F366055

General Info

Members Datasets Scaffolds Average Seq Length
255 149 510 313

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_72744_c1|nmdc:mga09592_72744_c1_1783_2895
Length 370
Sequence VASDDSRILPAEAGSHPPSRSALRRGRLSKVGGFRLKPEGCGVAAKIAALVKVYKHEGAGTRVVETVDAAWLQPGSGVVVWVVMDNPTSEEAKILSNVFHIHELAIEDALAEIHFPKIESYGDYLYLVLHGIDFQARHHTFRTKDVDFFVAPQFLITIHHGVSRSIQKVEQVCERNSQMLAEGTAALLHRLIDALVDNYRPEIEKLQERLDKLETEVFEKPNPKLARQILDFKRDVASMRKVVLPERDAVGRLARREFPLITEQLAYRFRDVHDHLVRLSDEAMFFQDRISGILDAHLSAVSNQLNAVMKVLTLISTIFLPLTVLTGMYGMNVTLPHMPGGDPWQFWWVVGIMVALSGGMIMYFKSRGWI

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
90 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
91 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
94 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
135 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.53
Nodule 0
Rhizoplane 2.35
Rhizosphere 94.12
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_72744_c1 3300050508 Bacteria 2920
2 Ga0065712_10068830 3300005290 Bacteria 8854
3 Ga0065712_10085806 3300005290 Bacteria 2673
4 Ga0065715_10133174 3300005293 Bacteria 1965
5 Ga0070683_100000881 3300005329 Bacteria 22260
6 Ga0070690_100251886 3300005330 Bacteria 1249
7 Ga0070670_100093852 3300005331 Bacteria 2581
8 Ga0070670_100108958 3300005331 Bacteria 2386
9 Ga0070677_10040261 3300005333 Bacteria 1838
10 Ga0070668_100307576 3300005347 Bacteria 1331
11 Ga0070669_100056199 3300005353 Bacteria 2885
12 Ga0070675_100052567 3300005354 Bacteria 3350
13 Ga0070671_100022667 3300005355 Bacteria 5130
14 Ga0070671_100195056 3300005355 Bacteria 1717
15 Ga0070671_100267296 3300005355 Bacteria 1453
16 Ga0070674_100003738 3300005356 Bacteria 8583
17 Ga0070663_100060934 3300005455 Bacteria 2716
18 Ga0070663_100073874 3300005455 Bacteria 2488
19 Ga0070678_100053206 3300005456 Bacteria 2943
20 Ga0070678_100131663 3300005456 Bacteria 1988
21 Ga0070685_10220252 3300005466 Bacteria 1243
22 Ga0070679_100210331 3300005530 Bacteria 1909
23 Ga0070684_100000124 3300005535 Bacteria 50931
24 Ga0070684_100274158 3300005535 Bacteria 1545
25 Ga0070672_100039345 3300005543 Bacteria 3622
26 Ga0070672_100095683 3300005543 Bacteria 2402
27 Ga0070672_100242284 3300005543 Bacteria 1517
28 Ga0070665_100178608 3300005548 Bacteria 2124
29 Ga0070665_100298673 3300005548 Bacteria 1613
30 Ga0070665_100606092 3300005548 Bacteria 1108
31 Ga0070664_100000363 3300005564 Bacteria 33478
32 Ga0068857_100247227 3300005577 Bacteria 1634
33 Ga0068859_100066668 3300005617 Bacteria 3635
34 Ga0068859_100121798 3300005617 Bacteria 2675
35 Ga0068864_100106516 3300005618 Bacteria 2493
36 Ga0068861_100178890 3300005719 Bacteria 1764
37 Ga0068863_100325657 3300005841 Bacteria 1493
38 Ga0068860_100073110 3300005843 Bacteria 3259
39 Ga0068860_100399717 3300005843 Bacteria 1359
40 Ga0075365_10054324 3300006038 Bacteria 2656
41 Ga0075363_100045060 3300006048 Bacteria 2338
42 Ga0075364_10058873 3300006051 Bacteria 2518
43 Ga0075367_10028882 3300006178 Bacteria 3167
44 Ga0075428_100005366 3300006844 Bacteria 14247
45 Ga0075428_100011325 3300006844 Bacteria 9923
46 Ga0075428_100126062 3300006844 Bacteria 2786
47 Ga0075428_100209706 3300006844 Bacteria 2105
48 Ga0075430_100003499 3300006846 Bacteria 13148
49 Ga0075430_100005996 3300006846 Bacteria 10262
50 Ga0075430_100023600 3300006846 Bacteria 5238
51 Ga0075431_100134356 3300006847 Bacteria 2550
52 Ga0075431_100168216 3300006847 Bacteria 2253
53 Ga0075433_10021244 3300006852 Bacteria 5442
54 Ga0075433_10098183 3300006852 Bacteria 2593
55 Ga0075433_10166666 3300006852 Bacteria 1961
56 Ga0075433_10223748 3300006852 Bacteria 1671
57 Ga0075434_100046758 3300006871 Bacteria 4294
58 Ga0075434_100088505 3300006871 Bacteria 3098
59 Ga0075434_100102013 3300006871 Bacteria 2877
60 Ga0075429_100004486 3300006880 Bacteria 12007
61 Ga0075436_100000801 3300006914 Bacteria 20860
62 Ga0097620_100066668 3300006931 Bacteria 3635
63 Ga0097620_100121797 3300006931 Bacteria 2675
64 Ga0075435_100000849 3300007076 Bacteria 19122
65 Ga0075435_100321065 3300007076 Bacteria 1325
66 Ga0111539_10000544 3300009094 Bacteria 48062
67 Ga0111539_10028438 3300009094 Bacteria 6820
68 Ga0111539_10096102 3300009094 Bacteria 3480
69 Ga0111539_10191427 3300009094 Bacteria 2387
70 Ga0111539_10447298 3300009094 Bacteria 1504
71 Ga0111539_10513208 3300009094 Bacteria 1396
72 Ga0114129_10007073 3300009147 Bacteria 15972
73 Ga0114129_10016647 3300009147 Bacteria 10470
74 Ga0114129_10096137 3300009147 Bacteria 4102
75 Ga0114129_10103305 3300009147 Bacteria 3940
76 Ga0114129_10136292 3300009147 Bacteria 3368
77 Ga0114129_10168585 3300009147 Bacteria 2987
78 Ga0105238_10127348 3300009551 Bacteria 2525
79 Ga0105239_10669759 3300010375 Bacteria 1186
80 Ga0105246_10075048 3300011119 Bacteria 2393
81 Ga0105246_10302904 3300011119 Bacteria 1291
82 Ga0157374_10216709 3300013296 Bacteria 1878
83 Ga0163162_10354798 3300013306 Bacteria 1599
84 Ga0157375_10101099 3300013308 Bacteria 2965
85 Ga0157375_10240735 3300013308 Bacteria 1969
86 Ga0163163_10104379 3300014325 Bacteria 2859
87 Ga0163163_10128764 3300014325 Bacteria 2570
88 Ga0163163_10689707 3300014325 Bacteria 1085
89 Ga0157380_10008240 3300014326 Bacteria 7427
90 Ga0157380_10143003 3300014326 Bacteria 2058
91 Ga0157380_10163457 3300014326 Bacteria 1937
92 Ga0157380_10606693 3300014326 Bacteria 1084
93 Ga0157377_10068768 3300014745 Bacteria 2042
94 Ga0157379_10233498 3300014968 Bacteria 1668
95 Ga0157376_10314900 3300014969 Bacteria 1486
96 Ga0207697_10000882 3300025315 Bacteria 16983
97 Ga0207697_10026904 3300025315 Bacteria 2353
98 Ga0207682_10111033 3300025893 Bacteria 1207
99 Ga0207688_10013880 3300025901 Bacteria 4379
100 Ga0207680_10039543 3300025903 Bacteria 2738
101 Ga0207650_10007021 3300025925 Bacteria 7681
102 Ga0207650_10032563 3300025925 Bacteria 3771
103 Ga0207650_10239090 3300025925 Bacteria 1467
104 Ga0207659_10067994 3300025926 Bacteria 2590
105 Ga0207644_10095286 3300025931 Bacteria 2226
106 Ga0207644_10176718 3300025931 Bacteria 1671
107 Ga0207669_10070955 3300025937 Bacteria 2186
108 Ga0207669_10131517 3300025937 Bacteria 1720
109 Ga0207691_10020666 3300025940 Bacteria 6225
110 Ga0207689_10124456 3300025942 Bacteria 2121
111 Ga0207661_10002924 3300025944 Bacteria 11804
112 Ga0207679_10008358 3300025945 Bacteria 6590
113 Ga0207651_10125561 3300025960 Bacteria 1954
114 Ga0207651_10416684 3300025960 Unclassified 1146
115 Ga0207712_10268512 3300025961 Bacteria 1387
116 Ga0207678_10051536 3300026067 Bacteria 3553
117 Ga0207678_10082480 3300026067 Bacteria 2751
118 Ga0207678_10209789 3300026067 Bacteria 1666
119 Ga0207708_10089933 3300026075 Bacteria 2366
120 Ga0207641_10195148 3300026088 Bacteria 1863
121 Ga0207641_10408715 3300026088 Bacteria 1305
122 Ga0207648_10347566 3300026089 Bacteria 1336
123 Ga0207676_10083246 3300026095 Bacteria 2605
124 Ga0207674_10240820 3300026116 Bacteria 1756
125 Ga0207675_100295652 3300026118 Bacteria 1576
126 Ga0207683_10012152 3300026121 Bacteria 7350
127 Ga0207683_10160499 3300026121 Bacteria 2032
128 Ga0207683_10265270 3300026121 Bacteria 1568
129 Ga0209813_10058972 3300027866 Bacteria 1221
130 Ga0207428_10002986 3300027907 Bacteria 16708
131 Ga0207428_10011671 3300027907 Bacteria 7748
132 Ga0207428_10015596 3300027907 Bacteria 6567
133 Ga0268266_10066010 3300028379 Bacteria 3129
134 Ga0268266_10434460 3300028379 Bacteria 1246
135 Ga0265318_10009125 3300028577 Bacteria 4381
136 Ga0265339_10029416 3300031249 Bacteria 3117
137 Ga0307408_100016955 3300031548 Bacteria 4869
138 Ga0307408_100208689 3300031548 Bacteria 1586
139 Ga0307405_10177227 3300031731 Bacteria 1527
140 Ga0307410_10185418 3300031852 Bacteria 1579
141 Ga0307407_10009513 3300031903 Bacteria 4532
142 Ga0307412_10056136 3300031911 Bacteria 2623
143 Ga0307412_10158633 3300031911 Bacteria 1678
144 Ga0307409_100347706 3300031995 Unclassified 1398
145 Ga0307416_100117578 3300032002 Bacteria 2360
146 Ga0307411_10042205 3300032005 Bacteria 2908
147 Ga0307411_10109116 3300032005 Bacteria 1976
148 Ga0395905_0121753 3300037471 Bacteria 2453
149 Ga0439439_0010364 3300041406 Bacteria 2226
150 Ga0439450_011035 3300042008 Bacteria 1758
151 Ga0450898_017264 3300042134 Bacteria 1240
152 Ga0439446_0059879 3300042156 Bacteria 1149
153 Ga0439435_0004237 3300042436 Bacteria 3070
154 Ga0439464_0038710 3300042439 Bacteria 1354
155 Ga0451577_0021993 3300042876 Bacteria 5828
156 Ga0495638_0009415 3300046460 Bacteria 6861
157 Ga0495642_0020599 3300046528 Bacteria 2592
158 Ga0495669_0016826 3300046684 Bacteria 3134
159 Ga0496101_0129559 3300048904 Bacteria 1915
160 Ga0496104_0001375 3300048907 Bacteria 21046
161 Ga0496105_0051116 3300048908 Bacteria 3415
162 Ga0496109_0000528 3300048912 Bacteria 32391
163 Ga0496110_0032766 3300048913 Bacteria 4492
164 Ga0496112_0001610 3300048915 Bacteria 17454
165 Ga0501298_025106 3300049521 Bacteria 1139
166 Ga0501031_0047491 3300049568 Bacteria 2799
167 Ga0501032_0042705 3300049569 Bacteria 3074
168 Ga0501034_0019683 3300049571 Bacteria 6900
169 Ga0501034_0354063 3300049571 Bacteria 1396
170 Ga0501036_0085978 3300049572 Bacteria 2658
171 Ga0501036_0453146 3300049572 Bacteria 1069
172 Ga0501038_0011085 3300049574 Bacteria 8232
173 Ga0501038_0223409 3300049574 Bacteria 1502
174 Ga0501038_0262565 3300049574 Bacteria 1364
175 Ga0501038_0281704 3300049574 Bacteria 1308
176 Ga0501039_0040627 3300049575 Bacteria 3590
177 Ga0501039_0087877 3300049575 Bacteria 2421
178 Ga0501040_0029514 3300049576 Bacteria 3703
179 Ga0501040_0095922 3300049576 Bacteria 2064
180 Ga0501043_0006538 3300049579 Bacteria 9351
181 Ga0501043_0020231 3300049579 Bacteria 5226
182 Ga0501043_0090892 3300049579 Bacteria 2400
183 Ga0501046_0011733 3300049580 Bacteria 7481
184 Ga0501047_0006723 3300049581 Bacteria 10810
185 Ga0501047_0013342 3300049581 Bacteria 7785
186 Ga0501047_0016559 3300049581 Bacteria 7039
187 Ga0501047_0120709 3300049581 Bacteria 2503
188 Ga0501048_0076134 3300049582 Bacteria 2368
189 Ga0501048_0132903 3300049582 Bacteria 1759
190 Ga0501068_0051232 3300049584 Bacteria 2497
191 Ga0501069_0029753 3300049585 Bacteria 2998
192 Ga0501070_0177535 3300049586 Bacteria 1753
193 Ga0501071_0017242 3300049587 Bacteria 4977
194 Ga0501071_0049623 3300049587 Bacteria 3022
195 Ga0501071_0241698 3300049587 Bacteria 1361
196 Ga0501072_0011518 3300049588 Bacteria 6759
197 Ga0501072_0044964 3300049588 Bacteria 3471
198 Ga0501074_0043809 3300049590 Bacteria 3239
199 Ga0501075_0075231 3300049591 Bacteria 2553
200 Ga0501076_0209560 3300049592 Bacteria 1592
201 Ga0501076_0588680 3300049592 Bacteria 918
202 Ga0501079_0044480 3300049741 Bacteria 3427
203 Ga0501079_0049982 3300049741 Bacteria 3228
204 Ga0501079_0150392 3300049741 Bacteria 1815
205 Ga0501080_0014274 3300049742 Bacteria 7316
206 Ga0501080_0022205 3300049742 Bacteria 5878
207 Ga0501081_0023401 3300049743 Bacteria 4140
208 Ga0501081_0259153 3300049743 Bacteria 1270
209 Ga0501083_0039212 3300049744 Bacteria 3217
210 Ga0501083_0187818 3300049744 Bacteria 1349
211 Ga0501035_0041286 3300049822 Bacteria 4166
212 Ga0501044_0080418 3300049823 Bacteria 3301
213 Ga0501044_0162307 3300049823 Bacteria 2210
214 Ga0501045_0004754 3300049824 Bacteria 9378
215 Ga0501045_0033500 3300049824 Bacteria 3725
216 nmdc:mga0yw44_9869_c1 3300050492 Bacteria 4849
217 nmdc:mga06z11_10928_c1 3300050494 Bacteria 3892
218 nmdc:mga04h51_41140_c1 3300050495 Bacteria 1509
219 nmdc:mga07m45_112769_c1 3300050496 Bacteria 1567
220 nmdc:mga05p37_120178_c1 3300050507 Bacteria 3228
221 nmdc:mga05p37_2339_c1 3300050507 Bacteria 22050
222 nmdc:mga05p37_29962_c1 3300050507 Bacteria 6640
223 nmdc:mga05p37_62093_c1 3300050507 Bacteria 4599
224 nmdc:mga05p37_7040_c1 3300050507 Bacteria 13256
225 nmdc:mga05p37_71578_c1 3300050507 Bacteria 4265
226 nmdc:mga09592_97445_c1 3300050508 Bacteria 2517
227 nmdc:mga0qj67_111895_c1 3300050509 Bacteria 2205
228 nmdc:mga0qj67_43210_c1 3300050509 Bacteria 3549
229 nmdc:mga06r32_225229_c1 3300050510 Bacteria 1864
230 nmdc:mga06r32_23812_c1 3300050510 Bacteria 5672
231 nmdc:mga06r32_24809_c1 3300050510 Bacteria 5573
232 nmdc:mga06r32_68733_c1 3300050510 Bacteria 3423
233 nmdc:mga08y16_1422_c1 3300050511 Bacteria 24034
234 nmdc:mga08y16_257720_c1 3300050511 Bacteria 1801
235 nmdc:mga08y16_3892_c1 3300050511 Bacteria 15541
236 nmdc:mga08y16_45267_c1 3300050511 Bacteria 4611
237 nmdc:mga0n895_284466_c1 3300050512 Bacteria 1677
238 nmdc:mga0n895_294119_c1 3300050512 Bacteria 1646
239 nmdc:mga0n895_416955_c1 3300050512 Bacteria 1357
240 nmdc:mga0n895_44082_c1 3300050512 Bacteria 4350
241 nmdc:mga0n895_8931_c1 3300050512 Bacteria 8734
242 nmdc:mga0rr50_192242_c1 3300050513 Bacteria 1673
243 nmdc:mga0rr50_76227_c1 3300050513 Bacteria 2574
244 nmdc:mga08x19_225556_c1 3300050514 Bacteria 1288
245 nmdc:mga08x19_28416_c1 3300050514 Bacteria 3503
246 nmdc:mga0a205_156256_c1 3300050515 Bacteria 2179
247 nmdc:mga0a205_29961_c1 3300050515 Bacteria 3722
248 nmdc:mga0a205_69680_c1 3300050515 Bacteria 3395
249 Ga0501084_0008525 3300054114 Bacteria 8472
250 Ga0590071_000200 3300059421 Bacteria 17495
251 Ga0590074_003264 3300059423 Bacteria 2679
252 Ga0590075_000043 3300059424 Bacteria 33018
253 Ga0590077_000271 3300059426 Bacteria 14710
254 Ga0530510_0002812 3300061734 Bacteria 11972
255 Ga0530510_0220774 3300061734 Bacteria 1409
256 nmdc:mga09592_72744_c1
257 Ga0065712_10068830
258 Ga0065712_10085806
259 Ga0065715_10133174
260 Ga0070683_100000881
261 Ga0070690_100251886
262 Ga0070670_100093852
263 Ga0070670_100108958
264 Ga0070677_10040261
265 Ga0070668_100307576
266 Ga0070669_100056199
267 Ga0070675_100052567
268 Ga0070671_100022667
269 Ga0070671_100195056
270 Ga0070671_100267296
271 Ga0070674_100003738
272 Ga0070663_100060934
273 Ga0070663_100073874
274 Ga0070678_100053206
275 Ga0070678_100131663
276 Ga0070685_10220252
277 Ga0070679_100210331
278 Ga0070684_100000124
279 Ga0070684_100274158
280 Ga0070672_100039345
281 Ga0070672_100095683
282 Ga0070672_100242284
283 Ga0070665_100178608
284 Ga0070665_100298673
285 Ga0070665_100606092
286 Ga0070664_100000363
287 Ga0068857_100247227
288 Ga0068859_100066668
289 Ga0068859_100121798
290 Ga0068864_100106516
291 Ga0068861_100178890
292 Ga0068863_100325657
293 Ga0068860_100073110
294 Ga0068860_100399717
295 Ga0075365_10054324
296 Ga0075363_100045060
297 Ga0075364_10058873
298 Ga0075367_10028882
299 Ga0075428_100005366
300 Ga0075428_100011325
301 Ga0075428_100126062
302 Ga0075428_100209706
303 Ga0075430_100003499
304 Ga0075430_100005996
305 Ga0075430_100023600
306 Ga0075431_100134356
307 Ga0075431_100168216
308 Ga0075433_10021244
309 Ga0075433_10098183
310 Ga0075433_10166666
311 Ga0075433_10223748
312 Ga0075434_100046758
313 Ga0075434_100088505
314 Ga0075434_100102013
315 Ga0075429_100004486
316 Ga0075436_100000801
317 Ga0097620_100066668
318 Ga0097620_100121797
319 Ga0075435_100000849
320 Ga0075435_100321065
321 Ga0111539_10000544
322 Ga0111539_10028438
323 Ga0111539_10096102
324 Ga0111539_10191427
325 Ga0111539_10447298
326 Ga0111539_10513208
327 Ga0114129_10007073
328 Ga0114129_10016647
329 Ga0114129_10096137
330 Ga0114129_10103305
331 Ga0114129_10136292
332 Ga0114129_10168585
333 Ga0105238_10127348
334 Ga0105239_10669759
335 Ga0105246_10075048
336 Ga0105246_10302904
337 Ga0157374_10216709
338 Ga0163162_10354798
339 Ga0157375_10101099
340 Ga0157375_10240735
341 Ga0163163_10104379
342 Ga0163163_10128764
343 Ga0163163_10689707
344 Ga0157380_10008240
345 Ga0157380_10143003
346 Ga0157380_10163457
347 Ga0157380_10606693
348 Ga0157377_10068768
349 Ga0157379_10233498
350 Ga0157376_10314900
351 Ga0207697_10000882
352 Ga0207697_10026904
353 Ga0207682_10111033
354 Ga0207688_10013880
355 Ga0207680_10039543
356 Ga0207650_10007021
357 Ga0207650_10032563
358 Ga0207650_10239090
359 Ga0207659_10067994
360 Ga0207644_10095286
361 Ga0207644_10176718
362 Ga0207669_10070955
363 Ga0207669_10131517
364 Ga0207691_10020666
365 Ga0207689_10124456
366 Ga0207661_10002924
367 Ga0207679_10008358
368 Ga0207651_10125561
369 Ga0207651_10416684
370 Ga0207712_10268512
371 Ga0207678_10051536
372 Ga0207678_10082480
373 Ga0207678_10209789
374 Ga0207708_10089933
375 Ga0207641_10195148
376 Ga0207641_10408715
377 Ga0207648_10347566
378 Ga0207676_10083246
379 Ga0207674_10240820
380 Ga0207675_100295652
381 Ga0207683_10012152
382 Ga0207683_10160499
383 Ga0207683_10265270
384 Ga0209813_10058972
385 Ga0207428_10002986
386 Ga0207428_10011671
387 Ga0207428_10015596
388 Ga0268266_10066010
389 Ga0268266_10434460
390 Ga0265318_10009125
391 Ga0265339_10029416
392 Ga0307408_100016955
393 Ga0307408_100208689
394 Ga0307405_10177227
395 Ga0307410_10185418
396 Ga0307407_10009513
397 Ga0307412_10056136
398 Ga0307412_10158633
399 Ga0307409_100347706
400 Ga0307416_100117578
401 Ga0307411_10042205
402 Ga0307411_10109116
403 Ga0395905_0121753
404 Ga0439439_0010364
405 Ga0439450_011035
406 Ga0450898_017264
407 Ga0439446_0059879
408 Ga0439435_0004237
409 Ga0439464_0038710
410 Ga0451577_0021993
411 Ga0495638_0009415
412 Ga0495642_0020599
413 Ga0495669_0016826
414 Ga0496101_0129559
415 Ga0496104_0001375
416 Ga0496105_0051116
417 Ga0496109_0000528
418 Ga0496110_0032766
419 Ga0496112_0001610
420 Ga0501298_025106
421 Ga0501031_0047491
422 Ga0501032_0042705
423 Ga0501034_0019683
424 Ga0501034_0354063
425 Ga0501036_0085978
426 Ga0501036_0453146
427 Ga0501038_0011085
428 Ga0501038_0223409
429 Ga0501038_0262565
430 Ga0501038_0281704
431 Ga0501039_0040627
432 Ga0501039_0087877
433 Ga0501040_0029514
434 Ga0501040_0095922
435 Ga0501043_0006538
436 Ga0501043_0020231
437 Ga0501043_0090892
438 Ga0501046_0011733
439 Ga0501047_0006723
440 Ga0501047_0013342
441 Ga0501047_0016559
442 Ga0501047_0120709
443 Ga0501048_0076134
444 Ga0501048_0132903
445 Ga0501068_0051232
446 Ga0501069_0029753
447 Ga0501070_0177535
448 Ga0501071_0017242
449 Ga0501071_0049623
450 Ga0501071_0241698
451 Ga0501072_0011518
452 Ga0501072_0044964
453 Ga0501074_0043809
454 Ga0501075_0075231
455 Ga0501076_0209560
456 Ga0501076_0588680
457 Ga0501079_0044480
458 Ga0501079_0049982
459 Ga0501079_0150392
460 Ga0501080_0014274
461 Ga0501080_0022205
462 Ga0501081_0023401
463 Ga0501081_0259153
464 Ga0501083_0039212
465 Ga0501083_0187818
466 Ga0501035_0041286
467 Ga0501044_0080418
468 Ga0501044_0162307
469 Ga0501045_0004754
470 Ga0501045_0033500
471 nmdc:mga0yw44_9869_c1
472 nmdc:mga06z11_10928_c1
473 nmdc:mga04h51_41140_c1
474 nmdc:mga07m45_112769_c1
475 nmdc:mga05p37_120178_c1
476 nmdc:mga05p37_2339_c1
477 nmdc:mga05p37_29962_c1
478 nmdc:mga05p37_62093_c1
479 nmdc:mga05p37_7040_c1
480 nmdc:mga05p37_71578_c1
481 nmdc:mga09592_97445_c1
482 nmdc:mga0qj67_111895_c1
483 nmdc:mga0qj67_43210_c1
484 nmdc:mga06r32_225229_c1
485 nmdc:mga06r32_23812_c1
486 nmdc:mga06r32_24809_c1
487 nmdc:mga06r32_68733_c1
488 nmdc:mga08y16_1422_c1
489 nmdc:mga08y16_257720_c1
490 nmdc:mga08y16_3892_c1
491 nmdc:mga08y16_45267_c1
492 nmdc:mga0n895_284466_c1
493 nmdc:mga0n895_294119_c1
494 nmdc:mga0n895_416955_c1
495 nmdc:mga0n895_44082_c1
496 nmdc:mga0n895_8931_c1
497 nmdc:mga0rr50_192242_c1
498 nmdc:mga0rr50_76227_c1
499 nmdc:mga08x19_225556_c1
500 nmdc:mga08x19_28416_c1
501 nmdc:mga0a205_156256_c1
502 nmdc:mga0a205_29961_c1
503 nmdc:mga0a205_69680_c1
504 Ga0501084_0008525
505 Ga0590071_000200
506 Ga0590074_003264
507 Ga0590075_000043
508 Ga0590077_000271
509 Ga0530510_0002812
510 Ga0530510_0220774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01544

CorA

CorA-like Mg2+ transporter protein

76

366

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nvo-assembly2.cif.gz_B-2 the soluble domain structure of the zntb zn2+ efflux system 0.8631 3 250
4egw-assembly1.cif.gz_B the structure of the soluble domain of cora from methanocaldococcus jannaschii 0.8624 4 250
6jfl-assembly2.cif.gz_B nucleotide-free mitofusin2 (mfn2) 0.8509 177 250
4egw-assembly1.cif.gz_B the structure of the soluble domain of cora from methanocaldococcus jannaschii 0.8307 4 250
3ck6-assembly1.cif.gz_D crystal structure of zntb cytoplasmic domain from vibrio parahaemolyticus rimd 2210633 0.8233 3 254
ID Description Score Start End Superfamily
2iubA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9482 136 241 1.20.58.340
4eebC02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9473 136 241 1.20.58.340
4i0uI02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9459 134 241 1.20.58.340
4i0uB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9452 134 241 1.20.58.340
4i0uJ02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Magnesium transport protein CorA, transmembrane region 0.9448 134 241 1.20.58.340
ID Description Score Start End GO Terms
AF-A0A2V8CBW3-F1-model_v4 Magnesium and cobalt transport protein CorA 0.962 1 126 GO:0016020
GO:0046873
AF-A0A2V8CBW3-F1-model_v4 Magnesium and cobalt transport protein CorA 0.9331 1 126 GO:0016020
GO:0046873
AF-A0A377TWQ5-F1-model_v4 Mg2+ and Co2+ transporter 0.9312 134 258 GO:0016020
GO:0046873
AF-A0A660PJM4-F1-model_v4 Magnesium and cobalt transport protein CorA 0.922 1 226 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897
AF-Q8KAG0-F1-model_v4 Magnesium transport protein CorA 0.9216 30 283 GO:0000287
GO:0005886
GO:0015087
GO:0015095
GO:0050897

Map