F366406

General Info

Members Datasets Scaffolds Average Seq Length
256 155 512 302

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100144936|Ga0068865_1001449362
Length 328
Sequence MAHMRSDAIASKPVSVKESVMRALKLLLCTAAVVAGLASPAFAAVKVVATTEDLAAIAREVGGDRVEVTALAKGYQDPHFVEPKPSFILAVSRADLLVVVGRELEIGWLPTLITSSRNAKIQPGAAGYLDASLNVKILEIPTGQLTRAMGDVHPQGNPHYWLDPGNGRLIAQAVRDRLTQLDAAGKAVYQQRYDDFDKRLAVAEKRWDAAMAPYKGTKLVTYHRSWPNFMERFGLQVMGYVEPKPGIPPSPSHTLELISDMKAQGVKLIVVEPYFDKKTPAAIAAQIGGTVLELAPSVGGEKTVTDYISLFDYDVKLLQGALKQITGR

Samples

Sample ID Description Type Environment
1 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
95 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
101 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
149 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.08
Nodule 0
Rhizoplane 0.78
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 21.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068865_100144936 3300006881 Bacteria 1795
2 JGI24751J29686_10004831 3300002459 Bacteria 2743
3 Ga0065712_10006750 3300005290 Bacteria 5079
4 Ga0065712_10093423 3300005290 Unclassified 2293
5 Ga0065712_10101694 3300005290 Bacteria 2027
6 Ga0065712_10111839 3300005290 Bacteria 1806
7 Ga0065715_10030729 3300005293 Bacteria 1317
8 Ga0070676_10128749 3300005328 Bacteria 1598
9 Ga0070677_10005418 3300005333 Bacteria 4204
10 Ga0070682_100155335 3300005337 Unclassified 1574
11 Ga0070689_100004813 3300005340 Bacteria 9159
12 Ga0070689_100067820 3300005340 Unclassified 2782
13 Ga0070675_100274878 3300005354 Bacteria 1479
14 Ga0070671_100177983 3300005355 Bacteria 1800
15 Ga0070674_100006460 3300005356 Bacteria 6843
16 Ga0070673_100012620 3300005364 Bacteria 5807
17 Ga0070673_100373938 3300005364 Bacteria 1269
18 Ga0070688_100030083 3300005365 Unclassified 3256
19 Ga0070688_100063483 3300005365 Bacteria 2341
20 Ga0070667_100000241 3300005367 Bacteria 62038
21 Ga0070713_100171707 3300005436 Bacteria 1943
22 Ga0070701_10021651 3300005438 Unclassified 3071
23 Ga0070705_100349511 3300005440 Bacteria 1077
24 Ga0070694_100026428 3300005444 Archaea 3761
25 Ga0070708_100455368 3300005445 Unclassified 1207
26 Ga0068867_100114960 3300005459 Bacteria 2072
27 Ga0070685_10006281 3300005466 Bacteria 6055
28 Ga0070685_10021925 3300005466 Bacteria 3476
29 Ga0070706_100202126 3300005467 Unclassified 1856
30 Ga0070707_100461550 3300005468 Unclassified 1231
31 Ga0070698_100022903 3300005471 Bacteria 6531
32 Ga0070698_100179623 3300005471 Bacteria 2055
33 Ga0070699_100019639 3300005518 Bacteria 5822
34 Ga0070699_100292270 3300005518 Unclassified 1461
35 Ga0070672_100132599 3300005543 Bacteria 2049
36 Ga0070704_100424169 3300005549 Unclassified 1140
37 Ga0068857_100182150 3300005577 Bacteria 1912
38 Ga0068852_100365075 3300005616 Bacteria 1413
39 Ga0068859_100003521 3300005617 Bacteria 15940
40 Ga0068864_100081703 3300005618 Bacteria 2833
41 Ga0068858_100096405 3300005842 Bacteria 2756
42 Ga0070717_10222368 3300006028 Unclassified 1660
43 Ga0075365_10093531 3300006038 Unclassified 2051
44 Ga0075368_10027665 3300006042 Unclassified 2189
45 Ga0075364_10094604 3300006051 Bacteria 1986
46 Ga0075362_10006828 3300006177 Bacteria 4273
47 Ga0075366_10013405 3300006195 Bacteria 4666
48 Ga0097621_100126155 3300006237 Unclassified 2174
49 Ga0068871_100174198 3300006358 Bacteria 1846
50 Ga0068871_100507009 3300006358 Bacteria 1088
51 Ga0075428_100000056 3300006844 Bacteria 89990
52 Ga0075428_100002102 3300006844 Bacteria 21471
53 Ga0075428_100052025 3300006844 Bacteria 4491
54 Ga0075430_100016386 3300006846 Bacteria 6311
55 Ga0075431_100016804 3300006847 Bacteria 7432
56 Ga0075431_100594318 3300006847 Bacteria 1091
57 Ga0075433_10526426 3300006852 Bacteria 1040
58 Ga0075429_100002201 3300006880 Bacteria 16306
59 Ga0097620_100003521 3300006931 Bacteria 15940
60 Ga0097620_100457158 3300006931 Bacteria 1373
61 Ga0075435_100063540 3300007076 Unclassified 2998
62 Ga0075435_100197237 3300007076 Bacteria 1705
63 Ga0111539_10000002 3300009094 Bacteria 983359
64 Ga0111539_10000159 3300009094 Bacteria 76817
65 Ga0111539_10006554 3300009094 Bacteria 15005
66 Ga0111539_10013592 3300009094 Bacteria 10175
67 Ga0111539_10032609 3300009094 Bacteria 6324
68 Ga0111539_10072391 3300009094 Unclassified 4065
69 Ga0111539_10309568 3300009094 Unclassified 1838
70 Ga0114129_10000023 3300009147 Bacteria 116820
71 Ga0114129_10003099 3300009147 Bacteria 23319
72 Ga0114129_10038400 3300009147 Bacteria 6755
73 Ga0105248_10127167 3300009177 Bacteria 2875
74 Ga0105248_10168184 3300009177 Bacteria 2471
75 Ga0105248_10354977 3300009177 Bacteria 1651
76 Ga0105248_10507020 3300009177 Unclassified 1360
77 Ga0105249_10199037 3300009553 Bacteria 1960
78 Ga0105239_10044363 3300010375 Unclassified 4875
79 Ga0157369_10093991 3300013105 Unclassified 3201
80 Ga0157378_10236384 3300013297 Bacteria 1744
81 Ga0157375_10356227 3300013308 Bacteria 1629
82 Ga0163163_10034484 3300014325 Bacteria 4902
83 Ga0163163_10349391 3300014325 Bacteria 1535
84 Ga0157380_10013473 3300014326 Bacteria 5962
85 Ga0157380_10102235 3300014326 Unclassified 2389
86 Ga0157380_10104388 3300014326 Bacteria 2367
87 Ga0157380_10172139 3300014326 Bacteria 1893
88 Ga0157380_10237468 3300014326 Bacteria 1641
89 Ga0157376_10041955 3300014969 Unclassified 3749
90 Ga0207647_10044524 3300025904 Unclassified 2772
91 Ga0207684_10166274 3300025910 Unclassified 1901
92 Ga0207660_10187423 3300025917 Bacteria 1609
93 Ga0207650_10392511 3300025925 Bacteria 1147
94 Ga0207700_10140008 3300025928 Unclassified 1987
95 Ga0207644_10071543 3300025931 Bacteria 2538
96 Ga0207706_10023354 3300025933 Bacteria 5554
97 Ga0207686_10346802 3300025934 Bacteria 1117
98 Ga0207670_10020624 3300025936 Bacteria 4054
99 Ga0207670_10064805 3300025936 Bacteria 2506
100 Ga0207691_10047586 3300025940 Bacteria 3935
101 Ga0207711_10077003 3300025941 Bacteria 2906
102 Ga0207651_10008569 3300025960 Bacteria 5532
103 Ga0207658_10040571 3300025986 Bacteria 3366
104 Ga0207703_10081433 3300026035 Bacteria 2699
105 Ga0207708_10050720 3300026075 Bacteria 3159
106 Ga0207708_10205990 3300026075 Bacteria 1571
107 Ga0207683_10289889 3300026121 Bacteria 1496
108 Ga0207683_10405897 3300026121 Bacteria 1254
109 Ga0207428_10000004 3300027907 Bacteria 727800
110 Ga0207428_10005911 3300027907 Bacteria 11332
111 Ga0207428_10007840 3300027907 Bacteria 9713
112 Ga0207428_10009089 3300027907 Bacteria 8934
113 Ga0207428_10176126 3300027907 Bacteria 1618
114 Ga0307513_10006796 3300031456 Bacteria 14918
115 Ga0307405_10055817 3300031731 Bacteria 2474
116 Ga0307406_10129874 3300031901 Unclassified 1767
117 Ga0307409_100127580 3300031995 Unclassified 2167
118 Ga0307409_100263142 3300031995 Unclassified 1584
119 Ga0307409_100290118 3300031995 Bacteria 1517
120 Ga0307411_10146849 3300032005 Bacteria 1747
121 Ga0373953_0028851 3300035117 Unclassified 2143
122 Ga0373954_0007706 3300035118 Bacteria 4713
123 Ga0316574_0053913 3300035398 Bacteria 2511
124 Ga0373935_0381897 3300035692 Unclassified 1009
125 Ga0373937_0021200 3300036401 Bacteria 5831
126 Ga0395900_0392469 3300037418 Bacteria 1354
127 Ga0395905_0077940 3300037471 Bacteria 3105
128 Ga0395905_0162273 3300037471 Bacteria 2100
129 Ga0451576_0020829 3300045051 Bacteria 7136
130 Ga0451576_0032553 3300045051 Bacteria 5549
131 Ga0451576_0085500 3300045051 Bacteria 3281
132 Ga0451576_0105260 3300045051 Bacteria 2935
133 Ga0451576_0454131 3300045051 Bacteria 1345
134 Ga0495603_0022932 3300046455 Unclassified 3778
135 Ga0495629_0025888 3300046459 Bacteria 4168
136 Ga0495638_0002027 3300046460 Bacteria 17231
137 Ga0495638_0014080 3300046460 Bacteria 5417
138 Ga0495594_0032346 3300046499 Bacteria 2839
139 Ga0495587_0037946 3300046536 Unclassified 2891
140 Ga0495598_0009962 3300046537 Bacteria 2262
141 Ga0495598_0036787 3300046537 Bacteria 1409
142 Ga0495659_0003868 3300046664 Bacteria 4755
143 Ga0495659_0011395 3300046664 Unclassified 2865
144 Ga0495659_0012217 3300046664 Unclassified 2778
145 Ga0495588_0014854 3300046674 Bacteria 3737
146 Ga0495658_0044749 3300046683 Unclassified 2481
147 Ga0495581_0251262 3300047315 Unclassified 1034
148 Ga0495604_0151088 3300047317 Bacteria 1650
149 Ga0495636_0121109 3300047318 Unclassified 1157
150 Ga0495672_0020847 3300047320 Bacteria 4287
151 Ga0495676_0025407 3300047321 Bacteria 5115
152 Ga0495676_0128650 3300047321 Bacteria 1832
153 Ga0496109_0459576 3300048912 Bacteria 1202
154 Ga0496110_0117700 3300048913 Unclassified 2393
155 Ga0501031_0189139 3300049568 Bacteria 1344
156 Ga0501032_0011110 3300049569 Bacteria 6471
157 Ga0501032_0073954 3300049569 Bacteria 2270
158 Ga0501033_0085734 3300049570 Bacteria 2306
159 Ga0501034_0009076 3300049571 Bacteria 10443
160 Ga0501034_0011593 3300049571 Bacteria 9129
161 Ga0501034_0406107 3300049571 Bacteria 1284
162 Ga0501036_0006748 3300049572 Bacteria 9331
163 Ga0501036_0024759 3300049572 Bacteria 5060
164 Ga0501036_0054156 3300049572 Bacteria 3397
165 Ga0501036_0203406 3300049572 Unclassified 1665
166 Ga0501037_0058034 3300049573 Bacteria 2825
167 Ga0501037_0082117 3300049573 Bacteria 2335
168 Ga0501037_0148974 3300049573 Unclassified 1673
169 Ga0501038_0059314 3300049574 Unclassified 3278
170 Ga0501038_0124921 3300049574 Bacteria 2118
171 Ga0501039_0012530 3300049575 Bacteria 6477
172 Ga0501039_0078953 3300049575 Bacteria 2560
173 Ga0501039_0121580 3300049575 Unclassified 2046
174 Ga0501040_0001124 3300049576 Bacteria 16954
175 Ga0501040_0027184 3300049576 Bacteria 3851
176 Ga0501041_0035160 3300049577 Unclassified 3035
177 Ga0501042_0077088 3300049578 Unclassified 2386
178 Ga0501043_0038175 3300049579 Bacteria 3776
179 Ga0501043_0043343 3300049579 Bacteria 3537
180 Ga0501043_0081547 3300049579 Bacteria 2542
181 Ga0501043_0089863 3300049579 Unclassified 2414
182 Ga0501046_0014569 3300049580 Bacteria 6627
183 Ga0501046_0038165 3300049580 Unclassified 3857
184 Ga0501046_0198087 3300049580 Unclassified 1495
185 Ga0501047_0001543 3300049581 Bacteria 22532
186 Ga0501047_0034093 3300049581 Bacteria 4915
187 Ga0501047_0084912 3300049581 Bacteria 3042
188 Ga0501048_0043344 3300049582 Bacteria 3221
189 Ga0501067_0091535 3300049583 Bacteria 1688
190 Ga0501068_0059843 3300049584 Bacteria 2313
191 Ga0501069_0034577 3300049585 Bacteria 2783
192 Ga0501069_0131091 3300049585 Unclassified 1435
193 Ga0501070_0376939 3300049586 Bacteria 1149
194 Ga0501071_0013499 3300049587 Bacteria 5568
195 Ga0501072_0015318 3300049588 Bacteria 5881
196 Ga0501072_0016316 3300049588 Bacteria 5698
197 Ga0501072_0036701 3300049588 Bacteria 3843
198 Ga0501073_0073625 3300049589 Bacteria 2378
199 Ga0501073_0208195 3300049589 Bacteria 1351
200 Ga0501075_0015822 3300049591 Bacteria 5424
201 Ga0501076_0000974 3300049592 Bacteria 18753
202 Ga0501076_0005785 3300049592 Bacteria 8920
203 Ga0501076_0311825 3300049592 Bacteria 1290
204 Ga0501077_0092601 3300049593 Unclassified 1915
205 Ga0501233_024468 3300049668 Bacteria 1321
206 Ga0501079_0004897 3300049741 Bacteria 9924
207 Ga0501080_0002989 3300049742 Bacteria 14896
208 Ga0501080_0025129 3300049742 Bacteria 5529
209 Ga0501080_0155241 3300049742 Bacteria 2114
210 Ga0501080_0157685 3300049742 Bacteria 2096
211 Ga0501081_0033050 3300049743 Unclassified 3512
212 Ga0501083_0006136 3300049744 Bacteria 8522
213 Ga0501035_0010869 3300049822 Bacteria 8430
214 Ga0501035_0305117 3300049822 Bacteria 1340
215 Ga0501044_0001751 3300049823 Bacteria 25336
216 Ga0501045_0003210 3300049824 Bacteria 11177
217 Ga0501045_0265967 3300049824 Viruses 1277
218 nmdc:mga03683_8633_c1 3300050489 Bacteria 3590
219 nmdc:mga00v17_106015_c1 3300050491 Bacteria 1779
220 nmdc:mga00v17_36870_c1 3300050491 Bacteria 2917
221 nmdc:mga0yw44_31156_c1 3300050492 Bacteria 3098
222 nmdc:mga0k408_20478_c1 3300050493 Bacteria 3706
223 nmdc:mga0k408_56479_c1 3300050493 Unclassified 2278
224 nmdc:mga06z11_6207_c1 3300050494 Bacteria 4844
225 nmdc:mga05p37_300_c1 3300050507 Bacteria 51798
226 nmdc:mga05p37_3248_c1 3300050507 Bacteria 18933
227 nmdc:mga05p37_97045_c1 3300050507 Bacteria 3631
228 nmdc:mga09592_24378_c1 3300050508 Bacteria 5003
229 nmdc:mga09592_296873_c1 3300050508 Bacteria 1401
230 nmdc:mga09592_4121_c1 3300050508 Bacteria 11742
231 nmdc:mga0qj67_7542_c1 3300050509 Bacteria 8038
232 nmdc:mga06r32_13344_c1 3300050510 Bacteria 7441
233 nmdc:mga06r32_444453_c1 3300050510 Bacteria 1276
234 nmdc:mga06r32_80966_c1 3300050510 Unclassified 3161
235 nmdc:mga08y16_12984_c1 3300050511 Bacteria 8765
236 nmdc:mga08y16_1346_c1 3300050511 Bacteria 24536
237 nmdc:mga08y16_18000_c1 3300050511 Bacteria 7441
238 nmdc:mga08y16_232444_c1 3300050511 Unclassified 1907
239 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
240 nmdc:mga08y16_355666_c1 3300050511 Bacteria 1504
241 nmdc:mga08y16_39815_c1 3300050511 Bacteria 4930
242 nmdc:mga08y16_5113_c1 3300050511 Bacteria 13705
243 nmdc:mga0n895_177166_c1 3300050512 Bacteria 2163
244 nmdc:mga0n895_29527_c1 3300050512 Bacteria 5232
245 nmdc:mga0rr50_131145_c1 3300050513 Bacteria 2007
246 nmdc:mga0rr50_39975_c1 3300050513 Bacteria 3406
247 nmdc:mga0a205_37095_c1 3300050515 Bacteria 4687
248 Ga0495601_0134849 3300053077 Unclassified 1609
249 Ga0500568_0033741 3300053139 Unclassified 2098
250 Ga0501084_0007508 3300054114 Bacteria 8988
251 Ga0501084_0012243 3300054114 Bacteria 7102
252 Ga0501084_0215167 3300054114 Bacteria 1621
253 Ga0501082_0000568 3300060353 Bacteria 32870
254 Ga0501082_0201557 3300060353 Bacteria 1731
255 Ga0530510_0002752 3300061734 Bacteria 12078
256 Ga0530510_0026515 3300061734 Bacteria 4149
257 Ga0068865_100144936
258 JGI24751J29686_10004831
259 Ga0065712_10006750
260 Ga0065712_10093423
261 Ga0065712_10101694
262 Ga0065712_10111839
263 Ga0065715_10030729
264 Ga0070676_10128749
265 Ga0070677_10005418
266 Ga0070682_100155335
267 Ga0070689_100004813
268 Ga0070689_100067820
269 Ga0070675_100274878
270 Ga0070671_100177983
271 Ga0070674_100006460
272 Ga0070673_100012620
273 Ga0070673_100373938
274 Ga0070688_100030083
275 Ga0070688_100063483
276 Ga0070667_100000241
277 Ga0070713_100171707
278 Ga0070701_10021651
279 Ga0070705_100349511
280 Ga0070694_100026428
281 Ga0070708_100455368
282 Ga0068867_100114960
283 Ga0070685_10006281
284 Ga0070685_10021925
285 Ga0070706_100202126
286 Ga0070707_100461550
287 Ga0070698_100022903
288 Ga0070698_100179623
289 Ga0070699_100019639
290 Ga0070699_100292270
291 Ga0070672_100132599
292 Ga0070704_100424169
293 Ga0068857_100182150
294 Ga0068852_100365075
295 Ga0068859_100003521
296 Ga0068864_100081703
297 Ga0068858_100096405
298 Ga0070717_10222368
299 Ga0075365_10093531
300 Ga0075368_10027665
301 Ga0075364_10094604
302 Ga0075362_10006828
303 Ga0075366_10013405
304 Ga0097621_100126155
305 Ga0068871_100174198
306 Ga0068871_100507009
307 Ga0075428_100000056
308 Ga0075428_100002102
309 Ga0075428_100052025
310 Ga0075430_100016386
311 Ga0075431_100016804
312 Ga0075431_100594318
313 Ga0075433_10526426
314 Ga0075429_100002201
315 Ga0097620_100003521
316 Ga0097620_100457158
317 Ga0075435_100063540
318 Ga0075435_100197237
319 Ga0111539_10000002
320 Ga0111539_10000159
321 Ga0111539_10006554
322 Ga0111539_10013592
323 Ga0111539_10032609
324 Ga0111539_10072391
325 Ga0111539_10309568
326 Ga0114129_10000023
327 Ga0114129_10003099
328 Ga0114129_10038400
329 Ga0105248_10127167
330 Ga0105248_10168184
331 Ga0105248_10354977
332 Ga0105248_10507020
333 Ga0105249_10199037
334 Ga0105239_10044363
335 Ga0157369_10093991
336 Ga0157378_10236384
337 Ga0157375_10356227
338 Ga0163163_10034484
339 Ga0163163_10349391
340 Ga0157380_10013473
341 Ga0157380_10102235
342 Ga0157380_10104388
343 Ga0157380_10172139
344 Ga0157380_10237468
345 Ga0157376_10041955
346 Ga0207647_10044524
347 Ga0207684_10166274
348 Ga0207660_10187423
349 Ga0207650_10392511
350 Ga0207700_10140008
351 Ga0207644_10071543
352 Ga0207706_10023354
353 Ga0207686_10346802
354 Ga0207670_10020624
355 Ga0207670_10064805
356 Ga0207691_10047586
357 Ga0207711_10077003
358 Ga0207651_10008569
359 Ga0207658_10040571
360 Ga0207703_10081433
361 Ga0207708_10050720
362 Ga0207708_10205990
363 Ga0207683_10289889
364 Ga0207683_10405897
365 Ga0207428_10000004
366 Ga0207428_10005911
367 Ga0207428_10007840
368 Ga0207428_10009089
369 Ga0207428_10176126
370 Ga0307513_10006796
371 Ga0307405_10055817
372 Ga0307406_10129874
373 Ga0307409_100127580
374 Ga0307409_100263142
375 Ga0307409_100290118
376 Ga0307411_10146849
377 Ga0373953_0028851
378 Ga0373954_0007706
379 Ga0316574_0053913
380 Ga0373935_0381897
381 Ga0373937_0021200
382 Ga0395900_0392469
383 Ga0395905_0077940
384 Ga0395905_0162273
385 Ga0451576_0020829
386 Ga0451576_0032553
387 Ga0451576_0085500
388 Ga0451576_0105260
389 Ga0451576_0454131
390 Ga0495603_0022932
391 Ga0495629_0025888
392 Ga0495638_0002027
393 Ga0495638_0014080
394 Ga0495594_0032346
395 Ga0495587_0037946
396 Ga0495598_0009962
397 Ga0495598_0036787
398 Ga0495659_0003868
399 Ga0495659_0011395
400 Ga0495659_0012217
401 Ga0495588_0014854
402 Ga0495658_0044749
403 Ga0495581_0251262
404 Ga0495604_0151088
405 Ga0495636_0121109
406 Ga0495672_0020847
407 Ga0495676_0025407
408 Ga0495676_0128650
409 Ga0496109_0459576
410 Ga0496110_0117700
411 Ga0501031_0189139
412 Ga0501032_0011110
413 Ga0501032_0073954
414 Ga0501033_0085734
415 Ga0501034_0009076
416 Ga0501034_0011593
417 Ga0501034_0406107
418 Ga0501036_0006748
419 Ga0501036_0024759
420 Ga0501036_0054156
421 Ga0501036_0203406
422 Ga0501037_0058034
423 Ga0501037_0082117
424 Ga0501037_0148974
425 Ga0501038_0059314
426 Ga0501038_0124921
427 Ga0501039_0012530
428 Ga0501039_0078953
429 Ga0501039_0121580
430 Ga0501040_0001124
431 Ga0501040_0027184
432 Ga0501041_0035160
433 Ga0501042_0077088
434 Ga0501043_0038175
435 Ga0501043_0043343
436 Ga0501043_0081547
437 Ga0501043_0089863
438 Ga0501046_0014569
439 Ga0501046_0038165
440 Ga0501046_0198087
441 Ga0501047_0001543
442 Ga0501047_0034093
443 Ga0501047_0084912
444 Ga0501048_0043344
445 Ga0501067_0091535
446 Ga0501068_0059843
447 Ga0501069_0034577
448 Ga0501069_0131091
449 Ga0501070_0376939
450 Ga0501071_0013499
451 Ga0501072_0015318
452 Ga0501072_0016316
453 Ga0501072_0036701
454 Ga0501073_0073625
455 Ga0501073_0208195
456 Ga0501075_0015822
457 Ga0501076_0000974
458 Ga0501076_0005785
459 Ga0501076_0311825
460 Ga0501077_0092601
461 Ga0501233_024468
462 Ga0501079_0004897
463 Ga0501080_0002989
464 Ga0501080_0025129
465 Ga0501080_0155241
466 Ga0501080_0157685
467 Ga0501081_0033050
468 Ga0501083_0006136
469 Ga0501035_0010869
470 Ga0501035_0305117
471 Ga0501044_0001751
472 Ga0501045_0003210
473 Ga0501045_0265967
474 nmdc:mga03683_8633_c1
475 nmdc:mga00v17_106015_c1
476 nmdc:mga00v17_36870_c1
477 nmdc:mga0yw44_31156_c1
478 nmdc:mga0k408_20478_c1
479 nmdc:mga0k408_56479_c1
480 nmdc:mga06z11_6207_c1
481 nmdc:mga05p37_300_c1
482 nmdc:mga05p37_3248_c1
483 nmdc:mga05p37_97045_c1
484 nmdc:mga09592_24378_c1
485 nmdc:mga09592_296873_c1
486 nmdc:mga09592_4121_c1
487 nmdc:mga0qj67_7542_c1
488 nmdc:mga06r32_13344_c1
489 nmdc:mga06r32_444453_c1
490 nmdc:mga06r32_80966_c1
491 nmdc:mga08y16_12984_c1
492 nmdc:mga08y16_1346_c1
493 nmdc:mga08y16_18000_c1
494 nmdc:mga08y16_232444_c1
495 nmdc:mga08y16_2_c1
496 nmdc:mga08y16_355666_c1
497 nmdc:mga08y16_39815_c1
498 nmdc:mga08y16_5113_c1
499 nmdc:mga0n895_177166_c1
500 nmdc:mga0n895_29527_c1
501 nmdc:mga0rr50_131145_c1
502 nmdc:mga0rr50_39975_c1
503 nmdc:mga0a205_37095_c1
504 Ga0495601_0134849
505 Ga0500568_0033741
506 Ga0501084_0007508
507 Ga0501084_0012243
508 Ga0501084_0215167
509 Ga0501082_0000568
510 Ga0501082_0201557
511 Ga0530510_0002752
512 Ga0530510_0026515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

47

321

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pq4-assembly1.cif.gz_A crystal structure of znua 0.905 25 302
2ov3-assembly1.cif.gz_A crystal structure of 138-173 znua deletion mutant plus zinc bound 0.9023 25 302
1pq4-assembly1.cif.gz_A crystal structure of znua 0.8916 25 302
2ov3-assembly1.cif.gz_A crystal structure of 138-173 znua deletion mutant plus zinc bound 0.8797 25 302
6ixi-assembly1.cif.gz_A structure of cd-bound periplasmic metal binding protein from candidatus liberibacter asiaticus 0.8785 26 303
ID Description Score Start End Superfamily
4irmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9239 27 190 3.40.50.1980
4oxrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9077 26 177 3.40.50.1980
4udnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9015 27 184 3.40.50.1980
4irmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8937 27 190 3.40.50.1980
1pq4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.8851 25 187 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A2V9BR50-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9862 137 305 GO:0030001
GO:0046872
AF-A0A1Q7RQG4-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.986 140 306 GO:0030001
GO:0046872
AF-A0A2V7GIP9-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9813 153 306 GO:0030001
GO:0046872
AF-A0A2V8HZP4-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9804 25 305 GO:0007155
GO:0030001
GO:0046872
AF-A0A1Q7SYC9-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9803 21 305 GO:0007155
GO:0030001
GO:0046872

Map