F366119

General Info

Members Datasets Scaffolds Average Seq Length
255 178 510 190

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2964326757|2964329801
Length 220
Sequence TVSDYDTPDGSGDTSAGAPGDATAGDATAGGAEPRAENSAEGFALAGVPDEFQRLWTPHRMVYIEHGQQPAKDDCPFCIAPSMDDEHALIVARGTHAFVLLNLFPYNSGHLLVCPYRHVATYDLATPEEVAEIGSLTQTAMRVIRSVSGNDGFNLGMNQGVIAGAGIAAHLHQHIVPRWAQDANFLPIIAKTKALPQLLGDVRRSIADAWPAAGSTPETN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
65 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
75 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
82 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
83 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
86 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
99 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
100 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
101 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
131 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
132 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
133 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
140 2643221553 Microbacterium sp. Root553 Isolate Unclassified
141 2643221575 Microbacterium sp. Root61 Isolate Unclassified
142 2643221616 Leifsonia sp. Root227 Isolate Unclassified
143 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
144 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
145 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
146 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
147 2773857759 Microbacterium sp. 1294 Isolate Unclassified
148 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
149 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
150 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
151 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
152 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
153 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
154 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
155 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
156 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
157 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
158 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
159 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
160 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
161 2919069694 Microbacterium sp. 1154 Isolate Unclassified
162 2919395869 Microbacterium resistens 2980 Isolate Unclassified
163 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
164 2928153084 Leifsonia sp. 563 Isolate Unclassified
165 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
166 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
167 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
168 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
169 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
170 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
171 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
172 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
173 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
174 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
175 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
176 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
177 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
178 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.35
Metatranscriptomes 1.96
Isolates 15.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.78
Bulb 0
Endosphere 14.9
Nodule 0
Rhizoplane 12.94
Rhizosphere 48.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10035991 3300001979 Bacteria 1542
2 JGI24740J21852_10067838 3300001979 Bacteria 964
3 JGI24735J21928_10006755 3300002067 Bacteria 3763
4 JGI25406J46586_10059300 3300003203 Bacteria 1243
5 Ga0006562J51391_1023897 3300003578 Bacteria 2440
6 Ga0006562J51391_1023899 3300003578 Bacteria 890
7 Ga0055532_1004463 3300003758 Bacteria 2108
8 Ga0055527_1000001 3300003760 Bacteria 850044
9 Ga0055529_1000018 3300003763 Bacteria 344344
10 Ga0070658_10000365 3300005327 Bacteria 39392
11 Ga0070658_10012305 3300005327 Bacteria 6869
12 Ga0070658_10568025 3300005327 Bacteria 982
13 Ga0070682_100514818 3300005337 Bacteria 930
14 Ga0070660_100272023 3300005339 Bacteria 1385
15 Ga0070663_100200310 3300005455 Bacteria 1558
16 Ga0068853_100618056 3300005539 Bacteria 1030
17 Ga0070665_100160817 3300005548 Bacteria 2248
18 Ga0068855_100029464 3300005563 Bacteria 6561
19 Ga0068855_100935162 3300005563 Bacteria 914
20 Ga0068856_100028485 3300005614 Bacteria 5455
21 Ga0068863_100295441 3300005841 Bacteria 1571
22 Ga0081539_10015109 3300005985 Bacteria 5648
23 Ga0075365_10052861 3300006038 Bacteria 2689
24 Ga0075365_10404980 3300006038 Bacteria 963
25 Ga0075368_10010768 3300006042 Bacteria 3314
26 Ga0075363_100002664 3300006048 Bacteria 7372
27 Ga0075364_10003633 3300006051 Bacteria 8798
28 Ga0075364_10022728 3300006051 Bacteria 3964
29 Ga0075367_10002639 3300006178 Bacteria 8248
30 Ga0075369_10012620 3300006186 Bacteria 3338
31 Ga0075369_10245070 3300006186 Bacteria 832
32 Ga0075370_10010986 3300006353 Bacteria 4748
33 Ga0105244_10016901 3300009036 Bacteria 4142
34 Ga0105244_10019240 3300009036 Bacteria 3819
35 Ga0105240_10044370 3300009093 Bacteria 5650
36 Ga0105247_10071666 3300009101 Bacteria 2168
37 Ga0105243_10108395 3300009148 Bacteria 2318
38 Ga0105243_10275139 3300009148 Bacteria 1514
39 Ga0105243_10836300 3300009148 Bacteria 910
40 Ga0105248_10004269 3300009177 Bacteria 15813
41 Ga0105237_10024693 3300009545 Bacteria 6148
42 Ga0105237_10095238 3300009545 Bacteria 2966
43 Ga0105238_10177473 3300009551 Bacteria 2107
44 Ga0105238_11361661 3300009551 Bacteria 736
45 Ga0105239_10045998 3300010375 Bacteria 4782
46 Ga0157370_10002771 3300013104 Bacteria 20948
47 Ga0157370_10683834 3300013104 Bacteria 937
48 Ga0157369_10005995 3300013105 Bacteria 14120
49 Ga0157374_10064351 3300013296 Bacteria 3441
50 Ga0163162_10132723 3300013306 Bacteria 2599
51 Ga0157372_10665545 3300013307 Bacteria 1212
52 Ga0157375_11080004 3300013308 Bacteria 939
53 Ga0206354_11607932 3300020081 Bacteria 3332
54 Ga0206353_11246627 3300020082 Bacteria 1334
55 Ga0206353_11622923 3300020082 Bacteria 3039
56 Ga0209672_100006 3300025228 Bacteria 1004497
57 Ga0209147_100819 3300025229 Bacteria 14772
58 Ga0209677_100187 3300025253 Bacteria 50389
59 Ga0209148_1000015 3300025254 Bacteria 850103
60 Ga0209455_1000013 3300025272 Bacteria 850103
61 Ga0207655_1003451 3300025728 Bacteria 11754
62 Ga0207710_10073822 3300025900 Bacteria 1569
63 Ga0207647_10097713 3300025904 Bacteria 1746
64 Ga0207705_10000006 3300025909 Bacteria 657147
65 Ga0207695_10025582 3300025913 Bacteria 6603
66 Ga0207671_10255844 3300025914 Bacteria 1377
67 Ga0207709_10041861 3300025935 Bacteria 2751
68 Ga0207709_10308578 3300025935 Bacteria 1179
69 Ga0207711_10006970 3300025941 Bacteria 9485
70 Ga0207667_10353854 3300025949 Bacteria 1497
71 Ga0207639_10587427 3300026041 Bacteria 1026
72 Ga0207678_11232329 3300026067 Bacteria 662
73 Ga0207702_10159923 3300026078 Bacteria 2056
74 Ga0207702_10544930 3300026078 Bacteria 1134
75 Ga0207641_10039356 3300026088 Bacteria 3954
76 Ga0209813_10050754 3300027866 Bacteria 1295
77 Ga0268266_10095656 3300028379 Bacteria 2609
78 Ga0265338_10017571 3300028800 Bacteria 7702
79 Ga0265320_10038219 3300031240 Bacteria 2410
80 Ga0265325_10015221 3300031241 Bacteria 4329
81 Ga0265340_10049847 3300031247 Bacteria 2032
82 Ga0265339_10052014 3300031249 Bacteria 2233
83 Ga0265316_10040830 3300031344 Bacteria 3718
84 Ga0307513_10160713 3300031456 Bacteria 2140
85 Ga0307406_10004767 3300031901 Bacteria 7386
86 Ga0307406_10877029 3300031901 Bacteria 762
87 Ga0307412_10234946 3300031911 Bacteria 1414
88 Ga0307414_10699190 3300032004 Bacteria 918
89 Ga0395899_0002537 3300037312 Bacteria 14792
90 Ga0395900_0332218 3300037418 Bacteria 1498
91 Ga0395898_0086951 3300037466 Bacteria 3012
92 Ga0451793_0790829 3300041452 Bacteria 959
93 Ga0451793_1437263 3300041452 Bacteria 868
94 Ga0451807_1648805 3300041486 Bacteria 699
95 Ga0451837_1195851 3300041494 Bacteria 967
96 Ga0466965_0219987 3300044683 Bacteria 1012
97 Ga0466970_0000454 3300044765 Bacteria 20164
98 Ga0466970_0030520 3300044765 Bacteria 2843
99 Ga0466970_0177064 3300044765 Bacteria 1183
100 Ga0466960_0261411 3300044901 Bacteria 964
101 Ga0466967_0473087 3300045976 Bacteria 1227
102 Ga0495670_0226068 3300046691 Bacteria 995
103 Ga0496100_0014858 3300048903 Bacteria 4531
104 Ga0496100_0468190 3300048903 Bacteria 968
105 Ga0496101_0002593 3300048904 Bacteria 11108
106 Ga0496101_0059094 3300048904 Bacteria 2778
107 Ga0496101_0252515 3300048904 Bacteria 1374
108 Ga0496102_0053095 3300048905 Bacteria 3695
109 Ga0496103_0443358 3300048906 Bacteria 833
110 Ga0496104_0104817 3300048907 Bacteria 2710
111 Ga0496104_0229913 3300048907 Bacteria 1767
112 Ga0496105_0059775 3300048908 Bacteria 3145
113 Ga0496105_0156476 3300048908 Bacteria 1871
114 Ga0496105_0158493 3300048908 Bacteria 1858
115 Ga0496105_0501593 3300048908 Bacteria 953
116 Ga0496107_0004710 3300048910 Bacteria 9267
117 Ga0496107_0271241 3300048910 Bacteria 1263
118 Ga0496109_0030410 3300048912 Bacteria 4840
119 Ga0496109_0043759 3300048912 Bacteria 4059
120 Ga0496111_0003836 3300048914 Bacteria 9388
121 Ga0496111_0115396 3300048914 Bacteria 1980
122 Ga0496112_0043686 3300048915 Bacteria 4388
123 Ga0496112_0401866 3300048915 Bacteria 1310
124 Ga0496113_0003897 3300048916 Bacteria 9042
125 Ga0496113_0110483 3300048916 Bacteria 2139
126 Ga0496114_0006901 3300048917 Bacteria 8945
127 Ga0496114_0057790 3300048917 Bacteria 3238
128 Ga0496114_0262995 3300048917 Bacteria 1519
129 Ga0496114_0399430 3300048917 Bacteria 1217
130 Ga0496115_0109404 3300048918 Bacteria 2269
131 Ga0496115_0161408 3300048918 Bacteria 1852
132 Ga0496115_0177448 3300048918 Bacteria 1761
133 Ga0496117_0000128 3300048920 Bacteria 166039
134 Ga0496117_0001311 3300048920 Bacteria 36601
135 Ga0496117_0002691 3300048920 Bacteria 21963
136 Ga0496117_0016448 3300048920 Bacteria 6244
137 Ga0496118_0007657 3300048921 Bacteria 11371
138 Ga0496118_0021380 3300048921 Bacteria 5697
139 Ga0496118_0110986 3300048921 Bacteria 1820
140 Ga0496118_0153362 3300048921 Bacteria 1438
141 Ga0496119_0002900 3300048922 Bacteria 18300
142 Ga0496119_0013457 3300048922 Bacteria 6517
143 Ga0496119_0027752 3300048922 Bacteria 3881
144 Ga0496119_0119690 3300048922 Bacteria 1449
145 Ga0496119_0346371 3300048922 Bacteria 721
146 Ga0496120_0001021 3300048923 Bacteria 37451
147 Ga0496120_0002253 3300048923 Bacteria 20131
148 Ga0496120_0009198 3300048923 Bacteria 7041
149 Ga0496121_0340938 3300048924 Bacteria 1002
150 Ga0496122_0000240 3300048925 Bacteria 123001
151 Ga0496122_0002688 3300048925 Bacteria 24738
152 Ga0496122_0003597 3300048925 Bacteria 20193
153 Ga0496122_0021125 3300048925 Bacteria 5842
154 Ga0496123_0000076 3300048926 Bacteria 194050
155 Ga0496123_0003240 3300048926 Bacteria 18522
156 Ga0496123_0071294 3300048926 Bacteria 2168
157 Ga0496124_0002643 3300048927 Bacteria 23026
158 Ga0496124_0005986 3300048927 Bacteria 13424
159 Ga0496124_0095981 3300048927 Bacteria 2409
160 Ga0496125_0000061 3300048928 Bacteria 262739
161 Ga0496125_0025355 3300048928 Bacteria 5431
162 Ga0496125_0028319 3300048928 Bacteria 5064
163 Ga0496126_0009671 3300048929 Bacteria 10217
164 Ga0496126_0043527 3300048929 Bacteria 4141
165 Ga0501032_0332540 3300049569 Bacteria 979
166 Ga0501032_0384317 3300049569 Bacteria 903
167 Ga0501033_0004225 3300049570 Bacteria 11558
168 Ga0501034_0017390 3300049571 Bacteria 7376
169 Ga0501034_0034198 3300049571 Bacteria 5153
170 Ga0501036_0023771 3300049572 Bacteria 5163
171 Ga0501037_0050645 3300049573 Bacteria 3038
172 Ga0501037_0098593 3300049573 Bacteria 2111
173 Ga0501038_0002801 3300049574 Bacteria 16231
174 Ga0501038_0043317 3300049574 Bacteria 3914
175 Ga0501043_0088543 3300049579 Bacteria 2433
176 Ga0501043_0173851 3300049579 Bacteria 1679
177 Ga0501043_0356387 3300049579 Bacteria 1111
178 Ga0501046_0009940 3300049580 Bacteria 8196
179 Ga0501046_0014738 3300049580 Bacteria 6581
180 Ga0501047_0024326 3300049581 Bacteria 5813
181 Ga0501048_0012283 3300049582 Bacteria 6373
182 Ga0501048_0139333 3300049582 Bacteria 1715
183 Ga0501067_0082927 3300049583 Bacteria 1778
184 Ga0501070_0021495 3300049586 Bacteria 5414
185 Ga0501071_0000398 3300049587 Bacteria 21451
186 Ga0501073_0001570 3300049589 Bacteria 16937
187 Ga0501073_0008007 3300049589 Bacteria 7847
188 Ga0501073_0269823 3300049589 Bacteria 1174
189 Ga0501074_0306810 3300049590 Bacteria 1127
190 Ga0501080_0704411 3300049742 Bacteria 890
191 Ga0501083_0005919 3300049744 Bacteria 8654
192 Ga0501083_0737473 3300049744 Bacteria 641
193 Ga0501035_0022323 3300049822 Bacteria 5811
194 Ga0501035_0231212 3300049822 Bacteria 1575
195 Ga0501044_0116761 3300049823 Bacteria 2673
196 Ga0501044_0146254 3300049823 Bacteria 2348
197 nmdc:mga03n38_70225_c1 3300050490 Bacteria 1619
198 nmdc:mga00v17_2037_c1 3300050491 Bacteria 10402
199 nmdc:mga00v17_313594_c1 3300050491 Bacteria 1019
200 nmdc:mga00v17_4121_c1 3300050491 Bacteria 7523
201 nmdc:mga0yw44_23480_c1 3300050492 Bacteria 3475
202 nmdc:mga0yw44_4131_c1 3300050492 Bacteria 6591
203 nmdc:mga06z11_7295_c1 3300050494 Bacteria 4540
204 nmdc:mga04h51_7770_c1 3300050495 Bacteria 2844
205 nmdc:mga07m45_18153_c1 3300050496 Bacteria 3791
206 nmdc:mga0sz30_9815_c1 3300050516 Bacteria 3650
207 Ga0500651_0000344 3300053093 Bacteria 26078
208 Ga0500556_0000141 3300053104 Bacteria 59919
209 Ga0500655_001492 3300053133 Bacteria 4425
210 Ga0500559_0000786 3300053136 Bacteria 20757
211 Ga0500590_004937 3300053148 Bacteria 6372
212 Ga0500616_0000021 3300053153 Bacteria 484527
213 Ga0500616_0069987 3300053153 Bacteria 1792
214 Ga0500620_000020 3300053155 Bacteria 32727
215 Ga0500645_004016 3300053730 Bacteria 5785
216 2964329801 2964326757 Bacteria 3290868
217 2643785801 2643221553 Bacteria 3544260
218 2643885520 2643221575 Bacteria 4022601
219 2644096224 2643221616 Bacteria 4066575
220 2644183440 2643221632 Bacteria 3406696
221 2644503785 2643221690 Bacteria 4654705
222 2758226187 2757320536 Bacteria 3629334
223 2774380562 2773857758 Bacteria 3592392
224 2774384457 2773857759 Bacteria 2963774
225 2808631248 2808606306 Bacteria 3608896
226 2809227326 2808606447 Bacteria 3572005
227 2812323053 2811994872 Bacteria 4121241
228 2844842629 2844841374 Bacteria 3917147
229 2852633295 2852632344 Bacteria 3463163
230 2852645529 2852643534 Bacteria 3013378
231 2857721153 2857720070 Bacteria 3189373
232 2857735737 2857733635 Bacteria 3532004
233 2862996368 2862993130 Bacteria 3860849
234 2904512076 2904509784 Bacteria 3520416
235 2906802977 2906799679 Bacteria 4031749
236 2908680993 2908678064 Bacteria 3482747
237 2919058314 2919055335 Bacteria 3875751
238 2919072537 2919069694 Bacteria 3622919
239 2919399074 2919395869 Bacteria 3704152
240 2928092199 2928090899 Bacteria 3158267
241 2928156385 2928153084 Bacteria 4020257
242 2939661132 2939660829 Bacteria 3784848
243 2945971769 2945968032 Bacteria 4111363
244 2974297097 2974294766 Bacteria 3767688
245 2974326669 2974324384 Bacteria 3750535
246 2977231331 2977228692 Bacteria 3450105
247 2977240112 2977236895 Bacteria 3569373
248 2977253955 2977251589 Bacteria 2952848
249 2984545615 2984542743 Bacteria 3569378
250 2984581028 2984580707 Bacteria 3351387
251 8004214238 8004212874 Bacteria 2861420
252 8016257623 8016254467 Bacteria 3797036
253 8055035946 8055034563 Bacteria 3562128
254 8056037449 8056037122 Bacteria 3854319
255 8057348791 8057345674 Bacteria 4160394
256 JGI24740J21852_10035991
257 JGI24740J21852_10067838
258 JGI24735J21928_10006755
259 JGI25406J46586_10059300
260 Ga0006562J51391_1023897
261 Ga0006562J51391_1023899
262 Ga0055532_1004463
263 Ga0055527_1000001
264 Ga0055529_1000018
265 Ga0070658_10000365
266 Ga0070658_10012305
267 Ga0070658_10568025
268 Ga0070682_100514818
269 Ga0070660_100272023
270 Ga0070663_100200310
271 Ga0068853_100618056
272 Ga0070665_100160817
273 Ga0068855_100029464
274 Ga0068855_100935162
275 Ga0068856_100028485
276 Ga0068863_100295441
277 Ga0081539_10015109
278 Ga0075365_10052861
279 Ga0075365_10404980
280 Ga0075368_10010768
281 Ga0075363_100002664
282 Ga0075364_10003633
283 Ga0075364_10022728
284 Ga0075367_10002639
285 Ga0075369_10012620
286 Ga0075369_10245070
287 Ga0075370_10010986
288 Ga0105244_10016901
289 Ga0105244_10019240
290 Ga0105240_10044370
291 Ga0105247_10071666
292 Ga0105243_10108395
293 Ga0105243_10275139
294 Ga0105243_10836300
295 Ga0105248_10004269
296 Ga0105237_10024693
297 Ga0105237_10095238
298 Ga0105238_10177473
299 Ga0105238_11361661
300 Ga0105239_10045998
301 Ga0157370_10002771
302 Ga0157370_10683834
303 Ga0157369_10005995
304 Ga0157374_10064351
305 Ga0163162_10132723
306 Ga0157372_10665545
307 Ga0157375_11080004
308 Ga0206354_11607932
309 Ga0206353_11246627
310 Ga0206353_11622923
311 Ga0209672_100006
312 Ga0209147_100819
313 Ga0209677_100187
314 Ga0209148_1000015
315 Ga0209455_1000013
316 Ga0207655_1003451
317 Ga0207710_10073822
318 Ga0207647_10097713
319 Ga0207705_10000006
320 Ga0207695_10025582
321 Ga0207671_10255844
322 Ga0207709_10041861
323 Ga0207709_10308578
324 Ga0207711_10006970
325 Ga0207667_10353854
326 Ga0207639_10587427
327 Ga0207678_11232329
328 Ga0207702_10159923
329 Ga0207702_10544930
330 Ga0207641_10039356
331 Ga0209813_10050754
332 Ga0268266_10095656
333 Ga0265338_10017571
334 Ga0265320_10038219
335 Ga0265325_10015221
336 Ga0265340_10049847
337 Ga0265339_10052014
338 Ga0265316_10040830
339 Ga0307513_10160713
340 Ga0307406_10004767
341 Ga0307406_10877029
342 Ga0307412_10234946
343 Ga0307414_10699190
344 Ga0395899_0002537
345 Ga0395900_0332218
346 Ga0395898_0086951
347 Ga0451793_0790829
348 Ga0451793_1437263
349 Ga0451807_1648805
350 Ga0451837_1195851
351 Ga0466965_0219987
352 Ga0466970_0000454
353 Ga0466970_0030520
354 Ga0466970_0177064
355 Ga0466960_0261411
356 Ga0466967_0473087
357 Ga0495670_0226068
358 Ga0496100_0014858
359 Ga0496100_0468190
360 Ga0496101_0002593
361 Ga0496101_0059094
362 Ga0496101_0252515
363 Ga0496102_0053095
364 Ga0496103_0443358
365 Ga0496104_0104817
366 Ga0496104_0229913
367 Ga0496105_0059775
368 Ga0496105_0156476
369 Ga0496105_0158493
370 Ga0496105_0501593
371 Ga0496107_0004710
372 Ga0496107_0271241
373 Ga0496109_0030410
374 Ga0496109_0043759
375 Ga0496111_0003836
376 Ga0496111_0115396
377 Ga0496112_0043686
378 Ga0496112_0401866
379 Ga0496113_0003897
380 Ga0496113_0110483
381 Ga0496114_0006901
382 Ga0496114_0057790
383 Ga0496114_0262995
384 Ga0496114_0399430
385 Ga0496115_0109404
386 Ga0496115_0161408
387 Ga0496115_0177448
388 Ga0496117_0000128
389 Ga0496117_0001311
390 Ga0496117_0002691
391 Ga0496117_0016448
392 Ga0496118_0007657
393 Ga0496118_0021380
394 Ga0496118_0110986
395 Ga0496118_0153362
396 Ga0496119_0002900
397 Ga0496119_0013457
398 Ga0496119_0027752
399 Ga0496119_0119690
400 Ga0496119_0346371
401 Ga0496120_0001021
402 Ga0496120_0002253
403 Ga0496120_0009198
404 Ga0496121_0340938
405 Ga0496122_0000240
406 Ga0496122_0002688
407 Ga0496122_0003597
408 Ga0496122_0021125
409 Ga0496123_0000076
410 Ga0496123_0003240
411 Ga0496123_0071294
412 Ga0496124_0002643
413 Ga0496124_0005986
414 Ga0496124_0095981
415 Ga0496125_0000061
416 Ga0496125_0025355
417 Ga0496125_0028319
418 Ga0496126_0009671
419 Ga0496126_0043527
420 Ga0501032_0332540
421 Ga0501032_0384317
422 Ga0501033_0004225
423 Ga0501034_0017390
424 Ga0501034_0034198
425 Ga0501036_0023771
426 Ga0501037_0050645
427 Ga0501037_0098593
428 Ga0501038_0002801
429 Ga0501038_0043317
430 Ga0501043_0088543
431 Ga0501043_0173851
432 Ga0501043_0356387
433 Ga0501046_0009940
434 Ga0501046_0014738
435 Ga0501047_0024326
436 Ga0501048_0012283
437 Ga0501048_0139333
438 Ga0501067_0082927
439 Ga0501070_0021495
440 Ga0501071_0000398
441 Ga0501073_0001570
442 Ga0501073_0008007
443 Ga0501073_0269823
444 Ga0501074_0306810
445 Ga0501080_0704411
446 Ga0501083_0005919
447 Ga0501083_0737473
448 Ga0501035_0022323
449 Ga0501035_0231212
450 Ga0501044_0116761
451 Ga0501044_0146254
452 nmdc:mga03n38_70225_c1
453 nmdc:mga00v17_2037_c1
454 nmdc:mga00v17_313594_c1
455 nmdc:mga00v17_4121_c1
456 nmdc:mga0yw44_23480_c1
457 nmdc:mga0yw44_4131_c1
458 nmdc:mga06z11_7295_c1
459 nmdc:mga04h51_7770_c1
460 nmdc:mga07m45_18153_c1
461 nmdc:mga0sz30_9815_c1
462 Ga0500651_0000344
463 Ga0500556_0000141
464 Ga0500655_001492
465 Ga0500559_0000786
466 Ga0500590_004937
467 Ga0500616_0000021
468 Ga0500616_0069987
469 Ga0500620_000020
470 Ga0500645_004016
471 2964329801
472 2643785801
473 2643885520
474 2644096224
475 2644183440
476 2644503785
477 2758226187
478 2774380562
479 2774384457
480 2808631248
481 2809227326
482 2812323053
483 2844842629
484 2852633295
485 2852645529
486 2857721153
487 2857735737
488 2862996368
489 2904512076
490 2906802977
491 2908680993
492 2919058314
493 2919072537
494 2919399074
495 2928092199
496 2928156385
497 2939661132
498 2945971769
499 2974297097
500 2974326669
501 2977231331
502 2977240112
503 2977253955
504 2984545615
505 2984581028
506 8004214238
507 8016257623
508 8055035946
509 8056037449
510 8057348791

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

85

181

0.93

PF04677

CwfJ_C_1

Protein similar to CwfJ C-terminus 1

65

185

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6af2-assembly1.cif.gz_C crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.873 69 205
1ems-assembly1.cif.gz_A crystal structure of the c. elegans nitfhit protein 0.8625 85 204
5cs2-assembly1.cif.gz_A-2 crystal structure of plasmodium falciparum diadenosine triphosphate hydrolase in complex with cyclomarin a 0.861 78 203
6af2-assembly1.cif.gz_B-2 crystal structure of n-terminus deletion mutant of mycobacterium avium diadenosine 5',5'''-p1,p4-tetraphosphate phosphorylase 0.8593 69 205
3fit-assembly1.cif.gz_A-2 fhit (fragile histidine triad protein) in complex with adenosine/sulfate amp analog 0.8547 78 205
ID Description Score Start End Superfamily
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8938 84 175 3.30.428.10
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8897 78 173 3.30.428.10
1emsB02 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8607 84 203 3.30.428.10
2fhiA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8507 78 203 3.30.428.10
af_Q0IQH7_1_86_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8294 105 182 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A434TNX9-F1-model_v4 HIT family protein 0.911 84 174 GO:0003824
AF-A0A3A2ZBK7-F1-model_v4 Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) 0.9053 84 177 GO:0000166
GO:0047710
AF-S3DMX6-F1-model_v4 Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) 0.9039 84 177 GO:0000166
GO:0047710
AF-A0A6A6NUK2-F1-model_v4 Bis(5'-adenosyl)-triphosphatase (EC 3.6.1.29) 0.9034 84 177 GO:0000166
GO:0047710
AF-A0A1G2GWF3-F1-model_v4 HIT domain-containing protein 0.9012 85 179 GO:0003824

Map