F365959

General Info

Members Datasets Scaffolds Average Seq Length
255 180 510 240

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0011357|Ga0495668_0011357_4339_5154
Length 271
Sequence LKAAGSALAAFVLPAAGTAFRARGSRQGTFRNMQLSQFKALSFDCYGTLIDWESGIVEALRPLSERAGISAEQLLDTYGPVEHEVQEAFPALRYSELLGKVHEWLSQRFGLEPNAAEAAAFGATVGDWPAFPDSAEALAYLKGHFQLIILSNVDRASFAGSNRRLGVEFDQVLTAEEIGSYKPDPRNFEYLLTRAGEAGIAKEELLHTAQSLFHDHVPANEMGIASAWIDRRHDKSGRGATVSPDPMPHFDFRFESLGELAAAHRAEQAGG

Samples

Sample ID Description Type Environment
1 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
90 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
91 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
115 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
116 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
163 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
164 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
165 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
166 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
167 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
168 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
169 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
170 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
171 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
172 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
173 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
174 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
175 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
176 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
177 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
178 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
179 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
180 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.94
Metatranscriptomes 0
Isolates 7.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 5.49
Rhizoplane 3.53
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 0.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495668_0011357 3300046616 Bacteria 5337
2 JGI24735J21928_10084235 3300002067 Bacteria 911
3 JGI25165J46597_1000025 3300003214 Bacteria 333075
4 JGI25165J46597_1000093 3300003214 Bacteria 164901
5 Ga0065715_10127473 3300005293 Bacteria 2086
6 Ga0065707_10082065 3300005295 Bacteria 23100
7 Ga0070677_10067820 3300005333 Bacteria 1491
8 Ga0070660_100091829 3300005339 Bacteria 2395
9 Ga0070692_10011839 3300005345 Bacteria 4020
10 Ga0070668_100062099 3300005347 Bacteria 2894
11 Ga0070669_100039180 3300005353 Bacteria 3443
12 Ga0070669_100136882 3300005353 Bacteria 1884
13 Ga0070673_100177784 3300005364 Bacteria 1820
14 Ga0070659_100004185 3300005366 Bacteria 10295
15 Ga0070659_100035805 3300005366 Bacteria 3867
16 Ga0070659_100077712 3300005366 Bacteria 2648
17 Ga0070694_100051250 3300005444 Bacteria 2785
18 Ga0070662_100049549 3300005457 Bacteria 3029
19 Ga0068867_100324183 3300005459 Bacteria 1277
20 Ga0068853_100098439 3300005539 Bacteria 2583
21 Ga0068853_100121150 3300005539 Bacteria 2334
22 Ga0068853_100320789 3300005539 Bacteria 1436
23 Ga0070672_100081263 3300005543 Bacteria 2598
24 Ga0070695_100162676 3300005545 Bacteria 1568
25 Ga0070693_100163123 3300005547 Bacteria 1421
26 Ga0070665_100015414 3300005548 Bacteria 7675
27 Ga0068855_100059737 3300005563 Bacteria 4460
28 Ga0068854_100096942 3300005578 Bacteria 2204
29 Ga0068852_100103060 3300005616 Bacteria 2580
30 Ga0068859_100058820 3300005617 Bacteria 3872
31 Ga0068859_100136371 3300005617 Bacteria 2527
32 Ga0068863_100036602 3300005841 Bacteria 4675
33 Ga0068863_100123770 3300005841 Bacteria 2467
34 Ga0068858_100012384 3300005842 Bacteria 8041
35 Ga0068858_100041212 3300005842 Bacteria 4282
36 Ga0068860_100011501 3300005843 Bacteria 8721
37 Ga0068862_100096290 3300005844 Bacteria 2583
38 Ga0081455_10257053 3300005937 Bacteria 1274
39 Ga0081538_10012399 3300005981 Bacteria 6832
40 Ga0081538_10018017 3300005981 Bacteria 5328
41 Ga0081539_10160775 3300005985 Bacteria 1071
42 Ga0097621_100194400 3300006237 Bacteria 1758
43 Ga0068871_100091151 3300006358 Bacteria 2540
44 Ga0068865_100249357 3300006881 Bacteria 1401
45 Ga0097620_100058825 3300006931 Bacteria 3872
46 Ga0097620_100136364 3300006931 Bacteria 2527
47 Ga0099794_10159977 3300007265 Unclassified 1145
48 Ga0105251_10202521 3300009011 Bacteria 894
49 Ga0105250_10000502 3300009092 Bacteria 27455
50 Ga0105240_10003013 3300009093 Bacteria 26500
51 Ga0114129_10095069 3300009147 Bacteria 4127
52 Ga0105243_10104883 3300009148 Bacteria 2354
53 Ga0105248_10106791 3300009177 Bacteria 3157
54 Ga0105237_10144527 3300009545 Bacteria 2373
55 Ga0105237_10263511 3300009545 Bacteria 1726
56 Ga0105249_10032103 3300009553 Bacteria 4750
57 Ga0105239_10010303 3300010375 Bacteria 10470
58 Ga0105239_10523846 3300010375 Bacteria 1349
59 Ga0105246_10114012 3300011119 Bacteria 1991
60 Ga0157373_10034758 3300013100 Bacteria 3620
61 Ga0157371_10133312 3300013102 Bacteria 1768
62 Ga0157370_10359357 3300013104 Bacteria 1342
63 Ga0157374_10080738 3300013296 Bacteria 3085
64 Ga0163162_10070259 3300013306 Bacteria 3553
65 Ga0157372_10353182 3300013307 Bacteria 1713
66 Ga0182008_10048181 3300014497 Bacteria 2116
67 Ga0157379_10096042 3300014968 Bacteria 2660
68 Ga0163161_10000389 3300017792 Bacteria 36885
69 Ga0209233_1000053 3300025261 Bacteria 444909
70 Ga0207696_1002521 3300025711 Bacteria 8944
71 Ga0207713_1117809 3300025735 Bacteria 894
72 Ga0207647_10001281 3300025904 Bacteria 19328
73 Ga0207654_10413768 3300025911 Bacteria 940
74 Ga0207695_10036801 3300025913 Bacteria 5286
75 Ga0207671_10082939 3300025914 Bacteria 2406
76 Ga0207671_10283544 3300025914 Bacteria 1307
77 Ga0207657_10006333 3300025919 Bacteria 12295
78 Ga0207657_10287833 3300025919 Bacteria 1303
79 Ga0207657_10392437 3300025919 Bacteria 1092
80 Ga0207681_10012796 3300025923 Bacteria 5185
81 Ga0207681_10241156 3300025923 Bacteria 1407
82 Ga0207681_10554911 3300025923 Bacteria 946
83 Ga0207644_10057457 3300025931 Bacteria 2809
84 Ga0207690_10004216 3300025932 Bacteria 8496
85 Ga0207690_10152610 3300025932 Bacteria 1714
86 Ga0207706_10005097 3300025933 Bacteria 12267
87 Ga0207709_10147831 3300025935 Bacteria 1624
88 Ga0207691_10009544 3300025940 Bacteria 9312
89 Ga0207711_10022477 3300025941 Bacteria 5274
90 Ga0207689_10438132 3300025942 Bacteria 1091
91 Ga0207667_10262686 3300025949 Bacteria 1765
92 Ga0207651_10057540 3300025960 Bacteria 2682
93 Ga0207651_10223385 3300025960 Bacteria 1524
94 Ga0207712_10002447 3300025961 Bacteria 11986
95 Ga0207668_10167068 3300025972 Bacteria 1721
96 Ga0207640_10481903 3300025981 Bacteria 1029
97 Ga0207703_10010867 3300026035 Bacteria 7099
98 Ga0207639_10039197 3300026041 Bacteria 3529
99 Ga0207639_10300972 3300026041 Bacteria 1418
100 Ga0207702_10061144 3300026078 Bacteria 3212
101 Ga0207641_10102106 3300026088 Bacteria 2528
102 Ga0207641_10415970 3300026088 Bacteria 1293
103 Ga0207674_10002909 3300026116 Bacteria 21260
104 Ga0207674_10084907 3300026116 Bacteria 3163
105 Ga0209371_1001665 3300027312 Bacteria 14256
106 Ga0268265_10047509 3300028380 Bacteria 3216
107 Ga0268264_10001863 3300028381 Bacteria 19178
108 Ga0268264_10069779 3300028381 Bacteria 2973
109 Ga0265334_10000021 3300028573 Bacteria 132223
110 Ga0268256_1001453 3300030500 Bacteria 14256
111 Ga0265331_10014422 3300031250 Bacteria 4209
112 Ga0265313_10000275 3300031595 Bacteria 56249
113 Ga0307413_10020159 3300031824 Bacteria 3539
114 Ga0307410_10006852 3300031852 Bacteria 6187
115 Ga0307407_10012847 3300031903 Bacteria 4043
116 Ga0307412_10360182 3300031911 Bacteria 1171
117 Ga0307409_100018512 3300031995 Bacteria 4685
118 Ga0307414_10015758 3300032004 Bacteria 4573
119 Ga0307411_10000757 3300032005 Bacteria 11941
120 Ga0307411_10232503 3300032005 Bacteria 1438
121 Ga0307415_100010709 3300032126 Bacteria 5208
122 Ga0307415_100153583 3300032126 Bacteria 1775
123 Ga0316574_0020076 3300035398 Bacteria 3951
124 Ga0373925_0144514 3300037068 Bacteria 1864
125 Ga0395900_0010722 3300037418 Bacteria 9374
126 Ga0395900_0033551 3300037418 Bacteria 5282
127 Ga0395905_0005321 3300037471 Bacteria 13159
128 Ga0395905_0006999 3300037471 Bacteria 11275
129 Ga0395905_0019858 3300037471 Bacteria 6368
130 Ga0395905_0059056 3300037471 Bacteria 3586
131 Ga0395905_0288250 3300037471 Bacteria 1529
132 Ga0395901_0042030 3300038443 Bacteria 4738
133 Ga0395901_0613434 3300038443 Bacteria 1096
134 Ga0436360_0788616 3300039438 Bacteria 2566
135 Ga0436360_1137707 3300039438 Bacteria 4952
136 Ga0451576_0088914 3300045051 Bacteria 3213
137 Ga0495590_0006109 3300046457 Bacteria 4722
138 Ga0495605_0000093 3300046474 Bacteria 113652
139 Ga0495605_0000671 3300046474 Bacteria 25837
140 Ga0495584_0000056 3300046491 Bacteria 81387
141 Ga0495583_0000086 3300046506 Bacteria 165176
142 Ga0495583_0000327 3300046506 Bacteria 75285
143 Ga0495606_0080764 3300046507 Bacteria 2022
144 Ga0495620_0011351 3300046515 Bacteria 4647
145 Ga0495637_0059880 3300046520 Bacteria 1566
146 Ga0495642_0101773 3300046528 Bacteria 1223
147 Ga0495654_0000117 3300046530 Bacteria 89307
148 Ga0495654_0176433 3300046530 Bacteria 928
149 Ga0495597_0017228 3300046542 Bacteria 3403
150 Ga0495611_0025454 3300046648 Bacteria 2579
151 Ga0495659_0000023 3300046664 Bacteria 71429
152 Ga0495669_0000551 3300046684 Bacteria 16685
153 Ga0495669_0001590 3300046684 Bacteria 9330
154 Ga0495669_0019713 3300046684 Bacteria 2913
155 Ga0495669_0057385 3300046684 Bacteria 1756
156 Ga0495671_0000085 3300046692 Bacteria 88500
157 Ga0495671_0008551 3300046692 Bacteria 5751
158 Ga0495649_0000283 3300046694 Bacteria 44818
159 Ga0495589_0002902 3300046794 Bacteria 9479
160 Ga0495660_0050187 3300046810 Bacteria 2274
161 Ga0495672_0000450 3300047320 Bacteria 48960
162 Ga0495672_0000537 3300047320 Bacteria 42948
163 Ga0495672_0098650 3300047320 Bacteria 1589
164 Ga0495683_0000597 3300047323 Bacteria 27120
165 Ga0495683_0001372 3300047323 Bacteria 16177
166 Ga0495677_0032936 3300047445 Bacteria 1888
167 Ga0495677_0106926 3300047445 Bacteria 1062
168 Ga0495673_0002663 3300047469 Bacteria 12336
169 Ga0495602_0059072 3300048088 Bacteria 3351
170 Ga0495602_0131939 3300048088 Bacteria 1991
171 Ga0495626_0000887 3300048091 Bacteria 26500
172 Ga0495626_0025020 3300048091 Bacteria 2922
173 Ga0496102_0142324 3300048905 Bacteria 2249
174 Ga0496103_0078071 3300048906 Bacteria 2079
175 Ga0496108_0041476 3300048911 Bacteria 3842
176 Ga0496108_0127884 3300048911 Bacteria 2182
177 Ga0496109_0021122 3300048912 Bacteria 5756
178 Ga0496110_0048694 3300048913 Bacteria 3715
179 Ga0496111_0057267 3300048914 Bacteria 2821
180 Ga0496112_0060166 3300048915 Bacteria 3742
181 Ga0496112_0118815 3300048915 Bacteria 2613
182 Ga0496124_0003049 3300048927 Bacteria 20888
183 Ga0496124_0021950 3300048927 Bacteria 5871
184 Ga0496126_0198802 3300048929 Bacteria 1694
185 Ga0495682_0000247 3300049460 Bacteria 42775
186 Ga0495682_0021906 3300049460 Bacteria 2393
187 Ga0495682_0116243 3300049460 Bacteria 958
188 Ga0501031_0003278 3300049568 Bacteria 10393
189 Ga0501031_0201741 3300049568 Bacteria 1298
190 Ga0501032_0216399 3300049569 Bacteria 1248
191 Ga0501036_0087607 3300049572 Bacteria 2631
192 Ga0501036_0104222 3300049572 Bacteria 2399
193 Ga0501036_0381864 3300049572 Bacteria 1176
194 Ga0501037_0062938 3300049573 Bacteria 2705
195 Ga0501038_0368731 3300049574 Bacteria 1116
196 Ga0501039_0005089 3300049575 Bacteria 9958
197 Ga0501040_0000097 3300049576 Bacteria 43974
198 Ga0501040_0005355 3300049576 Bacteria 8297
199 Ga0501040_0007189 3300049576 Bacteria 7210
200 Ga0501040_0059080 3300049576 Bacteria 2635
201 Ga0501041_0001952 3300049577 Bacteria 11578
202 Ga0501042_0000054 3300049578 Bacteria 40211
203 Ga0501042_0004380 3300049578 Bacteria 9001
204 Ga0501042_0009673 3300049578 Bacteria 6437
205 Ga0501042_0070916 3300049578 Bacteria 2493
206 Ga0501043_0074736 3300049579 Bacteria 2662
207 Ga0501046_0169849 3300049580 Bacteria 1637
208 Ga0501047_0501266 3300049581 Unclassified 1041
209 Ga0501048_0014218 3300049582 Bacteria 5895
210 Ga0501048_0108721 3300049582 Bacteria 1958
211 Ga0501048_0412634 3300049582 Bacteria 966
212 Ga0501068_0429322 3300049584 Bacteria 854
213 Ga0501071_0003747 3300049587 Bacteria 9545
214 Ga0501071_0177049 3300049587 Bacteria 1597
215 Ga0501072_0008794 3300049588 Bacteria 7668
216 Ga0501072_0009998 3300049588 Bacteria 7215
217 Ga0501074_0022862 3300049590 Bacteria 4547
218 Ga0501075_0014693 3300049591 Bacteria 5610
219 Ga0501075_0076258 3300049591 Bacteria 2536
220 Ga0501075_0180240 3300049591 Bacteria 1612
221 Ga0501076_0002701 3300049592 Bacteria 12257
222 Ga0501076_0274684 3300049592 Bacteria 1380
223 Ga0501076_0277284 3300049592 Bacteria 1373
224 Ga0501077_0056077 3300049593 Bacteria 2501
225 Ga0501079_0059382 3300049741 Bacteria 2950
226 Ga0501079_0070862 3300049741 Bacteria 2692
227 Ga0501079_0339306 3300049741 Bacteria 1177
228 Ga0501079_0508616 3300049741 Bacteria 947
229 Ga0501080_0028503 3300049742 Bacteria 5196
230 Ga0501080_0219605 3300049742 Bacteria 1740
231 Ga0501081_0007970 3300049743 Bacteria 6873
232 Ga0501045_0017803 3300049824 Bacteria 5046
233 Ga0501045_0253117 3300049824 Bacteria 1311
234 Ga0500618_001064 3300053125 Bacteria 13600
235 Ga0501084_0012869 3300054114 Bacteria 6931
236 Ga0501084_0107321 3300054114 Bacteria 2346
237 Ga0501084_0108512 3300054114 Bacteria 2332
238 2856327055 2856320880 Bacteria 7263508
239 2874143909 2874139085 Bacteria 7021506
240 2876377026 2876369609 Bacteria 6807521
241 2878744908 2878738818 Bacteria 7136951
242 2881153348 2881147464 Bacteria 7779814
243 2924719046 2924718760 Bacteria 6331356
244 2924783045 2924776078 Bacteria 7492003
245 2937884009 2937877337 Bacteria 7246526
246 2958069210 2958064165 Bacteria 7158582
247 2958091320 2958084443 Bacteria 7312792
248 2958151852 2958144490 Bacteria 6677056
249 2968018759 2968016561 Bacteria 7022047
250 2970471068 2970469710 Bacteria 6969209
251 2996349332 2996348954 Bacteria 7239054
252 3000140018 3000135777 Bacteria 6891109
253 3004276044 3004275668 Bacteria 7114440
254 8004642740 8004640170 Bacteria 6723001
255 8055303852 8055301274 Bacteria 8587385
256 Ga0495668_0011357
257 JGI24735J21928_10084235
258 JGI25165J46597_1000025
259 JGI25165J46597_1000093
260 Ga0065715_10127473
261 Ga0065707_10082065
262 Ga0070677_10067820
263 Ga0070660_100091829
264 Ga0070692_10011839
265 Ga0070668_100062099
266 Ga0070669_100039180
267 Ga0070669_100136882
268 Ga0070673_100177784
269 Ga0070659_100004185
270 Ga0070659_100035805
271 Ga0070659_100077712
272 Ga0070694_100051250
273 Ga0070662_100049549
274 Ga0068867_100324183
275 Ga0068853_100098439
276 Ga0068853_100121150
277 Ga0068853_100320789
278 Ga0070672_100081263
279 Ga0070695_100162676
280 Ga0070693_100163123
281 Ga0070665_100015414
282 Ga0068855_100059737
283 Ga0068854_100096942
284 Ga0068852_100103060
285 Ga0068859_100058820
286 Ga0068859_100136371
287 Ga0068863_100036602
288 Ga0068863_100123770
289 Ga0068858_100012384
290 Ga0068858_100041212
291 Ga0068860_100011501
292 Ga0068862_100096290
293 Ga0081455_10257053
294 Ga0081538_10012399
295 Ga0081538_10018017
296 Ga0081539_10160775
297 Ga0097621_100194400
298 Ga0068871_100091151
299 Ga0068865_100249357
300 Ga0097620_100058825
301 Ga0097620_100136364
302 Ga0099794_10159977
303 Ga0105251_10202521
304 Ga0105250_10000502
305 Ga0105240_10003013
306 Ga0114129_10095069
307 Ga0105243_10104883
308 Ga0105248_10106791
309 Ga0105237_10144527
310 Ga0105237_10263511
311 Ga0105249_10032103
312 Ga0105239_10010303
313 Ga0105239_10523846
314 Ga0105246_10114012
315 Ga0157373_10034758
316 Ga0157371_10133312
317 Ga0157370_10359357
318 Ga0157374_10080738
319 Ga0163162_10070259
320 Ga0157372_10353182
321 Ga0182008_10048181
322 Ga0157379_10096042
323 Ga0163161_10000389
324 Ga0209233_1000053
325 Ga0207696_1002521
326 Ga0207713_1117809
327 Ga0207647_10001281
328 Ga0207654_10413768
329 Ga0207695_10036801
330 Ga0207671_10082939
331 Ga0207671_10283544
332 Ga0207657_10006333
333 Ga0207657_10287833
334 Ga0207657_10392437
335 Ga0207681_10012796
336 Ga0207681_10241156
337 Ga0207681_10554911
338 Ga0207644_10057457
339 Ga0207690_10004216
340 Ga0207690_10152610
341 Ga0207706_10005097
342 Ga0207709_10147831
343 Ga0207691_10009544
344 Ga0207711_10022477
345 Ga0207689_10438132
346 Ga0207667_10262686
347 Ga0207651_10057540
348 Ga0207651_10223385
349 Ga0207712_10002447
350 Ga0207668_10167068
351 Ga0207640_10481903
352 Ga0207703_10010867
353 Ga0207639_10039197
354 Ga0207639_10300972
355 Ga0207702_10061144
356 Ga0207641_10102106
357 Ga0207641_10415970
358 Ga0207674_10002909
359 Ga0207674_10084907
360 Ga0209371_1001665
361 Ga0268265_10047509
362 Ga0268264_10001863
363 Ga0268264_10069779
364 Ga0265334_10000021
365 Ga0268256_1001453
366 Ga0265331_10014422
367 Ga0265313_10000275
368 Ga0307413_10020159
369 Ga0307410_10006852
370 Ga0307407_10012847
371 Ga0307412_10360182
372 Ga0307409_100018512
373 Ga0307414_10015758
374 Ga0307411_10000757
375 Ga0307411_10232503
376 Ga0307415_100010709
377 Ga0307415_100153583
378 Ga0316574_0020076
379 Ga0373925_0144514
380 Ga0395900_0010722
381 Ga0395900_0033551
382 Ga0395905_0005321
383 Ga0395905_0006999
384 Ga0395905_0019858
385 Ga0395905_0059056
386 Ga0395905_0288250
387 Ga0395901_0042030
388 Ga0395901_0613434
389 Ga0436360_0788616
390 Ga0436360_1137707
391 Ga0451576_0088914
392 Ga0495590_0006109
393 Ga0495605_0000093
394 Ga0495605_0000671
395 Ga0495584_0000056
396 Ga0495583_0000086
397 Ga0495583_0000327
398 Ga0495606_0080764
399 Ga0495620_0011351
400 Ga0495637_0059880
401 Ga0495642_0101773
402 Ga0495654_0000117
403 Ga0495654_0176433
404 Ga0495597_0017228
405 Ga0495611_0025454
406 Ga0495659_0000023
407 Ga0495669_0000551
408 Ga0495669_0001590
409 Ga0495669_0019713
410 Ga0495669_0057385
411 Ga0495671_0000085
412 Ga0495671_0008551
413 Ga0495649_0000283
414 Ga0495589_0002902
415 Ga0495660_0050187
416 Ga0495672_0000450
417 Ga0495672_0000537
418 Ga0495672_0098650
419 Ga0495683_0000597
420 Ga0495683_0001372
421 Ga0495677_0032936
422 Ga0495677_0106926
423 Ga0495673_0002663
424 Ga0495602_0059072
425 Ga0495602_0131939
426 Ga0495626_0000887
427 Ga0495626_0025020
428 Ga0496102_0142324
429 Ga0496103_0078071
430 Ga0496108_0041476
431 Ga0496108_0127884
432 Ga0496109_0021122
433 Ga0496110_0048694
434 Ga0496111_0057267
435 Ga0496112_0060166
436 Ga0496112_0118815
437 Ga0496124_0003049
438 Ga0496124_0021950
439 Ga0496126_0198802
440 Ga0495682_0000247
441 Ga0495682_0021906
442 Ga0495682_0116243
443 Ga0501031_0003278
444 Ga0501031_0201741
445 Ga0501032_0216399
446 Ga0501036_0087607
447 Ga0501036_0104222
448 Ga0501036_0381864
449 Ga0501037_0062938
450 Ga0501038_0368731
451 Ga0501039_0005089
452 Ga0501040_0000097
453 Ga0501040_0005355
454 Ga0501040_0007189
455 Ga0501040_0059080
456 Ga0501041_0001952
457 Ga0501042_0000054
458 Ga0501042_0004380
459 Ga0501042_0009673
460 Ga0501042_0070916
461 Ga0501043_0074736
462 Ga0501046_0169849
463 Ga0501047_0501266
464 Ga0501048_0014218
465 Ga0501048_0108721
466 Ga0501048_0412634
467 Ga0501068_0429322
468 Ga0501071_0003747
469 Ga0501071_0177049
470 Ga0501072_0008794
471 Ga0501072_0009998
472 Ga0501074_0022862
473 Ga0501075_0014693
474 Ga0501075_0076258
475 Ga0501075_0180240
476 Ga0501076_0002701
477 Ga0501076_0274684
478 Ga0501076_0277284
479 Ga0501077_0056077
480 Ga0501079_0059382
481 Ga0501079_0070862
482 Ga0501079_0339306
483 Ga0501079_0508616
484 Ga0501080_0028503
485 Ga0501080_0219605
486 Ga0501081_0007970
487 Ga0501045_0017803
488 Ga0501045_0253117
489 Ga0500618_001064
490 Ga0501084_0012869
491 Ga0501084_0107321
492 Ga0501084_0108512
493 2856327055
494 2874143909
495 2876377026
496 2878744908
497 2881153348
498 2924719046
499 2924783045
500 2937884009
501 2958069210
502 2958091320
503 2958151852
504 2968018759
505 2970471068
506 2996349332
507 3000140018
508 3004276044
509 8004642740
510 8055303852

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

38

207

0.75

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

41

229

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hp5-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase 0.9611 1 236
8hp7-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase k152a mutant trapped with (2r)-4-amino-2-hydroxybutanoic acid 0.9597 1 236
8hp6-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase d12a mutant 0.9587 1 236
8hp5-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase 0.9533 1 236
8hp7-assembly3.cif.gz_C crystal structure of (s)-2-haloacid dehalogenase k152a mutant trapped with (2r)-4-amino-2-hydroxybutanoic acid 0.9519 1 236
ID Description Score Start End Superfamily
3smvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9794 1 236 3.40.50.1000
3smvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9609 1 236 3.40.50.1000
3i76A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8707 99 233 3.40.50.1000
3smvA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1; 0.8694 20 93 1.10.150.750
1zrmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8684 6 230 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W4JUE6-F1-model_v4 HAD hydrolase-like protein 0.9835 97 235 GO:0016787
AF-A0A7W0KHM1-F1-model_v4 Haloacid dehalogenase 0.9814 1 196
AF-A0A2D5XWP4-F1-model_v4 Haloacid dehalogenase 0.981 78 236
AF-A0A6L8I7D8-F1-model_v4 HAD-IA family hydrolase 0.9764 1 170 GO:0016787
AF-A0A3M1GIU3-F1-model_v4 Haloacid dehalogenase 0.9763 6 235

Map