F366468

General Info

Members Datasets Scaffolds Average Seq Length
256 174 512 137

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10078089|Ga0105237_100780897
Length 153
Sequence MSLKMPKRVKYRKIQRGVIRGLAAKKKYNGAIKGNAQRGNYVAYGDFGLQTLEGGWLSAQAIEAARVTITRFVSGEGRYYMRVFPHKSVTSIPAETRMGKGKGEPEYWAAVVKAGMVLFEIGGIPEAQAKEALAKVAYKMPFKCRFVTRRPNV

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
80 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
98 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
99 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
127 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
158 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 83.2
Metatranscriptomes 16.41
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 8.98
Rhizosphere 78.12
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10078089 3300009545 Bacteria 3300
2 JGI24746J21847_1001901 3300001977 Bacteria 3330
3 JGI24740J21852_10017869 3300001979 Bacteria 2528
4 JGI24744J21845_10000972 3300002077 Bacteria 5472
5 JGI25405J52794_10022108 3300003911 Bacteria 1288
6 Ga0058863_11856111 3300004799 Bacteria 619
7 Ga0065715_10986422 3300005293 Bacteria 549
8 Ga0070658_10018594 3300005327 Bacteria 5565
9 Ga0070683_100968304 3300005329 Bacteria 817
10 Ga0070682_100784194 3300005337 Bacteria 773
11 Ga0070660_100168240 3300005339 Bacteria 1769
12 Ga0070687_100444566 3300005343 Bacteria 861
13 Ga0070661_100069984 3300005344 Bacteria 2580
14 Ga0070668_100594245 3300005347 Bacteria 968
15 Ga0070713_100219898 3300005436 Bacteria 1723
16 Ga0070701_10643915 3300005438 Bacteria 707
17 Ga0070700_100385935 3300005441 Bacteria 1049
18 Ga0070679_101080213 3300005530 Bacteria 747
19 Ga0068853_101045936 3300005539 Bacteria 787
20 Ga0070686_100797459 3300005544 Bacteria 761
21 Ga0070693_101191750 3300005547 Bacteria 584
22 Ga0070665_100000611 3300005548 Bacteria 48974
23 Ga0068855_100000002 3300005563 Bacteria 616881
24 Ga0068855_100167396 3300005563 Bacteria 2491
25 Ga0068855_101218289 3300005563 Bacteria 782
26 Ga0068855_102289554 3300005563 Bacteria 541
27 Ga0070664_100229151 3300005564 Bacteria 1665
28 Ga0070664_100980589 3300005564 Bacteria 794
29 Ga0068856_101235600 3300005614 Bacteria 763
30 Ga0068856_102100011 3300005614 Bacteria 575
31 Ga0068852_101086965 3300005616 Bacteria 820
32 Ga0068852_102697970 3300005616 Unclassified 516
33 Ga0068859_102593329 3300005617 Bacteria 558
34 Ga0068866_11159618 3300005718 Bacteria 556
35 Ga0068863_100657487 3300005841 Bacteria 1040
36 Ga0081455_10095690 3300005937 Bacteria 2396
37 Ga0081539_10454248 3300005985 Bacteria 531
38 Ga0070717_10191415 3300006028 Bacteria 1787
39 Ga0070712_101039181 3300006175 Bacteria 710
40 Ga0075428_100009144 3300006844 Bacteria 10996
41 Ga0075434_100108294 3300006871 Bacteria 2789
42 Ga0097620_102593013 3300006931 Bacteria 558
43 Ga0105240_10427566 3300009093 Bacteria 1487
44 Ga0105240_12598692 3300009093 Bacteria 523
45 Ga0111539_10005656 3300009094 Bacteria 16167
46 Ga0111539_10994705 3300009094 Bacteria 975
47 Ga0105245_10640694 3300009098 Bacteria 1092
48 Ga0105245_12429290 3300009098 Bacteria 577
49 Ga0114129_12035751 3300009147 Bacteria 694
50 Ga0105243_12051137 3300009148 Bacteria 607
51 Ga0105249_12217384 3300009553 Bacteria 622
52 Ga0105239_10804719 3300010375 Bacteria 1077
53 Ga0105246_10481112 3300011119 Bacteria 1050
54 Ga0157373_10004932 3300013100 Bacteria 10042
55 Ga0157370_10003571 3300013104 Bacteria 18205
56 Ga0157375_11738531 3300013308 Bacteria 739
57 Ga0163163_11584080 3300014325 Bacteria 716
58 Ga0157379_11398557 3300014968 Bacteria 678
59 Ga0197907_10356966 3300020069 Bacteria 1492
60 Ga0206356_11174597 3300020070 Bacteria 1679
61 Ga0206356_11703561 3300020070 Bacteria 987
62 Ga0206351_10007349 3300020077 Bacteria 568
63 Ga0206351_10636577 3300020077 Bacteria 1555
64 Ga0206352_10151202 3300020078 Bacteria 1017
65 Ga0206354_10538960 3300020081 Bacteria 662
66 Ga0206353_11685433 3300020082 Bacteria 1114
67 Ga0213873_10277772 3300021358 Bacteria 536
68 Ga0224712_10066803 3300022467 Bacteria 1449
69 Ga0224712_10579011 3300022467 Bacteria 547
70 Ga0207705_10126266 3300025909 Bacteria 1902
71 Ga0207707_10353418 3300025912 Bacteria 1266
72 Ga0207695_10165963 3300025913 Bacteria 2136
73 Ga0207662_10311532 3300025918 Bacteria 1049
74 Ga0207649_10565241 3300025920 Bacteria 872
75 Ga0207687_10809339 3300025927 Bacteria 799
76 Ga0207700_10184415 3300025928 Bacteria 1749
77 Ga0207690_10412925 3300025932 Bacteria 1078
78 Ga0207706_10299787 3300025933 Bacteria 1400
79 Ga0207709_11028851 3300025935 Bacteria 674
80 Ga0207679_10729315 3300025945 Bacteria 900
81 Ga0207667_10000005 3300025949 Bacteria 715503
82 Ga0207667_10271750 3300025949 Bacteria 1733
83 Ga0207667_10392074 3300025949 Bacteria 1414
84 Ga0207658_10914929 3300025986 Bacteria 799
85 Ga0207703_10848133 3300026035 Bacteria 874
86 Ga0207678_11878611 3300026067 Bacteria 523
87 Ga0207708_10791355 3300026075 Bacteria 816
88 Ga0207702_10739762 3300026078 Bacteria 970
89 Ga0207702_11376330 3300026078 Bacteria 699
90 Ga0207648_10642945 3300026089 Bacteria 980
91 Ga0207675_100193368 3300026118 Bacteria 1952
92 Ga0207683_10490821 3300026121 Bacteria 1134
93 Ga0207698_10997387 3300026142 Bacteria 848
94 Ga0209813_10165840 3300027866 Bacteria 799
95 Ga0207428_10005462 3300027907 Bacteria 11854
96 Ga0268266_10003698 3300028379 Bacteria 15081
97 Ga0268265_10499855 3300028380 Bacteria 1146
98 Ga0268265_11082743 3300028380 Bacteria 795
99 Ga0268264_10235628 3300028381 Bacteria 1693
100 Ga0307515_10416895 3300028794 Bacteria 964
101 Ga0265325_10018169 3300031241 Bacteria 3899
102 Ga0316577_10637692 3300031733 Unclassified 606
103 Ga0307406_10001464 3300031901 Bacteria 13054
104 Ga0307416_100772822 3300032002 Bacteria 1055
105 Ga0307414_11060383 3300032004 Bacteria 747
106 Ga0373935_1036206 3300035692 Bacteria 610
107 Ga0436364_0044858 3300037853 Bacteria 948
108 Ga0436364_0138952 3300037853 Bacteria 773
109 Ga0436364_0903513 3300037853 Bacteria 798
110 Ga0436364_0976130 3300037853 Bacteria 981
111 Ga0436364_1030209 3300037853 Bacteria 575
112 Ga0436364_1190970 3300037853 Bacteria 957
113 Ga0436364_1375832 3300037853 Bacteria 1497
114 Ga0436365_0162020 3300039437 Bacteria 912
115 Ga0436365_0429222 3300039437 Bacteria 504
116 Ga0436365_0502281 3300039437 Bacteria 1204
117 Ga0436365_0663487 3300039437 Bacteria 610
118 Ga0436365_0926669 3300039437 Bacteria 543
119 Ga0436365_1182599 3300039437 Bacteria 758
120 Ga0436365_1201192 3300039437 Bacteria 575
121 Ga0436365_1360485 3300039437 Bacteria 521
122 Ga0436365_1401849 3300039437 Bacteria 938
123 Ga0436365_1477758 3300039437 Bacteria 506
124 Ga0436365_1716791 3300039437 Bacteria 645
125 Ga0436360_0069595 3300039438 Bacteria 593
126 Ga0436360_0352168 3300039438 Bacteria 1203
127 Ga0436360_0658608 3300039438 Bacteria 1205
128 Ga0436360_0666741 3300039438 Bacteria 744
129 Ga0436360_0911285 3300039438 Bacteria 780
130 Ga0436360_0940128 3300039438 Bacteria 730
131 Ga0436360_0977764 3300039438 Bacteria 774
132 Ga0436360_1073310 3300039438 Bacteria 545
133 Ga0436360_1176189 3300039438 Bacteria 898
134 Ga0436360_1315784 3300039438 Bacteria 2973
135 Ga0436360_1341152 3300039438 Bacteria 582
136 Ga0436361_0162068 3300039447 Bacteria 702
137 Ga0436361_0183515 3300039447 Bacteria 605
138 Ga0436361_0244714 3300039447 Bacteria 695
139 Ga0436361_0614738 3300039447 Bacteria 817
140 Ga0436361_0823857 3300039447 Bacteria 613
141 Ga0436361_1071025 3300039447 Bacteria 701
142 Ga0436361_1079324 3300039447 Unclassified 672
143 Ga0436363_0012513 3300039450 Bacteria 564
144 Ga0436363_0185710 3300039450 Bacteria 624
145 Ga0436363_0455440 3300039450 Bacteria 716
146 Ga0436363_0543537 3300039450 Bacteria 619
147 Ga0436363_0565410 3300039450 Bacteria 517
148 Ga0436363_0929397 3300039450 Bacteria 609
149 Ga0436363_1081890 3300039450 Bacteria 822
150 Ga0436363_1084927 3300039450 Bacteria 928
151 Ga0436363_1525376 3300039450 Bacteria 874
152 Ga0436362_0011287 3300039453 Bacteria 596
153 Ga0436362_0184880 3300039453 Bacteria 628
154 Ga0436362_0979228 3300039453 Bacteria 576
155 Ga0436362_1183761 3300039453 Bacteria 905
156 Ga0436362_1295065 3300039453 Bacteria 597
157 Ga0436362_1305901 3300039453 Bacteria 549
158 Ga0451793_0264442 3300041452 Bacteria 779
159 Ga0451793_1841526 3300041452 Bacteria 654
160 Ga0451804_0119462 3300041463 Bacteria 620
161 Ga0451807_2117955 3300041486 Bacteria 838
162 Ga0451853_0414836 3300041512 Bacteria 756
163 Ga0451853_2852104 3300041512 Bacteria 529
164 Ga0451577_0881689 3300042876 Bacteria 806
165 Ga0466966_0911737 3300044684 Bacteria 530
166 Ga0466961_0385918 3300044693 Bacteria 851
167 Ga0466963_0487086 3300044694 Bacteria 871
168 Ga0466959_1192659 3300045049 Bacteria 506
169 Ga0495592_0728568 3300046454 Unclassified 594
170 Ga0495608_0009221 3300046511 Bacteria 6901
171 Ga0495628_0448094 3300046516 Bacteria 938
172 Ga0495587_0182910 3300046536 Bacteria 1188
173 Ga0495667_0041287 3300046559 Bacteria 3060
174 Ga0495635_0294347 3300046663 Bacteria 1089
175 Ga0495604_0061283 3300047317 Bacteria 2878
176 Ga0495636_0001806 3300047318 Bacteria 8178
177 Ga0495602_0606082 3300048088 Bacteria 753
178 Ga0496101_0373896 3300048904 Bacteria 1121
179 Ga0496104_0426874 3300048907 Bacteria 1237
180 Ga0496105_0152293 3300048908 Bacteria 1900
181 Ga0496105_0179426 3300048908 Bacteria 1734
182 Ga0496105_1092419 3300048908 Bacteria 592
183 Ga0496107_0776922 3300048910 Bacteria 702
184 Ga0496108_0459251 3300048911 Bacteria 1113
185 Ga0496108_0618226 3300048911 Bacteria 943
186 Ga0496109_0151954 3300048912 Bacteria 2168
187 Ga0496109_0554062 3300048912 Bacteria 1085
188 Ga0496109_1117070 3300048912 Bacteria 725
189 Ga0496110_0208131 3300048913 Bacteria 1778
190 Ga0496112_0143378 3300048915 Bacteria 2358
191 Ga0496112_1715076 3300048915 Bacteria 541
192 Ga0496113_1398966 3300048916 Bacteria 542
193 Ga0496114_0015937 3300048917 Bacteria 6049
194 Ga0496115_0244661 3300048918 Bacteria 1478
195 Ga0496115_0305480 3300048918 Bacteria 1303
196 Ga0496115_0333587 3300048918 Bacteria 1239
197 Ga0496121_0031024 3300048924 Bacteria 4895
198 Ga0501306_055715 3300049127 Bacteria 643
199 Ga0501308_000228 3300049128 Bacteria 3248
200 Ga0501309_015444 3300049129 Bacteria 1033
201 Ga0501304_003507 3300049160 Bacteria 1153
202 Ga0501307_000241 3300049162 Bacteria 3269
203 Ga0501311_003275 3300049527 Bacteria 1637
204 Ga0501312_023627 3300049528 Bacteria 927
205 Ga0501315_007482 3300049531 Bacteria 1246
206 Ga0501315_009178 3300049531 Bacteria 1165
207 Ga0501316_002691 3300049532 Bacteria 1666
208 Ga0501317_007794 3300049533 Bacteria 1218
209 Ga0501318_002255 3300049534 Bacteria 1647
210 Ga0501320_000340 3300049536 Bacteria 2592
211 Ga0501321_003907 3300049537 Bacteria 1396
212 Ga0501322_003244 3300049538 Bacteria 1046
213 Ga0501323_050662 3300049539 Bacteria 629
214 Ga0501328_00825 3300049544 Bacteria 1132
215 Ga0501329_00753 3300049545 Bacteria 1256
216 Ga0501032_0812663 3300049569 Bacteria 590
217 Ga0501034_0101286 3300049571 Bacteria 2874
218 Ga0501047_0328438 3300049581 Bacteria 1368
219 Ga0501069_0917646 3300049585 Bacteria 533
220 Ga0501075_1363985 3300049591 Bacteria 537
221 Ga0501076_0450060 3300049592 Bacteria 1060
222 Ga0501077_0743186 3300049593 Bacteria 631
223 Ga0501079_1199896 3300049741 Bacteria 598
224 Ga0501080_0195138 3300049742 Bacteria 1860
225 Ga0501080_1088860 3300049742 Bacteria 690
226 Ga0501035_0734046 3300049822 Bacteria 794
227 nmdc:mga0qj67_1472790_c1 3300050509 Bacteria 524
228 nmdc:mga0qj67_405286_c1 3300050509 Bacteria 1100
229 nmdc:mga08y16_6658_c1 3300050511 Bacteria 12115
230 nmdc:mga0n895_1728966_c1 3300050512 Bacteria 587
231 nmdc:mga0n895_371606_c1 3300050512 Bacteria 1447
232 Ga0495601_0004469 3300053077 Bacteria 8082
233 Ga0495601_0021734 3300053077 Bacteria 3932
234 Ga0495601_0194688 3300053077 Bacteria 1325
235 Ga0495595_0057915 3300053084 Bacteria 1808
236 Ga0495595_0061488 3300053084 Bacteria 1759
237 Ga0495595_0086889 3300053084 Bacteria 1497
238 Ga0495619_0041202 3300053085 Bacteria 3020
239 Ga0495619_0355166 3300053085 Bacteria 1014
240 Ga0495619_0526347 3300053085 Bacteria 812
241 Ga0501084_0021077 3300054114 Bacteria 5436
242 Ga0587073_0070242 3300059492 Bacteria 844
243 Ga0587073_0132625 3300059492 Bacteria 686
244 Ga0587077_147479 3300059493 Bacteria 612
245 Ga0587080_046831 3300059503 Bacteria 805
246 Ga0587082_088502 3300059504 Bacteria 657
247 Ga0587083_0100692 3300059505 Bacteria 719
248 Ga0587085_106087 3300059506 Bacteria 600
249 Ga0587106_139120 3300059605 Bacteria 531
250 Ga0587125_059937 3300059607 Bacteria 555
251 Ga0587101_124964 3300059623 Bacteria 536
252 Ga0587128_058873 3300059630 Bacteria 721
253 Ga0587062_067956 3300059639 Bacteria 639
254 Ga0587111_0200008 3300060346 Bacteria 566
255 Ga0501082_0686815 3300060353 Bacteria 896
256 2673167475 2671180531 Bacteria 9045424
257 Ga0105237_10078089
258 JGI24746J21847_1001901
259 JGI24740J21852_10017869
260 JGI24744J21845_10000972
261 JGI25405J52794_10022108
262 Ga0058863_11856111
263 Ga0065715_10986422
264 Ga0070658_10018594
265 Ga0070683_100968304
266 Ga0070682_100784194
267 Ga0070660_100168240
268 Ga0070687_100444566
269 Ga0070661_100069984
270 Ga0070668_100594245
271 Ga0070713_100219898
272 Ga0070701_10643915
273 Ga0070700_100385935
274 Ga0070679_101080213
275 Ga0068853_101045936
276 Ga0070686_100797459
277 Ga0070693_101191750
278 Ga0070665_100000611
279 Ga0068855_100000002
280 Ga0068855_100167396
281 Ga0068855_101218289
282 Ga0068855_102289554
283 Ga0070664_100229151
284 Ga0070664_100980589
285 Ga0068856_101235600
286 Ga0068856_102100011
287 Ga0068852_101086965
288 Ga0068852_102697970
289 Ga0068859_102593329
290 Ga0068866_11159618
291 Ga0068863_100657487
292 Ga0081455_10095690
293 Ga0081539_10454248
294 Ga0070717_10191415
295 Ga0070712_101039181
296 Ga0075428_100009144
297 Ga0075434_100108294
298 Ga0097620_102593013
299 Ga0105240_10427566
300 Ga0105240_12598692
301 Ga0111539_10005656
302 Ga0111539_10994705
303 Ga0105245_10640694
304 Ga0105245_12429290
305 Ga0114129_12035751
306 Ga0105243_12051137
307 Ga0105249_12217384
308 Ga0105239_10804719
309 Ga0105246_10481112
310 Ga0157373_10004932
311 Ga0157370_10003571
312 Ga0157375_11738531
313 Ga0163163_11584080
314 Ga0157379_11398557
315 Ga0197907_10356966
316 Ga0206356_11174597
317 Ga0206356_11703561
318 Ga0206351_10007349
319 Ga0206351_10636577
320 Ga0206352_10151202
321 Ga0206354_10538960
322 Ga0206353_11685433
323 Ga0213873_10277772
324 Ga0224712_10066803
325 Ga0224712_10579011
326 Ga0207705_10126266
327 Ga0207707_10353418
328 Ga0207695_10165963
329 Ga0207662_10311532
330 Ga0207649_10565241
331 Ga0207687_10809339
332 Ga0207700_10184415
333 Ga0207690_10412925
334 Ga0207706_10299787
335 Ga0207709_11028851
336 Ga0207679_10729315
337 Ga0207667_10000005
338 Ga0207667_10271750
339 Ga0207667_10392074
340 Ga0207658_10914929
341 Ga0207703_10848133
342 Ga0207678_11878611
343 Ga0207708_10791355
344 Ga0207702_10739762
345 Ga0207702_11376330
346 Ga0207648_10642945
347 Ga0207675_100193368
348 Ga0207683_10490821
349 Ga0207698_10997387
350 Ga0209813_10165840
351 Ga0207428_10005462
352 Ga0268266_10003698
353 Ga0268265_10499855
354 Ga0268265_11082743
355 Ga0268264_10235628
356 Ga0307515_10416895
357 Ga0265325_10018169
358 Ga0316577_10637692
359 Ga0307406_10001464
360 Ga0307416_100772822
361 Ga0307414_11060383
362 Ga0373935_1036206
363 Ga0436364_0044858
364 Ga0436364_0138952
365 Ga0436364_0903513
366 Ga0436364_0976130
367 Ga0436364_1030209
368 Ga0436364_1190970
369 Ga0436364_1375832
370 Ga0436365_0162020
371 Ga0436365_0429222
372 Ga0436365_0502281
373 Ga0436365_0663487
374 Ga0436365_0926669
375 Ga0436365_1182599
376 Ga0436365_1201192
377 Ga0436365_1360485
378 Ga0436365_1401849
379 Ga0436365_1477758
380 Ga0436365_1716791
381 Ga0436360_0069595
382 Ga0436360_0352168
383 Ga0436360_0658608
384 Ga0436360_0666741
385 Ga0436360_0911285
386 Ga0436360_0940128
387 Ga0436360_0977764
388 Ga0436360_1073310
389 Ga0436360_1176189
390 Ga0436360_1315784
391 Ga0436360_1341152
392 Ga0436361_0162068
393 Ga0436361_0183515
394 Ga0436361_0244714
395 Ga0436361_0614738
396 Ga0436361_0823857
397 Ga0436361_1071025
398 Ga0436361_1079324
399 Ga0436363_0012513
400 Ga0436363_0185710
401 Ga0436363_0455440
402 Ga0436363_0543537
403 Ga0436363_0565410
404 Ga0436363_0929397
405 Ga0436363_1081890
406 Ga0436363_1084927
407 Ga0436363_1525376
408 Ga0436362_0011287
409 Ga0436362_0184880
410 Ga0436362_0979228
411 Ga0436362_1183761
412 Ga0436362_1295065
413 Ga0436362_1305901
414 Ga0451793_0264442
415 Ga0451793_1841526
416 Ga0451804_0119462
417 Ga0451807_2117955
418 Ga0451853_0414836
419 Ga0451853_2852104
420 Ga0451577_0881689
421 Ga0466966_0911737
422 Ga0466961_0385918
423 Ga0466963_0487086
424 Ga0466959_1192659
425 Ga0495592_0728568
426 Ga0495608_0009221
427 Ga0495628_0448094
428 Ga0495587_0182910
429 Ga0495667_0041287
430 Ga0495635_0294347
431 Ga0495604_0061283
432 Ga0495636_0001806
433 Ga0495602_0606082
434 Ga0496101_0373896
435 Ga0496104_0426874
436 Ga0496105_0152293
437 Ga0496105_0179426
438 Ga0496105_1092419
439 Ga0496107_0776922
440 Ga0496108_0459251
441 Ga0496108_0618226
442 Ga0496109_0151954
443 Ga0496109_0554062
444 Ga0496109_1117070
445 Ga0496110_0208131
446 Ga0496112_0143378
447 Ga0496112_1715076
448 Ga0496113_1398966
449 Ga0496114_0015937
450 Ga0496115_0244661
451 Ga0496115_0305480
452 Ga0496115_0333587
453 Ga0496121_0031024
454 Ga0501306_055715
455 Ga0501308_000228
456 Ga0501309_015444
457 Ga0501304_003507
458 Ga0501307_000241
459 Ga0501311_003275
460 Ga0501312_023627
461 Ga0501315_007482
462 Ga0501315_009178
463 Ga0501316_002691
464 Ga0501317_007794
465 Ga0501318_002255
466 Ga0501320_000340
467 Ga0501321_003907
468 Ga0501322_003244
469 Ga0501323_050662
470 Ga0501328_00825
471 Ga0501329_00753
472 Ga0501032_0812663
473 Ga0501034_0101286
474 Ga0501047_0328438
475 Ga0501069_0917646
476 Ga0501075_1363985
477 Ga0501076_0450060
478 Ga0501077_0743186
479 Ga0501079_1199896
480 Ga0501080_0195138
481 Ga0501080_1088860
482 Ga0501035_0734046
483 nmdc:mga0qj67_1472790_c1
484 nmdc:mga0qj67_405286_c1
485 nmdc:mga08y16_6658_c1
486 nmdc:mga0n895_1728966_c1
487 nmdc:mga0n895_371606_c1
488 Ga0495601_0004469
489 Ga0495601_0021734
490 Ga0495601_0194688
491 Ga0495595_0057915
492 Ga0495595_0061488
493 Ga0495595_0086889
494 Ga0495619_0041202
495 Ga0495619_0355166
496 Ga0495619_0526347
497 Ga0501084_0021077
498 Ga0587073_0070242
499 Ga0587073_0132625
500 Ga0587077_147479
501 Ga0587080_046831
502 Ga0587082_088502
503 Ga0587083_0100692
504 Ga0587085_106087
505 Ga0587106_139120
506 Ga0587125_059937
507 Ga0587101_124964
508 Ga0587128_058873
509 Ga0587062_067956
510 Ga0587111_0200008
511 Ga0501082_0686815
512 2673167475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00252

Ribosomal_L16

Ribosomal protein L16p/L10e

6

147

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lqm-assembly1.cif.gz_J cryo-em structure of a pre-60s ribosomal subunit - state c 0.8329 33 135
8br8-assembly1.cif.gz_LK giardia ribosome in post-t state (a1) 0.8258 33 133
7cpu-assembly1.cif.gz_LI cryo-em structure of 80s ribosome from mouse kidney 0.8252 33 135
7xny-assembly1.cif.gz_LI high resolution cry-em structure of the human 80s ribosome from snord127+/- kasumi-1 cells 0.8219 33 135
7qws-assembly1.cif.gz_I structure of ribosome translating beta-tubulin in complex with ttc5 and nac 0.8206 33 135
ID Description Score Start End Superfamily
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8822 25 136 3.90.1170.10
6gbzM01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8498 25 136 3.90.1170.10
6qulN01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.808 23 136 3.90.1170.10
4kbuQ01 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.8062 28 139 3.90.1170.10
af_Q9Y822_37_214_3.90.1170.10 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Ribosomal protein L16/L10 0.7927 24 134 3.90.1170.10
ID Description Score Start End GO Terms
AF-A0A2H5PR85-F1-model_v4 Ribosomal protein L10e/L16 domain-containing protein 0.9393 27 136 GO:0003735
GO:0005762
GO:0019843
GO:0032543
AF-A0A2R6WWT8-F1-model_v4 Uncharacterized protein 0.864 33 137 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q6VHX4-F1-model_v4 50S ribosomal protein L16 0.8549 31 136 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A0H4T321-F1-model_v4 50S ribosomal protein L16 0.8536 30 136 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625
AF-A0A4Q3XSY2-F1-model_v4 50S ribosomal protein L16 0.8512 33 136 GO:0000049
GO:0003735
GO:0006412
GO:0019843
GO:0022625

Map