144 Ga0466963_0007541 3300044694 Bacteria 6492
145 Ga0466963_0015402 3300044694 Bacteria 4733
146 Ga0466963_0047592 3300044694 Bacteria 2830
147 Ga0466963_0167119 3300044694 Bacteria 1532
148 Ga0466964_0002360 3300044706 Bacteria 6707
149 Ga0466964_0008965 3300044706 Bacteria 3764
150 Ga0466964_0096665 3300044706 Bacteria 1295
151 Ga0466964_0149490 3300044706 Bacteria 1081
152 Ga0466971_0000411 3300044719 Bacteria 16714
153 Ga0466971_0018344 3300044719 Bacteria 3098
154 Ga0466971_0022421 3300044719 Bacteria 2814
155 Ga0466968_0022513 3300044735 Bacteria 2561
156 Ga0466968_0026657 3300044735 Bacteria 2373
157 Ga0466968_0164734 3300044735 Bacteria 1024
158 Ga0466968_0330883 3300044735 Unclassified 737
159 Ga0466970_0010111 3300044765 Bacteria 4780
160 Ga0466970_0021809 3300044765 Bacteria 3340
161 Ga0466957_0000448 3300044842 Bacteria 20335
162 Ga0466957_0010516 3300044842 Bacteria 5318
163 Ga0466957_0073820 3300044842 Bacteria 2114
164 Ga0466959_0003416 3300045049 Bacteria 10385
165 Ga0466959_0007651 3300045049 Bacteria 7597
166 Ga0466959_0033203 3300045049 Bacteria 3818
167 Ga0466958_0000148 3300045836 Bacteria 24461
168 Ga0466958_0002356 3300045836 Bacteria 9453
169 Ga0466958_0114507 3300045836 Bacteria 1684
170 Ga0466967_0002282 3300045976 Bacteria 11836
171 Ga0466967_0009709 3300045976 Bacteria 7164
172 Ga0466967_0012617 3300045976 Bacteria 6477
173 Ga0466967_0043742 3300045976 Bacteria 3880
174 Ga0466967_0140733 3300045976 Bacteria 2247
175 Ga0466967_0151924 3300045976 Bacteria 2165
176 Ga0466967_0170465 3300045976 Bacteria 2047
177 Ga0466967_0390188 3300045976 Bacteria 1353
178 Ga0495592_0106855 3300046454 Bacteria 1986
179 Ga0495641_0039297 3300046461 Bacteria 2207
180 Ga0495653_0254775 3300046463 Unclassified 1163
181 Ga0495664_0079163 3300046477 Bacteria 1969
182 Ga0495664_0106288 3300046477 Bacteria 1692
183 Ga0495584_0244706 3300046491 Archaea 912
184 Ga0495607_0068982 3300046501 Bacteria 1981
185 Ga0495608_0073462 3300046511 Bacteria 2230
186 Ga0495608_0190379 3300046511 Bacteria 1295
187 Ga0495644_0025818 3300046523 Bacteria 2229
188 Ga0495652_0084216 3300046529 Bacteria 2615
189 Ga0495652_0179818 3300046529 Bacteria 1624
190 Ga0495645_0136364 3300046543 Bacteria 1716
191 Ga0495667_0025943 3300046559 Bacteria 3947
192 Ga0495634_0228460 3300046642 Bacteria 1146
193 Ga0495635_0167599 3300046663 Unclassified 1494
194 Ga0495657_0065966 3300046675 Unclassified 2379
195 Ga0495599_0014418 3300046678 Bacteria 4894
196 Ga0495599_0235810 3300046678 Bacteria 1116
197 Ga0495623_0037108 3300046679 Bacteria 3121
198 Ga0495646_0177717 3300046680 Bacteria 1170
199 Ga0495658_0425196 3300046683 Bacteria 848
200 Ga0495624_0384155 3300046690 Bacteria 843
201 Ga0495581_0467170 3300047315 Unclassified 734
202 Ga0495604_0018313 3300047317 Bacteria 5609
203 Ga0495674_0574260 3300047319 Bacteria 895
204 Ga0495680_0522194 3300047322 Bacteria 803
205 Ga0495684_0030878 3300047471 Bacteria 4113
206 Ga0495602_0206467 3300048088 Bacteria 1495
207 Ga0496101_0007189 3300048904 Bacteria 7204
208 Ga0496102_0071824 3300048905 Bacteria 3178
209 Ga0496104_0018436 3300048907 Bacteria 6366
210 Ga0496104_0113653 3300048907 Bacteria 2596
211 Ga0496104_0323476 3300048907 Bacteria 1455
212 Ga0496105_0017266 3300048908 Bacteria 5781
213 Ga0496105_0144295 3300048908 Bacteria 1958
214 Ga0496108_0032381 3300048911 Bacteria 4343
215 Ga0496108_0033811 3300048911 Bacteria 4246
216 Ga0496109_0026061 3300048912 Bacteria 5210
217 Ga0496109_0036991 3300048912 Bacteria 4408
218 Ga0496110_0311659 3300048913 Bacteria 1433
219 Ga0496112_0883904 3300048915 Bacteria 816
220 Ga0496115_0101254 3300048918 Bacteria 2362
221 Ga0501041_0199073 3300049577 Bacteria 1255
222 Ga0501042_0023884 3300049578 Bacteria 4282
223 Ga0501042_0341283 3300049578 Bacteria 1083
224 Ga0501046_0197975 3300049580 Bacteria 1496
225 Ga0501047_0095284 3300049581 Bacteria 2855
226 Ga0501067_0000996 3300049583 Bacteria 15218
227 Ga0501067_0115287 3300049583 Bacteria 1494
228 Ga0501069_0046586 3300049585 Bacteria 2405
229 Ga0501070_0082782 3300049586 Bacteria 2656
230 Ga0501070_0197995 3300049586 Bacteria 1650
231 Ga0501070_0296778 3300049586 Bacteria 1317
232 Ga0501071_0005613 3300049587 Bacteria 8086
233 Ga0501071_0097723 3300049587 Bacteria 2162
234 Ga0501072_0055759 3300049588 Bacteria 3114
235 Ga0501074_0079068 3300049590 Bacteria 2360
236 Ga0501074_0162833 3300049590 Bacteria 1593
237 Ga0501076_0009284 3300049592 Bacteria 7256
238 Ga0501076_0258945 3300049592 Unclassified 1424
239 Ga0501077_0000785 3300049593 Bacteria 19174
240 Ga0501079_0171328 3300049741 Bacteria 1693
241 Ga0501080_0118301 3300049742 Bacteria 2456
242 Ga0501035_0196990 3300049822 Bacteria 1730
243 nmdc:mga05p37_204113_c1 3300050507 Unclassified 2392
244 nmdc:mga05p37_7706_c1 3300050507 Bacteria 12706
245 nmdc:mga09592_200202_c1 3300050508 Unclassified 1729
246 nmdc:mga08y16_51933_c1 3300050511 Bacteria 4290
247 nmdc:mga0a205_155775_c1 3300050515 Bacteria 1498
248 Ga0495601_0073459 3300053077 Bacteria 2186
249 Ga0495601_0217054 3300053077 Bacteria 1249
250 Ga0495612_0028970 3300053078 Bacteria 2229
251 Ga0495595_0013282 3300053084 Bacteria 3478
252 Ga0495619_0148243 3300053085 Bacteria 1618
253 Ga0501084_0001747 3300054114 Bacteria 17269
254 Ga0466962_0023654 3300061719 Bacteria 2952
255 Ga0466962_0036404 3300061719 Bacteria 2355
256 Ga0530510_0026992 3300061734 Bacteria 4113
257 Ga0207667_10727027
258 Ga0070658_10063382
259 Ga0070658_10316417
260 Ga0070683_100024643
261 Ga0070683_100316307
262 Ga0070683_100394363
263 Ga0068869_100249216
264 Ga0070680_100008169
265 Ga0070680_100017384
266 Ga0070680_100140682
267 Ga0070680_100272329
268 Ga0070660_100293488
269 Ga0070661_100015389
270 Ga0070661_100035115
271 Ga0070692_10126048
272 Ga0070671_100134628
273 Ga0070659_100462538
274 Ga0070714_100013212
275 Ga0070714_100035266
276 Ga0070714_100056397
277 Ga0070714_100093111
278 Ga0070713_100036877
279 Ga0070710_10016309
280 Ga0070710_10380064
281 Ga0070662_100038673
282 Ga0070681_10004088
283 Ga0070681_10018318
284 Ga0070681_10051050
285 Ga0070681_10147221
286 Ga0070706_100578023
287 Ga0070707_100000328
288 Ga0070698_100169167
289 Ga0070698_100532731
290 Ga0070699_100980280
291 Ga0070679_100016132
292 Ga0070679_100108310
293 Ga0070684_100156930
294 Ga0070684_100441719
295 Ga0070684_100602452
296 Ga0068853_100224960
297 Ga0070693_100119608
298 Ga0070704_100062201
299 Ga0068855_100067069
300 Ga0068857_100024043
301 Ga0068856_100018823
302 Ga0068856_100027647
303 Ga0068852_100089665
304 Ga0068852_100232736
305 Ga0068870_10001672
306 Ga0070717_10166049
307 Ga0075432_10001201
308 Ga0070715_10002679
309 Ga0070712_100088953
310 Ga0070712_100532772
311 Ga0075428_100001830
312 Ga0075428_100210667
313 Ga0075431_100256163
314 Ga0075433_10309624
315 Ga0105240_10457079
316 Ga0111539_10150899
317 Ga0105245_10015465
318 Ga0105245_10217321
319 Ga0105247_10175119
320 Ga0114129_10020194
321 Ga0114129_10050998
322 Ga0105241_10287103
323 Ga0105241_10302815
324 Ga0105248_10046432
325 Ga0105237_10026774
326 Ga0105237_10205900
327 Ga0105237_10639318
328 Ga0105238_10080736
329 Ga0105238_10574945
330 Ga0105239_10191998
331 Ga0105246_10011630
332 Ga0157373_10061840
333 Ga0157371_10275689
334 Ga0157370_10097431
335 Ga0157370_10141594
336 Ga0157370_10159697
337 Ga0157369_10466366
338 Ga0157372_10020916
339 Ga0157372_10037465
340 Ga0157372_10078587
341 Ga0157372_10158224
342 Ga0197907_10310963
343 Ga0206356_11156486
344 Ga0206356_11446847
345 Ga0207692_10014481
346 Ga0207688_10015363
347 Ga0207643_10023361
348 Ga0207705_10073033
349 Ga0207684_10489240
350 Ga0207707_10038419
351 Ga0207707_10138172
352 Ga0207707_10179232
353 Ga0207671_10305084
354 Ga0207693_10001363
355 Ga0207660_10002602
356 Ga0207660_10030181
357 Ga0207660_10127594
358 Ga0207657_10015985
359 Ga0207657_10082257
360 Ga0207657_10153536
361 Ga0207657_10341627
362 Ga0207649_10165253
363 Ga0207652_10056660
364 Ga0207652_10329126
365 Ga0207646_10000835
366 Ga0207681_10235875
367 Ga0207650_10032655
368 Ga0207687_10022378
369 Ga0207664_10249330
370 Ga0207644_10260051
371 Ga0207644_10281487
372 Ga0207690_10136389
373 Ga0207690_10431901
374 Ga0207706_10022041
375 Ga0207689_10215989
376 Ga0207661_10278283
377 Ga0207661_10327398
378 Ga0207679_10113223
379 Ga0207667_10119996
380 Ga0207667_10178936
381 Ga0207639_10560875
382 Ga0207678_10112028
383 Ga0207674_10068390
384 Ga0207674_10109059
385 Ga0207698_10006539
386 Ga0207698_10365672
387 Ga0209966_1033451
388 Ga0207428_10001384
389 Ga0373956_0158281
390 Ga0395898_1085528
391 Ga0466969_0001065
392 Ga0466972_0013343
393 Ga0466965_0248222
394 Ga0466965_0363725
395 Ga0466966_0020816
396 Ga0466966_0022996
397 Ga0466966_0269664
398 Ga0466963_0000037
399 Ga0466963_0001747
400 Ga0466963_0007541
401 Ga0466963_0015402
402 Ga0466963_0047592
403 Ga0466963_0167119
404 Ga0466964_0002360
405 Ga0466964_0008965
406 Ga0466964_0096665
407 Ga0466964_0149490
408 Ga0466971_0000411
409 Ga0466971_0018344
410 Ga0466971_0022421
411 Ga0466968_0022513
412 Ga0466968_0026657
413 Ga0466968_0164734
414 Ga0466968_0330883
415 Ga0466970_0010111
416 Ga0466970_0021809
417 Ga0466957_0000448
418 Ga0466957_0010516
419 Ga0466957_0073820
420 Ga0466959_0003416
421 Ga0466959_0007651
422 Ga0466959_0033203
423 Ga0466958_0000148
424 Ga0466958_0002356
425 Ga0466958_0114507
426 Ga0466967_0002282
427 Ga0466967_0009709
428 Ga0466967_0012617
429 Ga0466967_0043742
430 Ga0466967_0140733
431 Ga0466967_0151924
432 Ga0466967_0170465
433 Ga0466967_0390188
434 Ga0495592_0106855
435 Ga0495641_0039297
436 Ga0495653_0254775
437 Ga0495664_0079163
438 Ga0495664_0106288
439 Ga0495584_0244706
440 Ga0495607_0068982
441 Ga0495608_0073462
442 Ga0495608_0190379
443 Ga0495644_0025818
444 Ga0495652_0084216
445 Ga0495652_0179818
446 Ga0495645_0136364
447 Ga0495667_0025943
448 Ga0495634_0228460
449 Ga0495635_0167599
450 Ga0495657_0065966
451 Ga0495599_0014418
452 Ga0495599_0235810
453 Ga0495623_0037108
454 Ga0495646_0177717
455 Ga0495658_0425196
456 Ga0495624_0384155
457 Ga0495581_0467170
458 Ga0495604_0018313
459 Ga0495674_0574260
460 Ga0495680_0522194
461 Ga0495684_0030878
462 Ga0495602_0206467
463 Ga0496101_0007189
464 Ga0496102_0071824
465 Ga0496104_0018436
466 Ga0496104_0113653
467 Ga0496104_0323476
468 Ga0496105_0017266
469 Ga0496105_0144295
470 Ga0496108_0032381
471 Ga0496108_0033811
472 Ga0496109_0026061
473 Ga0496109_0036991
474 Ga0496110_0311659
475 Ga0496112_0883904
476 Ga0496115_0101254
477 Ga0501041_0199073
478 Ga0501042_0023884
479 Ga0501042_0341283
480 Ga0501046_0197975
481 Ga0501047_0095284
482 Ga0501067_0000996
483 Ga0501067_0115287
484 Ga0501069_0046586
485 Ga0501070_0082782
486 Ga0501070_0197995
487 Ga0501070_0296778
488 Ga0501071_0005613
489 Ga0501071_0097723
490 Ga0501072_0055759
491 Ga0501074_0079068
492 Ga0501074_0162833
493 Ga0501076_0009284
494 Ga0501076_0258945
495 Ga0501077_0000785
496 Ga0501079_0171328
497 Ga0501080_0118301
498 Ga0501035_0196990
499 nmdc:mga05p37_204113_c1
500 nmdc:mga05p37_7706_c1
501 nmdc:mga09592_200202_c1
502 nmdc:mga08y16_51933_c1
503 nmdc:mga0a205_155775_c1
504 Ga0495601_0073459
505 Ga0495601_0217054
506 Ga0495612_0028970
507 Ga0495595_0013282
508 Ga0495619_0148243
509 Ga0501084_0001747
510 Ga0466962_0023654
511 Ga0466962_0036404
512 Ga0530510_0026992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

52

227

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7479 29 178
4me8-assembly1.cif.gz_A crystal structure of a signal peptidase i (ef3073) from enterococcus faecalis v583 at 2.27 a resolution 0.7414 71 177
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7284 29 178
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6941 29 178
4wvg-assembly1.cif.gz_A crystal structure of the type-i signal peptidase from staphylococcus aureus (spsb). 0.6919 29 183
ID Description Score Start End Superfamily
af_A0A1D6L5X4_1_100_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8032 59 182 2.10.109.10
af_Q96LU5_28_157_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7822 29 190 2.10.109.10
af_A0A0P0VT29_3_120_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7809 58 190 2.10.109.10
af_I1M2T2_35_162_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7739 29 189 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.772 29 178 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A2V7VJL5-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8736 59 190 GO:0004252
GO:0006465
GO:0016020
AF-A0A6M8HB55-F1-model_v4 deleted 0.873 10 184
AF-A0A5C0SED1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8688 6 190 GO:0004252
GO:0005886
GO:0006465
AF-A0A359F327-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8675 6 190 GO:0004252
GO:0006465
GO:0016020
AF-A0A523EKS6-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8664 1 190 GO:0004252
GO:0006465
GO:0016020

Map