F366404

General Info

Members Datasets Scaffolds Average Seq Length
256 152 512 199

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100665387|Ga0075429_1006653872
Length 236
Sequence LFFNKAAEDTSLGYGELHSIRIVHFCGDVYWITIEGVDVFVARNISDIEHAFDRLRGSPVVGCDTETSGLTAKYGKLFSIQFSDGSFNVLIPISEGVAIGKLAEILTDLHIIKIFHNAKFDLEFLSAIDITPRNIFDTMVAEKVLTRGANQSSSLAETLYRYFAVDLDKSQRTKFIRKWNGIWTDELVAYALSDVVHLPRLMSAQNAWLEKLGLTAEYATQMNKVITSDGRPDALL

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
132 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
133 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
143 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
144 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
147 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
148 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
149 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
150 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
151 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
152 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 2.34
Rhizosphere 96.09
Stem 0
Stem Tuber 0
Unclassified 25.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100665387 3300006880 Unclassified 912
2 MBSR1b_contig_10316623 2162886012 Unclassified 858
3 Ga0065712_10169291 3300005290 Unclassified 1221
4 Ga0065715_10145032 3300005293 Bacteria 1800
5 Ga0065707_10105638 3300005295 Bacteria 2635
6 Ga0070658_10001502 3300005327 Bacteria 19810
7 Ga0070676_10092646 3300005328 Bacteria 1854
8 Ga0070690_100010799 3300005330 Bacteria 5326
9 Ga0070670_100176632 3300005331 Bacteria 1853
10 Ga0070670_100236323 3300005331 Bacteria 1591
11 Ga0070677_10054805 3300005333 Unclassified 1625
12 Ga0070666_10015159 3300005335 Bacteria 4915
13 Ga0070680_100098263 3300005336 Bacteria 2428
14 Ga0070680_100142779 3300005336 Bacteria 2008
15 Ga0068868_100006472 3300005338 Bacteria 8291
16 Ga0070689_100065851 3300005340 Bacteria 2822
17 Ga0070689_100070787 3300005340 Bacteria 2724
18 Ga0070669_100573004 3300005353 Unclassified 943
19 Ga0070669_101161687 3300005353 Bacteria 666
20 Ga0070675_100021311 3300005354 Bacteria 5178
21 Ga0070675_100556248 3300005354 Unclassified 1038
22 Ga0070671_100010530 3300005355 Bacteria 7424
23 Ga0070671_100107677 3300005355 Bacteria 2340
24 Ga0070671_100260950 3300005355 Bacteria 1472
25 Ga0070671_100291990 3300005355 Bacteria 1388
26 Ga0070674_100365616 3300005356 Bacteria 1169
27 Ga0070673_100221879 3300005364 Bacteria 1636
28 Ga0070667_100044370 3300005367 Bacteria 3733
29 Ga0070667_100927692 3300005367 Bacteria 811
30 Ga0070705_100738756 3300005440 Bacteria 777
31 Ga0070700_100343668 3300005441 Bacteria 1104
32 Ga0070663_100055602 3300005455 Bacteria 2834
33 Ga0070678_100033172 3300005456 Bacteria 3582
34 Ga0070678_100726811 3300005456 Unclassified 896
35 Ga0070662_100246221 3300005457 Bacteria 1435
36 Ga0070662_100279364 3300005457 Bacteria 1351
37 Ga0070681_10002868 3300005458 Bacteria 15929
38 Ga0070681_10025371 3300005458 Bacteria 5962
39 Ga0068867_100276397 3300005459 Bacteria 1375
40 Ga0070685_10038346 3300005466 Bacteria 2717
41 Ga0070685_10093868 3300005466 Bacteria 1821
42 Ga0070679_100265638 3300005530 Bacteria 1671
43 Ga0070684_100148721 3300005535 Bacteria 2121
44 Ga0068853_100002336 3300005539 Bacteria 14180
45 Ga0068853_100002532 3300005539 Bacteria 13722
46 Ga0068853_100046210 3300005539 Bacteria 3732
47 Ga0068853_100122522 3300005539 Bacteria 2321
48 Ga0068853_100985247 3300005539 Unclassified 811
49 Ga0068853_101154711 3300005539 Bacteria 747
50 Ga0070672_100154245 3300005543 Bacteria 1902
51 Ga0070672_100156479 3300005543 Bacteria 1888
52 Ga0070672_100364991 3300005543 Bacteria 1233
53 Ga0070686_100014402 3300005544 Bacteria 4560
54 Ga0070665_100086297 3300005548 Bacteria 3144
55 Ga0068855_100020637 3300005563 Bacteria 7900
56 Ga0070664_100043922 3300005564 Unclassified 3772
57 Ga0070664_100063316 3300005564 Bacteria 3153
58 Ga0068857_100335844 3300005577 Bacteria 1397
59 Ga0068857_100786501 3300005577 Bacteria 908
60 Ga0068857_100969195 3300005577 Unclassified 818
61 Ga0068854_100653464 3300005578 Unclassified 903
62 Ga0068856_100480123 3300005614 Bacteria 1264
63 Ga0070702_100015598 3300005615 Unclassified 3882
64 Ga0070702_100196259 3300005615 Bacteria 1332
65 Ga0068852_100040214 3300005616 Bacteria 3943
66 Ga0068852_100194984 3300005616 Bacteria 1913
67 Ga0068859_100099876 3300005617 Bacteria 2957
68 Ga0068859_100403835 3300005617 Unclassified 1462
69 Ga0068859_101138885 3300005617 Bacteria 859
70 Ga0068864_100046160 3300005618 Bacteria 3737
71 Ga0068861_100682561 3300005719 Bacteria 952
72 Ga0068861_101082739 3300005719 Unclassified 769
73 Ga0068851_10120601 3300005834 Bacteria 1409
74 Ga0068863_100351488 3300005841 Bacteria 1435
75 Ga0068858_100039437 3300005842 Unclassified 4379
76 Ga0068860_100114908 3300005843 Bacteria 2574
77 Ga0068862_100573200 3300005844 Unclassified 1080
78 Ga0081539_10062285 3300005985 Unclassified 2039
79 Ga0070715_10079847 3300006163 Bacteria 1482
80 Ga0097621_100036189 3300006237 Unclassified 3949
81 Ga0097621_100208652 3300006237 Bacteria 1698
82 Ga0068871_100058913 3300006358 Bacteria 3128
83 Ga0068865_100168971 3300006881 Bacteria 1675
84 Ga0097620_100031940 3300006931 Bacteria 5289
85 Ga0097620_100099885 3300006931 Bacteria 2957
86 Ga0097620_100403829 3300006931 Unclassified 1462
87 Ga0097620_101138853 3300006931 Bacteria 859
88 Ga0105240_11456838 3300009093 Unclassified 719
89 Ga0105245_11170852 3300009098 Unclassified 816
90 Ga0105242_10024301 3300009176 Bacteria 4784
91 Ga0105242_10066736 3300009176 Unclassified 2972
92 Ga0105249_10044145 3300009553 Bacteria 4054
93 Ga0105249_10051083 3300009553 Viruses 3770
94 Ga0157373_10015652 3300013100 Bacteria 5541
95 Ga0157373_10255333 3300013100 Unclassified 1240
96 Ga0157371_10335093 3300013102 Bacteria 1100
97 Ga0157370_10200313 3300013104 Bacteria 1852
98 Ga0157370_10547314 3300013104 Bacteria 1061
99 Ga0157369_10212241 3300013105 Bacteria 2028
100 Ga0157369_10313078 3300013105 Unclassified 1632
101 Ga0157374_10047894 3300013296 Bacteria 3964
102 Ga0157374_10436265 3300013296 Bacteria 1310
103 Ga0157378_10016795 3300013297 Bacteria 6414
104 Ga0157378_10513203 3300013297 Bacteria 1199
105 Ga0157378_11433346 3300013297 Bacteria 734
106 Ga0163162_10015937 3300013306 Bacteria 7344
107 Ga0163162_10432797 3300013306 Bacteria 1448
108 Ga0163162_10882074 3300013306 Unclassified 1008
109 Ga0157372_10009572 3300013307 Bacteria 10300
110 Ga0157372_10389174 3300013307 Bacteria 1624
111 Ga0157372_10656650 3300013307 Bacteria 1221
112 Ga0157372_11411295 3300013307 Unclassified 803
113 Ga0157375_10155106 3300013308 Bacteria 2428
114 Ga0157375_10346934 3300013308 Bacteria 1650
115 Ga0157375_10472775 3300013308 Bacteria 1419
116 Ga0157375_11284221 3300013308 Bacteria 860
117 Ga0163163_10016495 3300014325 Bacteria 6868
118 Ga0163163_10160872 3300014325 Bacteria 2291
119 Ga0163163_10334174 3300014325 Bacteria 1570
120 Ga0163163_10464983 3300014325 Unclassified 1325
121 Ga0157380_10043237 3300014326 Bacteria 3526
122 Ga0157380_10059807 3300014326 Bacteria 3042
123 Ga0157380_10395929 3300014326 Unclassified 1309
124 Ga0157380_11458342 3300014326 Bacteria 736
125 Ga0157379_10032573 3300014968 Bacteria 4647
126 Ga0157376_10052165 3300014969 Bacteria 3399
127 Ga0163161_10001614 3300017792 Bacteria 16602
128 Ga0163161_10028574 3300017792 Bacteria 3961
129 Ga0163161_10116513 3300017792 Unclassified 2003
130 Ga0207656_10077334 3300025321 Bacteria 1490
131 Ga0207682_10221404 3300025893 Unclassified 875
132 Ga0207680_10025656 3300025903 Bacteria 3254
133 Ga0207685_10149490 3300025905 Bacteria 1055
134 Ga0207645_10093558 3300025907 Bacteria 1934
135 Ga0207645_10232537 3300025907 Bacteria 1217
136 Ga0207643_10013847 3300025908 Unclassified 4375
137 Ga0207705_10002257 3300025909 Bacteria 14900
138 Ga0207707_10002766 3300025912 Bacteria 15638
139 Ga0207707_10155480 3300025912 Bacteria 2000
140 Ga0207707_10218943 3300025912 Unclassified 1657
141 Ga0207707_10373043 3300025912 Bacteria 1227
142 Ga0207649_10118269 3300025920 Bacteria 1783
143 Ga0207652_10314806 3300025921 Bacteria 1413
144 Ga0207650_10427597 3300025925 Bacteria 1099
145 Ga0207659_10046585 3300025926 Bacteria 3063
146 Ga0207659_10055638 3300025926 Bacteria 2831
147 Ga0207687_10449496 3300025927 Unclassified 1068
148 Ga0207644_10020319 3300025931 Bacteria 4515
149 Ga0207644_10103054 3300025931 Bacteria 2147
150 Ga0207644_10265365 3300025931 Bacteria 1374
151 Ga0207690_10308113 3300025932 Bacteria 1241
152 Ga0207706_10221137 3300025933 Bacteria 1658
153 Ga0207706_10681524 3300025933 Unclassified 879
154 Ga0207670_10435819 3300025936 Bacteria 1054
155 Ga0207669_10005334 3300025937 Bacteria 5758
156 Ga0207669_10081287 3300025937 Unclassified 2076
157 Ga0207691_10083478 3300025940 Bacteria 2868
158 Ga0207691_10211884 3300025940 Unclassified 1682
159 Ga0207691_10349003 3300025940 Unclassified 1266
160 Ga0207711_10023614 3300025941 Bacteria 5148
161 Ga0207711_10208557 3300025941 Bacteria 1784
162 Ga0207689_10131337 3300025942 Bacteria 2061
163 Ga0207661_11002573 3300025944 Bacteria 769
164 Ga0207667_10059829 3300025949 Bacteria 3988
165 Ga0207667_10507647 3300025949 Bacteria 1222
166 Ga0207712_10080567 3300025961 Bacteria 2369
167 Ga0207712_10173415 3300025961 Bacteria 1688
168 Ga0207640_10010493 3300025981 Bacteria 5219
169 Ga0207658_10615097 3300025986 Bacteria 977
170 Ga0207677_10100624 3300026023 Bacteria 2126
171 Ga0207703_10046183 3300026035 Bacteria 3507
172 Ga0207639_10003252 3300026041 Bacteria 10936
173 Ga0207639_10221753 3300026041 Bacteria 1633
174 Ga0207639_10621961 3300026041 Bacteria 997
175 Ga0207639_10802797 3300026041 Unclassified 877
176 Ga0207678_10074473 3300026067 Bacteria 2909
177 Ga0207678_10221058 3300026067 Bacteria 1621
178 Ga0207702_10506815 3300026078 Bacteria 1177
179 Ga0207641_10020076 3300026088 Bacteria 5485
180 Ga0207641_10361484 3300026088 Unclassified 1386
181 Ga0207676_10394628 3300026095 Bacteria 1291
182 Ga0207676_10467950 3300026095 Bacteria 1191
183 Ga0207676_11060428 3300026095 Bacteria 800
184 Ga0207674_10011030 3300026116 Bacteria 10163
185 Ga0207674_10309281 3300026116 Bacteria 1529
186 Ga0207674_10641602 3300026116 Bacteria 1025
187 Ga0207675_100066235 3300026118 Bacteria 3376
188 Ga0207675_100418239 3300026118 Unclassified 1323
189 Ga0207675_101397363 3300026118 Unclassified 721
190 Ga0207683_10030238 3300026121 Unclassified 4692
191 Ga0207683_10357184 3300026121 Bacteria 1342
192 Ga0207698_10027282 3300026142 Bacteria 4053
193 Ga0207698_10332026 3300026142 Bacteria 1429
194 Ga0207698_10664598 3300026142 Bacteria 1033
195 Ga0209974_10041434 3300027876 Bacteria 1533
196 Ga0268266_10065053 3300028379 Bacteria 3152
197 Ga0268265_10367453 3300028380 Unclassified 1319
198 Ga0268264_10012411 3300028381 Bacteria 7013
199 Ga0268264_10537961 3300028381 Bacteria 1144
200 Ga0307408_100020238 3300031548 Unclassified 4489
201 Ga0307405_10001448 3300031731 Bacteria 9996
202 Ga0307413_10000705 3300031824 Bacteria 11458
203 Ga0307413_10241543 3300031824 Bacteria 1334
204 Ga0307413_10259327 3300031824 Bacteria 1295
205 Ga0307410_10029150 3300031852 Bacteria 3511
206 Ga0307410_10087797 3300031852 Bacteria 2201
207 Ga0307410_10231573 3300031852 Unclassified 1427
208 Ga0307410_10569091 3300031852 Bacteria 941
209 Ga0307406_10006912 3300031901 Bacteria 6285
210 Ga0307406_10050288 3300031901 Bacteria 2642
211 Ga0307406_10103730 3300031901 Unclassified 1942
212 Ga0307407_10001322 3300031903 Bacteria 8866
213 Ga0307407_10122120 3300031903 Bacteria 1653
214 Ga0307412_10265925 3300031911 Unclassified 1340
215 Ga0307409_100026121 3300031995 Unclassified 4113
216 Ga0307409_100046921 3300031995 Bacteria 3274
217 Ga0307409_100119762 3300031995 Unclassified 2226
218 Ga0307416_100064355 3300032002 Bacteria 3008
219 Ga0307416_100877942 3300032002 Bacteria 996
220 Ga0307416_101904940 3300032002 Unclassified 698
221 Ga0307414_10006005 3300032004 Bacteria 6732
222 Ga0307411_10009461 3300032005 Bacteria 5125
223 Ga0307411_10024916 3300032005 Bacteria 3575
224 Ga0307411_10066706 3300032005 Bacteria 2419
225 Ga0307411_10771707 3300032005 Unclassified 844
226 Ga0307415_100079448 3300032126 Bacteria 2337
227 Ga0307415_100090607 3300032126 Unclassified 2212
228 Ga0307415_100328049 3300032126 Bacteria 1279
229 Ga0307415_100367265 3300032126 Bacteria 1217
230 Ga0307415_101281275 3300032126 Unclassified 693
231 Ga0373943_0073448 3300035170 Bacteria 1737
232 Ga0395905_0139773 3300037471 Bacteria 2279
233 Ga0436364_1171170 3300037853 Unclassified 3679
234 Ga0436363_0552717 3300039450 Unclassified 971
235 Ga0451807_0955985 3300041486 Bacteria 750
236 Ga0451849_1324676 3300041505 Unclassified 1770
237 Ga0439432_068589 3300042006 Unclassified 1084
238 Ga0451576_0276207 3300045051 Bacteria 1757
239 Ga0495621_0092425 3300046539 Bacteria 1142
240 Ga0496101_0459727 3300048904 Unclassified 1004
241 Ga0496104_0856034 3300048907 Bacteria 814
242 Ga0496105_0188900 3300048908 Bacteria 1685
243 Ga0496107_0641130 3300048910 Unclassified 783
244 Ga0496114_0019959 3300048917 Bacteria 5437
245 Ga0501072_0011578 3300049588 Bacteria 6739
246 Ga0501209_132620 3300049656 Bacteria 744
247 Ga0501217_179250 3300049661 Unclassified 649
248 Ga0501230_018541 3300049667 Unclassified 1189
249 Ga0501249_002564 3300049679 Bacteria 3664
250 Ga0501259_012464 3300049688 Bacteria 1419
251 Ga0501245_031800 3300049708 Unclassified 875
252 Ga0501263_003361 3300049760 Unclassified 1703
253 Ga0501268_001690 3300049765 Unclassified 2797
254 Ga0501273_000413 3300049770 Unclassified 3395
255 Ga0501274_011378 3300049771 Unclassified 830
256 Ga0500577_0000071 3300053142 Bacteria 23220
257 Ga0075429_100665387
258 MBSR1b_contig_10316623
259 Ga0065712_10169291
260 Ga0065715_10145032
261 Ga0065707_10105638
262 Ga0070658_10001502
263 Ga0070676_10092646
264 Ga0070690_100010799
265 Ga0070670_100176632
266 Ga0070670_100236323
267 Ga0070677_10054805
268 Ga0070666_10015159
269 Ga0070680_100098263
270 Ga0070680_100142779
271 Ga0068868_100006472
272 Ga0070689_100065851
273 Ga0070689_100070787
274 Ga0070669_100573004
275 Ga0070669_101161687
276 Ga0070675_100021311
277 Ga0070675_100556248
278 Ga0070671_100010530
279 Ga0070671_100107677
280 Ga0070671_100260950
281 Ga0070671_100291990
282 Ga0070674_100365616
283 Ga0070673_100221879
284 Ga0070667_100044370
285 Ga0070667_100927692
286 Ga0070705_100738756
287 Ga0070700_100343668
288 Ga0070663_100055602
289 Ga0070678_100033172
290 Ga0070678_100726811
291 Ga0070662_100246221
292 Ga0070662_100279364
293 Ga0070681_10002868
294 Ga0070681_10025371
295 Ga0068867_100276397
296 Ga0070685_10038346
297 Ga0070685_10093868
298 Ga0070679_100265638
299 Ga0070684_100148721
300 Ga0068853_100002336
301 Ga0068853_100002532
302 Ga0068853_100046210
303 Ga0068853_100122522
304 Ga0068853_100985247
305 Ga0068853_101154711
306 Ga0070672_100154245
307 Ga0070672_100156479
308 Ga0070672_100364991
309 Ga0070686_100014402
310 Ga0070665_100086297
311 Ga0068855_100020637
312 Ga0070664_100043922
313 Ga0070664_100063316
314 Ga0068857_100335844
315 Ga0068857_100786501
316 Ga0068857_100969195
317 Ga0068854_100653464
318 Ga0068856_100480123
319 Ga0070702_100015598
320 Ga0070702_100196259
321 Ga0068852_100040214
322 Ga0068852_100194984
323 Ga0068859_100099876
324 Ga0068859_100403835
325 Ga0068859_101138885
326 Ga0068864_100046160
327 Ga0068861_100682561
328 Ga0068861_101082739
329 Ga0068851_10120601
330 Ga0068863_100351488
331 Ga0068858_100039437
332 Ga0068860_100114908
333 Ga0068862_100573200
334 Ga0081539_10062285
335 Ga0070715_10079847
336 Ga0097621_100036189
337 Ga0097621_100208652
338 Ga0068871_100058913
339 Ga0068865_100168971
340 Ga0097620_100031940
341 Ga0097620_100099885
342 Ga0097620_100403829
343 Ga0097620_101138853
344 Ga0105240_11456838
345 Ga0105245_11170852
346 Ga0105242_10024301
347 Ga0105242_10066736
348 Ga0105249_10044145
349 Ga0105249_10051083
350 Ga0157373_10015652
351 Ga0157373_10255333
352 Ga0157371_10335093
353 Ga0157370_10200313
354 Ga0157370_10547314
355 Ga0157369_10212241
356 Ga0157369_10313078
357 Ga0157374_10047894
358 Ga0157374_10436265
359 Ga0157378_10016795
360 Ga0157378_10513203
361 Ga0157378_11433346
362 Ga0163162_10015937
363 Ga0163162_10432797
364 Ga0163162_10882074
365 Ga0157372_10009572
366 Ga0157372_10389174
367 Ga0157372_10656650
368 Ga0157372_11411295
369 Ga0157375_10155106
370 Ga0157375_10346934
371 Ga0157375_10472775
372 Ga0157375_11284221
373 Ga0163163_10016495
374 Ga0163163_10160872
375 Ga0163163_10334174
376 Ga0163163_10464983
377 Ga0157380_10043237
378 Ga0157380_10059807
379 Ga0157380_10395929
380 Ga0157380_11458342
381 Ga0157379_10032573
382 Ga0157376_10052165
383 Ga0163161_10001614
384 Ga0163161_10028574
385 Ga0163161_10116513
386 Ga0207656_10077334
387 Ga0207682_10221404
388 Ga0207680_10025656
389 Ga0207685_10149490
390 Ga0207645_10093558
391 Ga0207645_10232537
392 Ga0207643_10013847
393 Ga0207705_10002257
394 Ga0207707_10002766
395 Ga0207707_10155480
396 Ga0207707_10218943
397 Ga0207707_10373043
398 Ga0207649_10118269
399 Ga0207652_10314806
400 Ga0207650_10427597
401 Ga0207659_10046585
402 Ga0207659_10055638
403 Ga0207687_10449496
404 Ga0207644_10020319
405 Ga0207644_10103054
406 Ga0207644_10265365
407 Ga0207690_10308113
408 Ga0207706_10221137
409 Ga0207706_10681524
410 Ga0207670_10435819
411 Ga0207669_10005334
412 Ga0207669_10081287
413 Ga0207691_10083478
414 Ga0207691_10211884
415 Ga0207691_10349003
416 Ga0207711_10023614
417 Ga0207711_10208557
418 Ga0207689_10131337
419 Ga0207661_11002573
420 Ga0207667_10059829
421 Ga0207667_10507647
422 Ga0207712_10080567
423 Ga0207712_10173415
424 Ga0207640_10010493
425 Ga0207658_10615097
426 Ga0207677_10100624
427 Ga0207703_10046183
428 Ga0207639_10003252
429 Ga0207639_10221753
430 Ga0207639_10621961
431 Ga0207639_10802797
432 Ga0207678_10074473
433 Ga0207678_10221058
434 Ga0207702_10506815
435 Ga0207641_10020076
436 Ga0207641_10361484
437 Ga0207676_10394628
438 Ga0207676_10467950
439 Ga0207676_11060428
440 Ga0207674_10011030
441 Ga0207674_10309281
442 Ga0207674_10641602
443 Ga0207675_100066235
444 Ga0207675_100418239
445 Ga0207675_101397363
446 Ga0207683_10030238
447 Ga0207683_10357184
448 Ga0207698_10027282
449 Ga0207698_10332026
450 Ga0207698_10664598
451 Ga0209974_10041434
452 Ga0268266_10065053
453 Ga0268265_10367453
454 Ga0268264_10012411
455 Ga0268264_10537961
456 Ga0307408_100020238
457 Ga0307405_10001448
458 Ga0307413_10000705
459 Ga0307413_10241543
460 Ga0307413_10259327
461 Ga0307410_10029150
462 Ga0307410_10087797
463 Ga0307410_10231573
464 Ga0307410_10569091
465 Ga0307406_10006912
466 Ga0307406_10050288
467 Ga0307406_10103730
468 Ga0307407_10001322
469 Ga0307407_10122120
470 Ga0307412_10265925
471 Ga0307409_100026121
472 Ga0307409_100046921
473 Ga0307409_100119762
474 Ga0307416_100064355
475 Ga0307416_100877942
476 Ga0307416_101904940
477 Ga0307414_10006005
478 Ga0307411_10009461
479 Ga0307411_10024916
480 Ga0307411_10066706
481 Ga0307411_10771707
482 Ga0307415_100079448
483 Ga0307415_100090607
484 Ga0307415_100328049
485 Ga0307415_100367265
486 Ga0307415_101281275
487 Ga0373943_0073448
488 Ga0395905_0139773
489 Ga0436364_1171170
490 Ga0436363_0552717
491 Ga0451807_0955985
492 Ga0451849_1324676
493 Ga0439432_068589
494 Ga0451576_0276207
495 Ga0495621_0092425
496 Ga0496101_0459727
497 Ga0496104_0856034
498 Ga0496105_0188900
499 Ga0496107_0641130
500 Ga0496114_0019959
501 Ga0501072_0011578
502 Ga0501209_132620
503 Ga0501217_179250
504 Ga0501230_018541
505 Ga0501249_002564
506 Ga0501259_012464
507 Ga0501245_031800
508 Ga0501263_003361
509 Ga0501268_001690
510 Ga0501273_000413
511 Ga0501274_011378
512 Ga0500577_0000071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

39

207

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dku-assembly2.cif.gz_B c-terminal his tagged appol exonuclease mutant 0.8357 3 175
3sag-assembly1.cif.gz_A crystal structure of the human rrp6 catalytic domain with d313n mutation in the active site 0.8346 1 177
1yt3-assembly1.cif.gz_A crystal structure of escherichia coli rnase d, an exoribonuclease involved in structured rna processing 0.8321 1 193
7mpr-assembly2.cif.gz_B brucella melitensis nrnc 0.8293 1 193
7mpt-assembly2.cif.gz_B brucella melitensis nrnc with bound mg2+ 0.8285 2 193
ID Description Score Start End Superfamily
af_Q8ILY1_1321_1641_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8638 3 193 3.30.420.10
af_Q8ILY1_1321_1641_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8472 3 193 3.30.420.10
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8321 1 193 3.30.420.10
af_Q9LZQ8_3_133_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8307 1 101 3.30.420.10
3sahB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8224 3 175 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7W1CBZ4-F1-model_v4 3'-5' exonuclease domain-containing protein 0.9336 6 189 GO:0003676
GO:0006139
GO:0008408
AF-A0A7W1G9U9-F1-model_v4 3'-5' exonuclease domain-containing protein 0.9282 2 189 GO:0003676
GO:0006139
GO:0008408
AF-A0A7W1CBZ4-F1-model_v4 3'-5' exonuclease domain-containing protein 0.9096 6 189 GO:0003676
GO:0006139
GO:0008408
AF-A0A2M8NIQ4-F1-model_v4 3'-5' exonuclease 0.8991 3 108 GO:0000175
GO:0000467
GO:0003727
GO:0071044
GO:0071051
AF-A0A7W1G9U9-F1-model_v4 3'-5' exonuclease domain-containing protein 0.8959 2 189 GO:0003676
GO:0006139
GO:0008408

Map