F366332

General Info

Members Datasets Scaffolds Average Seq Length
256 205 205 101

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_101194634|Ga0070664_1011946342
Length 101
Sequence MADECLHAAGIREVVPSALGCEECLKTGSMWVHLRLCRTCGHVGSSDDSPNRHAKHFHATGHPVVEGYDPPEAWGWCYIDEVVLDLGDRATPQNGPIPRYY

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
3 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
4 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
5 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
6 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
7 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
8 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
9 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
10 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
11 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
12 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
13 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
14 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
15 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
16 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
17 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
18 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
19 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
20 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
21 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
22 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
23 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
24 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
25 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
26 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
27 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
28 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
29 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
30 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
31 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
32 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
33 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
34 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
35 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
36 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
37 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
38 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
39 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
40 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
41 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
42 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
43 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
44 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
45 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
46 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
47 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
48 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
49 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
50 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
129 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
130 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
131 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
132 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
133 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
134 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
185 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
195 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
196 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
198 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
203 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.69
Metatranscriptomes 0.39
Isolates 19.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.94
Nodule 18.75
Rhizoplane 11.33
Rhizosphere 53.12
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100622872 3300005329 Bacteria 1033
2 Ga0070680_100071545 3300005336 Bacteria 2850
3 Ga0070714_101464896 3300005435 Bacteria 667
4 Ga0070713_102281667 3300005436 Bacteria 524
5 Ga0070711_100040313 3300005439 Bacteria 3149
6 Ga0070711_100330507 3300005439 Bacteria 1220
7 Ga0070711_101593675 3300005439 Bacteria 571
8 Ga0070711_101669578 3300005439 Bacteria 558
9 Ga0070681_10034939 3300005458 Bacteria 5049
10 Ga0070681_10048632 3300005458 Bacteria 4238
11 Ga0070698_100555696 3300005471 Bacteria 1087
12 Ga0070679_101134855 3300005530 Bacteria 726
13 Ga0068853_100243215 3300005539 Bacteria 1650
14 Ga0070665_100022168 3300005548 Bacteria 6389
15 Ga0070665_101031095 3300005548 Bacteria 835
16 Ga0070664_101194634 3300005564 Bacteria 717
17 Ga0070664_102244333 3300005564 Bacteria 518
18 Ga0068854_100008528 3300005578 Bacteria 6596
19 Ga0068856_100000413 3300005614 Bacteria 47108
20 Ga0068852_100430181 3300005616 Bacteria 1303
21 Ga0068859_102212789 3300005617 Bacteria 607
22 Ga0068861_101821848 3300005719 Bacteria 604
23 Ga0068862_100014060 3300005844 Bacteria 6639
24 Ga0068862_102660382 3300005844 Unclassified 512
25 Ga0070717_11490060 3300006028 Bacteria 614
26 Ga0070712_101546042 3300006175 Bacteria 580
27 Ga0075428_101654099 3300006844 Bacteria 669
28 Ga0075434_100986417 3300006871 Unclassified 856
29 Ga0097620_102213073 3300006931 Bacteria 607
30 Ga0105240_10360301 3300009093 Bacteria 1647
31 Ga0105240_10853107 3300009093 Bacteria 983
32 Ga0105247_10006995 3300009101 Bacteria 6943
33 Ga0105247_11566131 3300009101 Bacteria 540
34 Ga0105243_10373758 3300009148 Bacteria 1316
35 Ga0105241_10065628 3300009174 Bacteria 2805
36 Ga0105241_12702919 3300009174 Bacteria 500
37 Ga0105242_10877501 3300009176 Bacteria 895
38 Ga0099796_10133961 3300010159 Bacteria 963
39 Ga0157370_10708895 3300013104 Bacteria 918
40 Ga0157369_10001360 3300013105 Bacteria 30196
41 Ga0157378_11727362 3300013297 Bacteria 673
42 Ga0157375_12736256 3300013308 Bacteria 590
43 Ga0163163_10001968 3300014325 Bacteria 17366
44 Ga0163163_10473031 3300014325 Bacteria 1314
45 Ga0163163_10682320 3300014325 Bacteria 1091
46 Ga0157376_10785272 3300014969 Bacteria 964
47 Ga0182007_10092991 3300015262 Bacteria 994
48 Ga0206350_11431390 3300020080 Bacteria 548
49 Ga0213875_10049915 3300021388 Bacteria 1961
50 Ga0213875_10167387 3300021388 Bacteria 1032
51 Ga0209257_1067614 3300025304 Bacteria 952
52 Ga0207699_10179195 3300025906 Bacteria 1423
53 Ga0207645_11054549 3300025907 Bacteria 549
54 Ga0207654_10496315 3300025911 Bacteria 861
55 Ga0207707_10056825 3300025912 Bacteria 3405
56 Ga0207707_10260639 3300025912 Bacteria 1504
57 Ga0207695_10845774 3300025913 Bacteria 795
58 Ga0207693_10617611 3300025915 Bacteria 843
59 Ga0207693_10864887 3300025915 Bacteria 695
60 Ga0207663_10007745 3300025916 Bacteria 5592
61 Ga0207663_10380138 3300025916 Bacteria 1076
62 Ga0207663_11684939 3300025916 Bacteria 510
63 Ga0207660_10228981 3300025917 Bacteria 1461
64 Ga0207700_11724931 3300025928 Bacteria 552
65 Ga0207664_11051381 3300025929 Bacteria 729
66 Ga0207709_10645199 3300025935 Bacteria 842
67 Ga0207669_10339661 3300025937 Bacteria 1156
68 Ga0207661_10603389 3300025944 Bacteria 1008
69 Ga0207640_10618231 3300025981 Bacteria 919
70 Ga0207639_11213758 3300026041 Bacteria 708
71 Ga0207639_12239641 3300026041 Bacteria 508
72 Ga0207698_10571635 3300026142 Bacteria 1111
73 Ga0268266_10395872 3300028379 Bacteria 1305
74 Ga0268265_10012276 3300028380 Bacteria 5806
75 Ga0265318_10000035 3300028577 Bacteria 139989
76 Ga0265329_10126433 3300031242 Bacteria 821
77 Ga0265316_10034545 3300031344 Bacteria 4106
78 Ga0307513_10031296 3300031456 Bacteria 6028
79 Ga0265314_10022065 3300031711 Bacteria 4881
80 Ga0265342_10067531 3300031712 Bacteria 2092
81 Ga0307510_10004140 3300033180 Bacteria 17029
82 Ga0373934_0492753 3300035086 Bacteria 515
83 Ga0373936_0011441 3300035113 Bacteria 3358
84 Ga0373954_0053264 3300035118 Bacteria 1902
85 Ga0373956_0262316 3300035119 Bacteria 822
86 Ga0373943_0986272 3300035170 Bacteria 505
87 Ga0373946_0653441 3300035171 Bacteria 548
88 Ga0373955_0579231 3300035172 Bacteria 687
89 Ga0373931_0470450 3300035691 Unclassified 807
90 Ga0373935_0248541 3300035692 Bacteria 1244
91 Ga0373935_0882289 3300035692 Bacteria 662
92 Ga0373927_0035173 3300035695 Bacteria 3258
93 Ga0373927_0301230 3300035695 Bacteria 1055
94 Ga0373947_0555287 3300035725 Bacteria 782
95 Ga0373937_0105394 3300036401 Bacteria 2620
96 Ga0373937_1336712 3300036401 Bacteria 665
97 Ga0373925_0309022 3300037068 Bacteria 1278
98 Ga0436364_0544858 3300037853 Bacteria 1293
99 Ga0436364_1162316 3300037853 Bacteria 1314
100 Ga0436365_0851760 3300039437 Bacteria 1273
101 Ga0436360_0206247 3300039438 Bacteria 760
102 Ga0436361_0787713 3300039447 Bacteria 1361
103 Ga0436361_1190380 3300039447 Bacteria 3470
104 Ga0436363_0378446 3300039450 Bacteria 1354
105 Ga0436363_0563370 3300039450 Bacteria 548
106 Ga0451839_0393588 3300041496 Bacteria 545
107 Ga0451845_1000182 3300041501 Bacteria 530
108 Ga0439448_0021448 3300042005 Bacteria 2003
109 Ga0466968_0696084 3300044735 Bacteria 519
110 Ga0466959_0052626 3300045049 Bacteria 2981
111 Ga0466959_0160722 3300045049 Bacteria 1580
112 Ga0495629_0353953 3300046459 Bacteria 1001
113 Ga0495651_0168655 3300046462 Bacteria 1561
114 Ga0495580_0043300 3300046472 Bacteria 3204
115 Ga0495580_0783991 3300046472 Bacteria 619
116 Ga0495582_0015156 3300046473 Bacteria 4241
117 Ga0495582_0108226 3300046473 Bacteria 1561
118 Ga0495664_0579070 3300046477 Bacteria 668
119 Ga0495608_0055284 3300046511 Bacteria 2623
120 Ga0495628_0533468 3300046516 Bacteria 844
121 Ga0495652_0287212 3300046529 Bacteria 1202
122 Ga0495665_0036730 3300046531 Bacteria 2615
123 Ga0495645_0481824 3300046543 Bacteria 778
124 Ga0495635_0418982 3300046663 Bacteria 888
125 Ga0495657_0313952 3300046675 Bacteria 932
126 Ga0495658_0099134 3300046683 Bacteria 1736
127 Ga0495600_0417247 3300046809 Bacteria 833
128 Ga0495680_0791172 3300047322 Bacteria 620
129 Ga0495684_0821815 3300047471 Bacteria 605
130 Ga0495686_0145884 3300047472 Bacteria 1393
131 Ga0495686_0345540 3300047472 Bacteria 810
132 Ga0495593_0659629 3300047673 Bacteria 525
133 Ga0496100_0134492 3300048903 Bacteria 1745
134 Ga0496100_0386648 3300048903 Bacteria 1063
135 Ga0496101_0030989 3300048904 Bacteria 3756
136 Ga0496101_0394184 3300048904 Bacteria 1090
137 Ga0496102_0349358 3300048905 Bacteria 1392
138 Ga0496102_1736183 3300048905 Bacteria 542
139 Ga0496104_0002500 3300048907 Bacteria 15822
140 Ga0496105_0000789 3300048908 Bacteria 21424
141 Ga0496105_0158236 3300048908 Bacteria 1860
142 Ga0496105_1182287 3300048908 Bacteria 564
143 Ga0496106_0002037 3300048909 Bacteria 15199
144 Ga0496106_0841374 3300048909 Bacteria 727
145 Ga0496107_0000944 3300048910 Bacteria 17207
146 Ga0496108_0002514 3300048911 Bacteria 14666
147 Ga0496108_0012174 3300048911 Bacteria 6995
148 Ga0496108_1679557 3300048911 Bacteria 523
149 Ga0496109_0000837 3300048912 Bacteria 25676
150 Ga0496109_0001383 3300048912 Bacteria 20107
151 Ga0496109_1334502 3300048912 Bacteria 653
152 Ga0496110_0073435 3300048913 Bacteria 3036
153 Ga0496110_0705966 3300048913 Bacteria 910
154 Ga0496112_0007428 3300048915 Bacteria 9728
155 Ga0496112_0073517 3300048915 Bacteria 3379
156 Ga0496112_0109053 3300048915 Bacteria 2739
157 Ga0496113_0000408 3300048916 Bacteria 20776
158 Ga0496114_0310066 3300048917 Bacteria 1394
159 Ga0496115_0076141 3300048918 Bacteria 2727
160 Ga0496115_0213777 3300048918 Bacteria 1592
161 Ga0496115_0692183 3300048918 Bacteria 802
162 Ga0496123_0144702 3300048926 Bacteria 1293
163 Ga0501033_0218520 3300049570 Bacteria 1357
164 Ga0501034_0358874 3300049571 Bacteria 1385
165 Ga0501038_0153091 3300049574 Bacteria 1879
166 Ga0501043_0946519 3300049579 Bacteria 615
167 Ga0501047_0006145 3300049581 Bacteria 11288
168 Ga0501068_0194498 3300049584 Bacteria 1285
169 Ga0501072_0192641 3300049588 Bacteria 1626
170 Ga0501073_0002585 3300049589 Bacteria 13527
171 Ga0501073_0805820 3300049589 Bacteria 647
172 Ga0501080_0003161 3300049742 Bacteria 14510
173 Ga0501083_0291174 3300049744 Bacteria 1062
174 Ga0501035_0071252 3300049822 Bacteria 3078
175 Ga0501044_0006612 3300049823 Bacteria 12787
176 nmdc:mga0n895_401654_c1 3300050512 Bacteria 1386
177 nmdc:mga0rr50_333243_c1 3300050513 Unclassified 1274
178 Ga0500578_0006070 3300053086 Bacteria 8118
179 Ga0500644_0072893 3300053088 Bacteria 1242
180 Ga0500644_0227241 3300053088 Bacteria 780
181 Ga0500644_0461124 3300053088 Bacteria 557
182 Ga0500646_0014876 3300053090 Bacteria 2022
183 Ga0500647_0152164 3300053091 Bacteria 1079
184 Ga0500651_0005177 3300053093 Bacteria 7422
185 Ga0500651_0075836 3300053093 Bacteria 2089
186 Ga0500566_0237544 3300053094 Bacteria 895
187 Ga0500641_0080135 3300053096 Bacteria 1385
188 Ga0500555_075862 3300053103 Bacteria 881
189 Ga0500556_0337780 3300053104 Bacteria 585
190 Ga0500595_007462 3300053119 Bacteria 4538
191 Ga0500607_069536 3300053121 Bacteria 1821
192 Ga0500642_0000555 3300053130 Bacteria 11307
193 Ga0500642_0153535 3300053130 Bacteria 1080
194 Ga0500658_0032814 3300053134 Bacteria 2038
195 Ga0500568_0009222 3300053139 Bacteria 4703
196 Ga0500568_0133192 3300053139 Bacteria 923
197 Ga0500577_0102839 3300053142 Bacteria 1170
198 Ga0500588_0000416 3300053146 Bacteria 6711
199 Ga0500588_0006825 3300053146 Bacteria 2608
200 Ga0500604_0001282 3300053151 Bacteria 7034
201 Ga0500604_0007944 3300053151 Bacteria 2814
202 Ga0500622_0277783 3300053156 Bacteria 723
203 Ga0500611_028984 3300053727 Bacteria 1129
204 Ga0500609_002418 3300053731 Bacteria 2659
205 Ga0501082_0191599 3300060353 Bacteria 1778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035119 Ga0373956_0262316 Ga0373956_0262316_183_470 93
2 3300039438 Ga0436360_0206247 Ga0436360_0206247_427_711 93
3 3300044735 Ga0466968_0696084 Ga0466968_0696084_42_329 95
4 3300053088 Ga0500644_0072893 Ga0500644_0072893_664_954 96
5 3300053146 Ga0500588_0000416 Ga0500588_0000416_2002_2292 96
6 iso_pu_bacteria 2687453392 2688596055 97
7 iso_pu_bacteria 2856349417 2856350771 97
8 iso_pu_bacteria 2871495908 2871498804 97
9 iso_pu_bacteria 2878760144 2878763022 97
10 iso_pu_bacteria 2878767105 2878769992 97
11 iso_pu_bacteria 2881155292 2881159435 97
12 iso_pu_bacteria 2881853255 2881855018 97
13 iso_pu_bacteria 2881861095 2881864248 97
14 iso_pu_bacteria 2885318864 2885319740 97
15 iso_pu_bacteria 2885342637 2885343927 97
16 iso_pu_bacteria 2922151315 2922157086 97
17 iso_pu_bacteria 2924784321 2924791035 97
18 iso_pu_bacteria 2937994558 2937997452 97
19 iso_pu_bacteria 2958165035 2958167926 97
20 iso_pu_bacteria 2961127735 2961131136 97
21 iso_pu_bacteria 2961163497 2961166394 97
22 iso_pu_bacteria 2965018300 2965021213 97
23 iso_pu_bacteria 2968171901 2968174795 97
24 iso_pu_bacteria 2970503327 2970504603 97
25 iso_pu_bacteria 2970554993 2970557877 97
26 iso_pu_bacteria 2979808191 2979809241 97
27 iso_pu_bacteria 2987659509 2987662402 97
28 iso_pu_bacteria 2987673487 2987674999 97
29 iso_pu_bacteria 3004188549 3004191453 97
30 iso_pu_bacteria 649633066 649870622 97
31 3300048911 Ga0496108_0012174 Ga0496108_0012174_144_440 98
32 3300048915 Ga0496112_0073517 Ga0496112_0073517_2749_3045 98
33 iso_pu_bacteria 2508501123 2509114154 98
34 iso_pu_bacteria 2791355123 2792747271 98
35 iso_pu_bacteria 2856320880 2856323846 98
36 iso_pu_bacteria 2869162929 2869166591 98
37 iso_pu_bacteria 2869278585 2869284817 98
38 iso_pu_bacteria 2874123672 2874129784 98
39 iso_pu_bacteria 2874139085 2874142863 98
40 iso_pu_bacteria 2878738818 2878741068 98
41 iso_pu_bacteria 2878781027 2878787017 98
42 iso_pu_bacteria 2882632389 2882635244 98
43 iso_pu_bacteria 2888337043 2888343325 98
44 iso_pu_bacteria 2903540706 2903543606 98
45 iso_pu_bacteria 2924718760 2924722211 98
46 iso_pu_bacteria 2924776078 2924778669 98
47 iso_pu_bacteria 2937877337 2937878432 98
48 iso_pu_bacteria 2937972304 2937974338 98
49 iso_pu_bacteria 2958034702 2958041328 98
50 iso_pu_bacteria 2958041894 2958042302 98
51 iso_pu_bacteria 2958084443 2958085705 98
52 iso_pu_bacteria 2958144490 2958147403 98
53 iso_pu_bacteria 2965110997 2965111776 98
54 iso_pu_bacteria 2968016561 2968019156 98
55 iso_pu_bacteria 2970469710 2970472520 98
56 iso_pu_bacteria 2970593180 2970599428 98
57 iso_pu_bacteria 3004289098 3004293051 98
58 iso_pu_bacteria 2979793036 2979800031 99
59 3300005564 Ga0070664_101194634 Ga0070664_1011946342 101
60 3300006028 Ga0070717_11490060 Ga0070717_114900601 101
61 3300009101 Ga0105247_11566131 Ga0105247_115661312 101
62 3300014325 Ga0163163_10001968 Ga0163163_1000196826 101
63 3300026041 Ga0207639_12239641 Ga0207639_122396411 101
64 3300028577 Ga0265318_10000035 Ga0265318_10000035119 101
65 3300035086 Ga0373934_0492753 Ga0373934_0492753_40_345 101
66 3300036401 Ga0373937_1336712 Ga0373937_1336712_250_555 101
67 3300039447 Ga0436361_0787713 Ga0436361_0787713_492_803 101
68 3300041496 Ga0451839_0393588 Ga0451839_0393588_208_519 101
69 3300046472 Ga0495580_0783991 Ga0495580_0783991_182_487 101
70 3300046477 Ga0495664_0579070 Ga0495664_0579070_348_653 101
71 3300046543 Ga0495645_0481824 Ga0495645_0481824_215_520 101
72 3300047471 Ga0495684_0821815 Ga0495684_0821815_277_582 101
73 3300048903 Ga0496100_0386648 Ga0496100_0386648_95_400 101
74 3300048905 Ga0496102_1736183 Ga0496102_1736183_112_417 101
75 3300048907 Ga0496104_0002500 Ga0496104_0002500_1958_2263 101
76 3300048908 Ga0496105_0000789 Ga0496105_0000789_2233_2538 101
77 3300048912 Ga0496109_0001383 Ga0496109_0001383_1412_1717 101
78 3300048918 Ga0496115_0213777 Ga0496115_0213777_525_830 101
79 3300005329 Ga0070683_100622872 Ga0070683_1006228722 102
80 3300005336 Ga0070680_100071545 Ga0070680_1000715454 102
81 3300005435 Ga0070714_101464896 Ga0070714_1014648962 102
82 3300005436 Ga0070713_102281667 Ga0070713_1022816672 102
83 3300005439 Ga0070711_100040313 Ga0070711_1000403134 102
84 3300005439 Ga0070711_100330507 Ga0070711_1003305071 102
85 3300005439 Ga0070711_101593675 Ga0070711_1015936751 102
86 3300005439 Ga0070711_101669578 Ga0070711_1016695782 102
87 3300005458 Ga0070681_10034939 Ga0070681_100349394 102
88 3300005458 Ga0070681_10048632 Ga0070681_100486323 102
89 3300005471 Ga0070698_100555696 Ga0070698_1005556962 102
90 3300005530 Ga0070679_101134855 Ga0070679_1011348551 102
91 3300005539 Ga0068853_100243215 Ga0068853_1002432152 102
92 3300005548 Ga0070665_100022168 Ga0070665_1000221682 102
93 3300005548 Ga0070665_101031095 Ga0070665_1010310952 102
94 3300005564 Ga0070664_102244333 Ga0070664_1022443332 102
95 3300005578 Ga0068854_100008528 Ga0068854_1000085288 102
96 3300005614 Ga0068856_100000413 Ga0068856_10000041342 102
97 3300005616 Ga0068852_100430181 Ga0068852_1004301812 102
98 3300005617 Ga0068859_102212789 Ga0068859_1022127892 102
99 3300005719 Ga0068861_101821848 Ga0068861_1018218481 102
100 3300005844 Ga0068862_100014060 Ga0068862_1000140602 102
101 3300005844 Ga0068862_102660382 Ga0068862_1026603821 102
102 3300006175 Ga0070712_101546042 Ga0070712_1015460422 102
103 3300006844 Ga0075428_101654099 Ga0075428_1016540992 102
104 3300006871 Ga0075434_100986417 Ga0075434_1009864172 102
105 3300006931 Ga0097620_102213073 Ga0097620_1022130732 102
106 3300009093 Ga0105240_10360301 Ga0105240_103603012 102
107 3300009093 Ga0105240_10853107 Ga0105240_108531072 102
108 3300009101 Ga0105247_10006995 Ga0105247_100069956 102
109 3300009148 Ga0105243_10373758 Ga0105243_103737582 102
110 3300009174 Ga0105241_10065628 Ga0105241_100656283 102
111 3300009174 Ga0105241_12702919 Ga0105241_127029191 102
112 3300009176 Ga0105242_10877501 Ga0105242_108775011 102
113 3300010159 Ga0099796_10133961 Ga0099796_101339612 102
114 3300013104 Ga0157370_10708895 Ga0157370_107088952 102
115 3300013105 Ga0157369_10001360 Ga0157369_1000136020 102
116 3300013297 Ga0157378_11727362 Ga0157378_117273622 102
117 3300013308 Ga0157375_12736256 Ga0157375_127362561 102
118 3300014325 Ga0163163_10473031 Ga0163163_104730312 102
119 3300014325 Ga0163163_10682320 Ga0163163_106823202 102
120 3300014969 Ga0157376_10785272 Ga0157376_107852722 102
121 3300015262 Ga0182007_10092991 Ga0182007_100929911 102
122 3300020080 Ga0206350_11431390 Ga0206350_114313901 102
123 3300021388 Ga0213875_10049915 Ga0213875_100499151 102
124 3300021388 Ga0213875_10167387 Ga0213875_101673872 102
125 3300025304 Ga0209257_1067614 Ga0209257_10676142 102
126 3300025906 Ga0207699_10179195 Ga0207699_101791952 102
127 3300025907 Ga0207645_11054549 Ga0207645_110545492 102
128 3300025911 Ga0207654_10496315 Ga0207654_104963153 102
129 3300025912 Ga0207707_10056825 Ga0207707_100568254 102
130 3300025912 Ga0207707_10260639 Ga0207707_102606393 102
131 3300025913 Ga0207695_10845774 Ga0207695_108457741 102
132 3300025915 Ga0207693_10617611 Ga0207693_106176113 102
133 3300025915 Ga0207693_10864887 Ga0207693_108648871 102
134 3300025916 Ga0207663_10007745 Ga0207663_100077453 102
135 3300025916 Ga0207663_10380138 Ga0207663_103801382 102
136 3300025916 Ga0207663_11684939 Ga0207663_116849392 102
137 3300025917 Ga0207660_10228981 Ga0207660_102289811 102
138 3300025928 Ga0207700_11724931 Ga0207700_117249311 102
139 3300025929 Ga0207664_11051381 Ga0207664_110513812 102
140 3300025935 Ga0207709_10645199 Ga0207709_106451992 102
141 3300025937 Ga0207669_10339661 Ga0207669_103396612 102
142 3300025944 Ga0207661_10603389 Ga0207661_106033892 102
143 3300025981 Ga0207640_10618231 Ga0207640_106182312 102
144 3300026041 Ga0207639_11213758 Ga0207639_112137581 102
145 3300026142 Ga0207698_10571635 Ga0207698_105716352 102
146 3300028379 Ga0268266_10395872 Ga0268266_103958722 102
147 3300028380 Ga0268265_10012276 Ga0268265_100122762 102
148 3300031242 Ga0265329_10126433 Ga0265329_101264332 102
149 3300031344 Ga0265316_10034545 Ga0265316_100345454 102
150 3300031456 Ga0307513_10031296 Ga0307513_100312964 102
151 3300031711 Ga0265314_10022065 Ga0265314_100220654 102
152 3300031712 Ga0265342_10067531 Ga0265342_100675312 102
153 3300033180 Ga0307510_10004140 Ga0307510_1000414018 102
154 3300035113 Ga0373936_0011441 Ga0373936_0011441_295_609 102
155 3300035118 Ga0373954_0053264 Ga0373954_0053264_1177_1485 102
156 3300035170 Ga0373943_0986272 Ga0373943_0986272_42_350 102
157 3300035171 Ga0373946_0653441 Ga0373946_0653441_87_395 102
158 3300035172 Ga0373955_0579231 Ga0373955_0579231_23_331 102
159 3300035691 Ga0373931_0470450 Ga0373931_0470450_121_429 102
160 3300035692 Ga0373935_0248541 Ga0373935_0248541_907_1215 102
161 3300035692 Ga0373935_0882289 Ga0373935_0882289_297_605 102
162 3300035695 Ga0373927_0035173 Ga0373927_0035173_2909_3217 102
163 3300035695 Ga0373927_0301230 Ga0373927_0301230_113_421 102
164 3300035725 Ga0373947_0555287 Ga0373947_0555287_64_372 102
165 3300036401 Ga0373937_0105394 Ga0373937_0105394_160_468 102
166 3300037068 Ga0373925_0309022 Ga0373925_0309022_128_436 102
167 3300037853 Ga0436364_0544858 Ga0436364_0544858_329_637 102
168 3300037853 Ga0436364_1162316 Ga0436364_1162316_688_996 102
169 3300039437 Ga0436365_0851760 Ga0436365_0851760_463_771 102
170 3300039447 Ga0436361_1190380 Ga0436361_1190380_3047_3355 102
171 3300039450 Ga0436363_0378446 Ga0436363_0378446_313_687 102
172 3300039450 Ga0436363_0563370 Ga0436363_0563370_99_407 102
173 3300041501 Ga0451845_1000182 Ga0451845_1000182_45_353 102
174 3300042005 Ga0439448_0021448 Ga0439448_0021448_174_482 102
175 3300045049 Ga0466959_0052626 Ga0466959_0052626_1915_2223 102
176 3300045049 Ga0466959_0160722 Ga0466959_0160722_452_760 102
177 3300046459 Ga0495629_0353953 Ga0495629_0353953_683_991 102
178 3300046462 Ga0495651_0168655 Ga0495651_0168655_1194_1502 102
179 3300046472 Ga0495580_0043300 Ga0495580_0043300_879_1187 102
180 3300046473 Ga0495582_0015156 Ga0495582_0015156_2614_2922 102
181 3300046473 Ga0495582_0108226 Ga0495582_0108226_366_674 102
182 3300046511 Ga0495608_0055284 Ga0495608_0055284_1172_1480 102
183 3300046516 Ga0495628_0533468 Ga0495628_0533468_524_832 102
184 3300046529 Ga0495652_0287212 Ga0495652_0287212_291_599 102
185 3300046531 Ga0495665_0036730 Ga0495665_0036730_1296_1604 102
186 3300046663 Ga0495635_0418982 Ga0495635_0418982_408_716 102
187 3300046675 Ga0495657_0313952 Ga0495657_0313952_60_368 102
188 3300046683 Ga0495658_0099134 Ga0495658_0099134_442_750 102
189 3300046809 Ga0495600_0417247 Ga0495600_0417247_383_691 102
190 3300047322 Ga0495680_0791172 Ga0495680_0791172_146_454 102
191 3300047472 Ga0495686_0145884 Ga0495686_0145884_235_543 102
192 3300047472 Ga0495686_0345540 Ga0495686_0345540_85_399 102
193 3300047673 Ga0495593_0659629 Ga0495593_0659629_185_493 102
194 3300048903 Ga0496100_0134492 Ga0496100_0134492_650_958 102
195 3300048904 Ga0496101_0030989 Ga0496101_0030989_1619_1927 102
196 3300048904 Ga0496101_0394184 Ga0496101_0394184_618_926 102
197 3300048905 Ga0496102_0349358 Ga0496102_0349358_422_730 102
198 3300048908 Ga0496105_0158236 Ga0496105_0158236_276_584 102
199 3300048908 Ga0496105_1182287 Ga0496105_1182287_176_484 102
200 3300048909 Ga0496106_0002037 Ga0496106_0002037_9341_9649 102
201 3300048909 Ga0496106_0841374 Ga0496106_0841374_95_403 102
202 3300048910 Ga0496107_0000944 Ga0496107_0000944_7804_8112 102
203 3300048911 Ga0496108_0002514 Ga0496108_0002514_4045_4353 102
204 3300048911 Ga0496108_1679557 Ga0496108_1679557_117_425 102
205 3300048912 Ga0496109_0000837 Ga0496109_0000837_9433_9741 102
206 3300048912 Ga0496109_1334502 Ga0496109_1334502_15_323 102
207 3300048913 Ga0496110_0073435 Ga0496110_0073435_2534_2842 102
208 3300048913 Ga0496110_0705966 Ga0496110_0705966_556_864 102
209 3300048915 Ga0496112_0007428 Ga0496112_0007428_4513_4821 102
210 3300048915 Ga0496112_0109053 Ga0496112_0109053_2038_2346 102
211 3300048916 Ga0496113_0000408 Ga0496113_0000408_16792_17100 102
212 3300048917 Ga0496114_0310066 Ga0496114_0310066_898_1206 102
213 3300048918 Ga0496115_0076141 Ga0496115_0076141_96_404 102
214 3300048918 Ga0496115_0692183 Ga0496115_0692183_334_642 102
215 3300048926 Ga0496123_0144702 Ga0496123_0144702_752_1060 102
216 3300049570 Ga0501033_0218520 Ga0501033_0218520_101_409 102
217 3300049571 Ga0501034_0358874 Ga0501034_0358874_672_980 102
218 3300049574 Ga0501038_0153091 Ga0501038_0153091_464_772 102
219 3300049579 Ga0501043_0946519 Ga0501043_0946519_277_585 102
220 3300049581 Ga0501047_0006145 Ga0501047_0006145_3267_3575 102
221 3300049584 Ga0501068_0194498 Ga0501068_0194498_42_350 102
222 3300049588 Ga0501072_0192641 Ga0501072_0192641_945_1253 102
223 3300049589 Ga0501073_0002585 Ga0501073_0002585_11887_12195 102
224 3300049589 Ga0501073_0805820 Ga0501073_0805820_239_547 102
225 3300049742 Ga0501080_0003161 Ga0501080_0003161_12768_13076 102
226 3300049744 Ga0501083_0291174 Ga0501083_0291174_269_577 102
227 3300049822 Ga0501035_0071252 Ga0501035_0071252_2497_2805 102
228 3300049823 Ga0501044_0006612 Ga0501044_0006612_6438_6746 102
229 3300050512 nmdc:mga0n895_401654_c1 nmdc:mga0n895_401654_c1_788_1096 102
230 3300050513 nmdc:mga0rr50_333243_c1 nmdc:mga0rr50_333243_c1_456_764 102
231 3300053086 Ga0500578_0006070 Ga0500578_0006070_2669_2977 102
232 3300053088 Ga0500644_0227241 Ga0500644_0227241_11_325 102
233 3300053088 Ga0500644_0461124 Ga0500644_0461124_41_355 102
234 3300053090 Ga0500646_0014876 Ga0500646_0014876_1033_1386 102
235 3300053091 Ga0500647_0152164 Ga0500647_0152164_123_431 102
236 3300053093 Ga0500651_0005177 Ga0500651_0005177_5929_6243 102
237 3300053093 Ga0500651_0075836 Ga0500651_0075836_930_1238 102
238 3300053094 Ga0500566_0237544 Ga0500566_0237544_185_493 102
239 3300053096 Ga0500641_0080135 Ga0500641_0080135_920_1234 102
240 3300053103 Ga0500555_075862 Ga0500555_075862_528_842 102
241 3300053104 Ga0500556_0337780 Ga0500556_0337780_250_564 102
242 3300053119 Ga0500595_007462 Ga0500595_007462_704_1018 102
243 3300053121 Ga0500607_069536 Ga0500607_069536_1046_1354 102
244 3300053130 Ga0500642_0000555 Ga0500642_0000555_6528_6842 102
245 3300053130 Ga0500642_0153535 Ga0500642_0153535_531_884 102
246 3300053134 Ga0500658_0032814 Ga0500658_0032814_931_1245 102
247 3300053139 Ga0500568_0009222 Ga0500568_0009222_3504_3818 102
248 3300053139 Ga0500568_0133192 Ga0500568_0133192_413_727 102
249 3300053142 Ga0500577_0102839 Ga0500577_0102839_460_774 102
250 3300053146 Ga0500588_0006825 Ga0500588_0006825_1762_2076 102
251 3300053151 Ga0500604_0001282 Ga0500604_0001282_5904_6212 102
252 3300053151 Ga0500604_0007944 Ga0500604_0007944_1471_1785 102
253 3300053156 Ga0500622_0277783 Ga0500622_0277783_196_510 102
254 3300053727 Ga0500611_028984 Ga0500611_028984_618_932 102
255 3300053731 Ga0500609_002418 Ga0500609_002418_163_477 102
256 3300060353 Ga0501082_0191599 Ga0501082_0191599_1434_1742 102

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

21

86

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9501 1 102
4zux-assembly1.cif.gz_Z saga dub module ubp8/sgf11/sus1/sgf73 bound to ubiqitinated nucleosome 0.8719 33 85
4fip-assembly1.cif.gz_A structure of the saga ubp8(s144n)/sgf11(1-72, delta-znf)/sus1/sgf73 dub module 0.8497 33 85
6aqr-assembly1.cif.gz_A saga dub module ubp8(c146a)/sgf11/sus1/sgf73 bound to monoubiquitin 0.8449 33 85
4fk5-assembly1.cif.gz_A structure of the saga ubp8(s144n)/sgf11/sus1/sgf73 dub module 0.8444 33 85
ID Description Score Start End Superfamily
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9439 1 87 3.30.40.10
2idaA01 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9234 1 87 3.30.40.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9106 34 85 3.30.40.10
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8878 33 86 3.30.40.10
af_I1ME85_192_270_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8816 32 46 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A356HIJ5-F1-model_v4 deleted 1.005 5 68
AF-A0A1Q7VFD7-F1-model_v4 UBP-type domain-containing protein 0.9991 3 67 GO:0008270
AF-A0A7W5Q5D6-F1-model_v4 UBP-type domain-containing protein 0.993 11 102 GO:0008270
AF-G6YHW3-F1-model_v4 UBP-type domain-containing protein 0.987 3 102 GO:0008270
AF-A0A455X523-F1-model_v4 UBP-type domain-containing protein 0.9867 4 97 GO:0008270

Feature Viewer

pLDDT pTM Quality
84.26 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map