F365894

General Info

Members Datasets Scaffolds Average Seq Length
255 166 510 178

Family's Representative Sequence

Representative Sequence 3300042131|Ga0450894_000445|Ga0450894_000445_195_806
Length 203
Sequence VTATANPAAARSGQNGKPFLYVVVCAAGIAGEVGRLITAAQERNWEVGVIATPVALGGFFDPAAVEAQTGRPIRSAWRRPGDPRPFPPPDAVVVAPATFNTVNKWAAGLADTLAVGTLCEASGLGVPVAVLPCVADALAAHPAYRASLERLRGMGVRFGDPYAGEGDEDGGRGEFHWERALDLLEADGGRRRSGGPAGRTSGR

Samples

Sample ID Description Type Environment
1 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
9 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
13 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
15 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
16 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
19 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
20 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
21 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
22 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
23 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
24 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
25 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
26 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
27 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
28 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
29 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
30 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
31 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
32 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
33 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
34 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
35 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
36 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
37 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
38 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
39 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
40 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
41 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
42 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
43 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
44 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
48 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
49 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
62 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
63 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
66 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
67 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
68 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
69 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
72 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
73 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
74 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
75 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
78 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
84 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
95 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
100 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
101 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
117 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
139 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
140 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
141 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
142 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
145 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
146 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
147 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
148 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
149 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
150 2808606448 Streptomyces sp. 193411 Isolate Unclassified
151 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
152 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
153 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
154 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
155 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
156 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
157 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
158 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
159 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
160 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
161 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
162 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
163 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
164 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
165 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
166 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.98
Metatranscriptomes 0
Isolates 9.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.31
Nodule 0.78
Rhizoplane 0.39
Rhizosphere 81.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450894_000445 3300042131 Bacteria 7069
2 JGI24737J22298_10042905 3300001990 Bacteria 1385
3 JGI24738J21930_10021175 3300002075 Bacteria 1349
4 Ga0081455_10124111 3300005937 Bacteria 2029
5 Ga0075368_10033264 3300006042 Bacteria 2006
6 Ga0075363_100009341 3300006048 Bacteria 4608
7 Ga0075367_10000426 3300006178 Bacteria 15627
8 Ga0105239_10508924 3300010375 Bacteria 1369
9 Ga0157369_10169271 3300013105 Bacteria 2303
10 Ga0157372_10723796 3300013307 Bacteria 1157
11 Ga0182008_10000517 3300014497 Bacteria 28996
12 Ga0182007_10004522 3300015262 Bacteria 6288
13 Ga0207647_10026552 3300025904 Bacteria 3787
14 Ga0209813_10036034 3300027866 Bacteria 1484
15 Ga0307515_10000475 3300028794 Bacteria 96024
16 Ga0307515_10054528 3300028794 Bacteria 5867
17 Ga0307515_10133959 3300028794 Bacteria 2708
18 Ga0307511_10041277 3300030521 Bacteria 3899
19 Ga0307511_10210987 3300030521 Bacteria 991
20 Ga0307512_10005450 3300030522 Bacteria 13284
21 Ga0307512_10079055 3300030522 Bacteria 2378
22 Ga0307513_10006833 3300031456 Bacteria 14868
23 Ga0307513_10138681 3300031456 Bacteria 2362
24 Ga0307509_10048076 3300031507 Bacteria 4584
25 Ga0307509_10360701 3300031507 Bacteria 1173
26 Ga0307508_10053887 3300031616 Bacteria 3567
27 Ga0307508_10215818 3300031616 Bacteria 1518
28 Ga0307514_10008253 3300031649 Bacteria 8887
29 Ga0307514_10082216 3300031649 Bacteria 2377
30 Ga0307514_10310037 3300031649 Bacteria 876
31 Ga0307516_10046117 3300031730 Bacteria 4302
32 Ga0307516_10312072 3300031730 Bacteria 1246
33 Ga0307518_10039571 3300031838 Bacteria 3427
34 Ga0307518_10088516 3300031838 Bacteria 2229
35 Ga0307518_10143331 3300031838 Bacteria 1663
36 Ga0307507_10010004 3300033179 Bacteria 12426
37 Ga0307510_10012308 3300033180 Bacteria 10147
38 Ga0395900_0564026 3300037418 Bacteria 1082
39 Ga0395898_0040466 3300037466 Bacteria 4609
40 Ga0395901_0089881 3300038443 Bacteria 3214
41 Ga0439436_0022099 3300041404 Bacteria 1885
42 Ga0439439_0000535 3300041406 Bacteria 6587
43 Ga0439465_0112406 3300041413 Bacteria 949
44 Ga0451853_0189088 3300041512 Bacteria 1805
45 Ga0439433_0002338 3300041999 Bacteria 4012
46 Ga0439442_062765 3300042002 Bacteria 788
47 Ga0439449_0000637 3300042007 Bacteria 13150
48 Ga0439449_0026679 3300042007 Bacteria 2156
49 Ga0439457_016911 3300042014 Bacteria 1623
50 Ga0439457_019176 3300042014 Bacteria 1519
51 Ga0439462_0044281 3300042015 Bacteria 1191
52 Ga0450898_005544 3300042134 Bacteria 1911
53 Ga0450899_002623 3300042135 Bacteria 1942
54 Ga0450903_025212 3300042138 Bacteria 910
55 Ga0450906_008328 3300042145 Bacteria 2010
56 Ga0466965_0004280 3300044683 Bacteria 6346
57 Ga0466966_0099860 3300044684 Bacteria 1796
58 Ga0466966_0424046 3300044684 Bacteria 799
59 Ga0466961_0000403 3300044693 Bacteria 27800
60 Ga0466964_0000909 3300044706 Bacteria 9712
61 Ga0466971_0004038 3300044719 Bacteria 6317
62 Ga0466970_0000470 3300044765 Bacteria 19986
63 Ga0466970_0014007 3300044765 Bacteria 4114
64 Ga0466957_0000355 3300044842 Bacteria 22485
65 Ga0466960_0245407 3300044901 Bacteria 993
66 Ga0466959_0002377 3300045049 Bacteria 11999
67 Ga0466958_0001104 3300045836 Bacteria 12428
68 Ga0466967_0044113 3300045976 Bacteria 3865
69 Ga0466967_0048838 3300045976 Bacteria 3698
70 Ga0466967_0091269 3300045976 Bacteria 2768
71 Ga0495617_118275 3300046452 Bacteria 854
72 Ga0495627_097329 3300046453 Bacteria 842
73 Ga0495592_0090215 3300046454 Bacteria 2199
74 Ga0495603_0014483 3300046455 Bacteria 4769
75 Ga0495603_0086088 3300046455 Bacteria 1839
76 Ga0495629_0007248 3300046459 Bacteria 8168
77 Ga0495629_0013605 3300046459 Bacteria 5871
78 Ga0495629_0044592 3300046459 Bacteria 3112
79 Ga0495629_0174363 3300046459 Bacteria 1491
80 Ga0495629_0179282 3300046459 Bacteria 1469
81 Ga0495629_0284059 3300046459 Bacteria 1135
82 Ga0495638_0031490 3300046460 Bacteria 3409
83 Ga0495651_0013802 3300046462 Bacteria 6249
84 Ga0495605_0025438 3300046474 Bacteria 3084
85 Ga0495662_0013590 3300046476 Bacteria 3962
86 Ga0495662_0028786 3300046476 Bacteria 2682
87 Ga0495662_0154941 3300046476 Bacteria 1128
88 Ga0495664_0000157 3300046477 Bacteria 33463
89 Ga0495584_0305441 3300046491 Bacteria 808
90 Ga0495585_0193691 3300046492 Bacteria 1038
91 Ga0495594_0023853 3300046499 Bacteria 3281
92 Ga0495594_0057982 3300046499 Bacteria 2138
93 Ga0495594_0102697 3300046499 Bacteria 1608
94 Ga0495596_0069656 3300046500 Bacteria 1367
95 Ga0495596_0095692 3300046500 Bacteria 1153
96 Ga0495607_0115178 3300046501 Bacteria 1419
97 Ga0495583_0036459 3300046506 Bacteria 2339
98 Ga0495583_0124467 3300046506 Bacteria 1082
99 Ga0495583_0321262 3300046506 Bacteria 613
100 Ga0495606_0007291 3300046507 Bacteria 9962
101 Ga0495608_0256817 3300046511 Bacteria 1089
102 Ga0495610_0038650 3300046512 Bacteria 2421
103 Ga0495616_0008376 3300046513 Bacteria 6132
104 Ga0495618_0072889 3300046514 Bacteria 2185
105 Ga0495620_0003368 3300046515 Bacteria 9158
106 Ga0495620_0011341 3300046515 Bacteria 4649
107 Ga0495628_0124630 3300046516 Bacteria 1974
108 Ga0495628_0127372 3300046516 Bacteria 1949
109 Ga0495630_0144312 3300046517 Bacteria 1810
110 Ga0495630_0245588 3300046517 Bacteria 1368
111 Ga0495631_0248963 3300046518 Bacteria 757
112 Ga0495643_0002749 3300046522 Bacteria 13509
113 Ga0495648_0088746 3300046524 Bacteria 1737
114 Ga0495666_0026436 3300046526 Bacteria 2860
115 Ga0495640_0013438 3300046533 Bacteria 6220
116 Ga0495640_0177272 3300046533 Bacteria 1360
117 Ga0495587_0006543 3300046536 Bacteria 7586
118 Ga0495587_0253933 3300046536 Bacteria 988
119 Ga0495609_0163182 3300046538 Bacteria 943
120 Ga0495597_0065669 3300046542 Bacteria 1573
121 Ga0495597_0262227 3300046542 Bacteria 676
122 Ga0495645_0245496 3300046543 Bacteria 1192
123 Ga0495645_0250306 3300046543 Bacteria 1178
124 Ga0495622_0092402 3300046557 Bacteria 1389
125 Ga0495633_0075187 3300046558 Bacteria 1573
126 Ga0495668_0006551 3300046616 Bacteria 7607
127 Ga0495634_0024092 3300046642 Bacteria 4274
128 Ga0495634_0120537 3300046642 Bacteria 1680
129 Ga0495634_0311152 3300046642 Bacteria 950
130 Ga0495611_0015991 3300046648 Bacteria 3207
131 Ga0495625_0013746 3300046660 Bacteria 6490
132 Ga0495625_0097559 3300046660 Bacteria 2022
133 Ga0495635_0002714 3300046663 Bacteria 12118
134 Ga0495635_0055798 3300046663 Bacteria 2721
135 Ga0495635_0174215 3300046663 Bacteria 1463
136 Ga0495661_0064191 3300046665 Bacteria 2168
137 Ga0495588_0004380 3300046674 Bacteria 6236
138 Ga0495588_0024897 3300046674 Bacteria 2977
139 Ga0495588_0187911 3300046674 Bacteria 1091
140 Ga0495657_0013282 3300046675 Bacteria 6080
141 Ga0495623_0091592 3300046679 Bacteria 1865
142 Ga0495646_0346789 3300046680 Bacteria 778
143 Ga0495613_0006692 3300046689 Bacteria 8606
144 Ga0495613_0059359 3300046689 Bacteria 2804
145 Ga0495613_0193535 3300046689 Bacteria 1436
146 Ga0495613_0287553 3300046689 Bacteria 1140
147 Ga0495624_0456548 3300046690 Bacteria 765
148 Ga0495649_0046170 3300046694 Bacteria 2372
149 Ga0495649_0186249 3300046694 Bacteria 1081
150 Ga0495649_0298297 3300046694 Bacteria 821
151 Ga0495589_0009442 3300046794 Bacteria 5074
152 Ga0495589_0036252 3300046794 Bacteria 2472
153 Ga0495600_0081837 3300046809 Bacteria 2107
154 Ga0495600_0190364 3300046809 Bacteria 1319
155 Ga0495581_0088362 3300047315 Bacteria 1797
156 Ga0495604_0000533 3300047317 Bacteria 33502
157 Ga0495636_0016756 3300047318 Bacteria 2930
158 Ga0495636_0228402 3300047318 Bacteria 856
159 Ga0495674_0999180 3300047319 Bacteria 641
160 Ga0495676_0003444 3300047321 Bacteria 14317
161 Ga0495676_0015921 3300047321 Bacteria 6682
162 Ga0495676_0044188 3300047321 Bacteria 3638
163 Ga0495680_0007332 3300047322 Bacteria 10143
164 Ga0495683_0150517 3300047323 Bacteria 1083
165 Ga0495687_005980 3300047443 Bacteria 7584
166 Ga0495687_036889 3300047443 Bacteria 2182
167 Ga0495687_049760 3300047443 Bacteria 1789
168 Ga0495687_061199 3300047443 Bacteria 1549
169 Ga0495687_095471 3300047443 Bacteria 1127
170 Ga0495675_0033288 3300047444 Bacteria 3290
171 Ga0495685_000546 3300047447 Bacteria 11653
172 Ga0495685_010239 3300047447 Bacteria 3142
173 Ga0495685_022826 3300047447 Bacteria 2153
174 Ga0495681_0021824 3300047470 Bacteria 3440
175 Ga0495681_0137399 3300047470 Bacteria 1035
176 Ga0495686_0005138 3300047472 Bacteria 10450
177 Ga0495686_0152773 3300047472 Bacteria 1354
178 Ga0495686_0525086 3300047472 Bacteria 621
179 Ga0495593_0018466 3300047673 Bacteria 3917
180 Ga0495593_0036424 3300047673 Bacteria 2668
181 Ga0495614_0007420 3300048089 Bacteria 4882
182 Ga0495614_0012799 3300048089 Bacteria 3681
183 Ga0495614_0150001 3300048089 Bacteria 1039
184 Ga0495614_0255415 3300048089 Bacteria 802
185 Ga0495626_0032813 3300048091 Bacteria 2491
186 Ga0496109_0027096 3300048912 Bacteria 5115
187 Ga0501031_0072847 3300049568 Bacteria 2236
188 Ga0501031_0792883 3300049568 Bacteria 607
189 Ga0501032_0031708 3300049569 Bacteria 3623
190 Ga0501032_0254506 3300049569 Bacteria 1139
191 Ga0501032_0502396 3300049569 Bacteria 775
192 Ga0501033_0010021 3300049570 Bacteria 7278
193 Ga0501033_0033374 3300049570 Bacteria 3864
194 Ga0501034_0011198 3300049571 Bacteria 9311
195 Ga0501034_0043807 3300049571 Bacteria 4527
196 Ga0501036_0253281 3300049572 Bacteria 1475
197 Ga0501036_0429435 3300049572 Bacteria 1101
198 Ga0501037_0086388 3300049573 Bacteria 2271
199 Ga0501037_0262892 3300049573 Bacteria 1205
200 Ga0501038_0020802 3300049574 Bacteria 5897
201 Ga0501038_0036028 3300049574 Bacteria 4342
202 Ga0501039_0240561 3300049575 Bacteria 1423
203 Ga0501043_0007117 3300049579 Bacteria 8902
204 Ga0501043_0227301 3300049579 Bacteria 1442
205 Ga0501046_0016549 3300049580 Bacteria 6168
206 Ga0501046_0077234 3300049580 Bacteria 2578
207 Ga0501047_0005685 3300049581 Bacteria 11733
208 Ga0501047_0022190 3300049581 Bacteria 6099
209 Ga0501047_0047110 3300049581 Bacteria 4165
210 Ga0501048_0008362 3300049582 Bacteria 7823
211 Ga0501048_0133729 3300049582 Bacteria 1752
212 Ga0501070_0232919 3300049586 Bacteria 1509
213 Ga0501070_0531359 3300049586 Bacteria 943
214 Ga0501080_0056362 3300049742 Bacteria 3660
215 Ga0501035_0002387 3300049822 Bacteria 18449
216 Ga0501035_0059818 3300049822 Bacteria 3393
217 Ga0501035_0076838 3300049822 Bacteria 2952
218 Ga0501035_0091080 3300049822 Bacteria 2684
219 Ga0501044_0006252 3300049823 Bacteria 13165
220 Ga0501044_0024575 3300049823 Bacteria 6393
221 Ga0501044_0118275 3300049823 Bacteria 2653
222 Ga0501044_0152493 3300049823 Bacteria 2292
223 Ga0501045_0078676 3300049824 Bacteria 2431
224 nmdc:mga03n38_3316_c1 3300050490 Bacteria 5151
225 nmdc:mga06z11_40268_c1 3300050494 Bacteria 2331
226 nmdc:mga04h51_43032_c1 3300050495 Bacteria 1484
227 Ga0500640_039016 3300053095 Bacteria 2086
228 Ga0500650_0184234 3300053098 Bacteria 956
229 Ga0500560_001498 3300053107 Bacteria 4085
230 Ga0500573_0202175 3300053140 Bacteria 1054
231 Ga0466962_0000374 3300061719 Bacteria 19303
232 Ga0466962_0073431 3300061719 Bacteria 1635
233 2547409332 2547132111 Bacteria 8013147
234 2585315138 2582581314 Bacteria 11452267
235 2616696357 2616644814 Bacteria 11555299
236 2784592288 2784132148 Bacteria 8627943
237 2785339280 2784746763 Bacteria 9783172
238 2808915530 2808606375 Bacteria 9466072
239 2809235931 2808606448 Bacteria 8656184
240 2812353902 2811994879 Bacteria 9313447
241 2812483061 2811994917 Bacteria 7761064
242 2852639095 2852635781 Bacteria 8251373
243 2862282718 2862281513 Bacteria 9621493
244 2862385566 2862382967 Bacteria 10317375
245 2912715599 2912715099 Bacteria 9460473
246 2912728416 2912723979 Bacteria 8557534
247 2946071794 2946064051 Bacteria 8957905
248 2947232683 2947224130 Bacteria 9938529
249 2990064367 2990059506 Bacteria 9321252
250 3006396444 3006393351 Bacteria 6615579
251 3006495787 3006493962 Bacteria 8825450
252 8008564701 8008558824 Bacteria 10610750
253 8023626588 8023623736 Bacteria 8593882
254 8048411233 8048406513 Bacteria 8936924
255 8056832355 8056829672 Bacteria 9045328
256 Ga0450894_000445
257 JGI24737J22298_10042905
258 JGI24738J21930_10021175
259 Ga0081455_10124111
260 Ga0075368_10033264
261 Ga0075363_100009341
262 Ga0075367_10000426
263 Ga0105239_10508924
264 Ga0157369_10169271
265 Ga0157372_10723796
266 Ga0182008_10000517
267 Ga0182007_10004522
268 Ga0207647_10026552
269 Ga0209813_10036034
270 Ga0307515_10000475
271 Ga0307515_10054528
272 Ga0307515_10133959
273 Ga0307511_10041277
274 Ga0307511_10210987
275 Ga0307512_10005450
276 Ga0307512_10079055
277 Ga0307513_10006833
278 Ga0307513_10138681
279 Ga0307509_10048076
280 Ga0307509_10360701
281 Ga0307508_10053887
282 Ga0307508_10215818
283 Ga0307514_10008253
284 Ga0307514_10082216
285 Ga0307514_10310037
286 Ga0307516_10046117
287 Ga0307516_10312072
288 Ga0307518_10039571
289 Ga0307518_10088516
290 Ga0307518_10143331
291 Ga0307507_10010004
292 Ga0307510_10012308
293 Ga0395900_0564026
294 Ga0395898_0040466
295 Ga0395901_0089881
296 Ga0439436_0022099
297 Ga0439439_0000535
298 Ga0439465_0112406
299 Ga0451853_0189088
300 Ga0439433_0002338
301 Ga0439442_062765
302 Ga0439449_0000637
303 Ga0439449_0026679
304 Ga0439457_016911
305 Ga0439457_019176
306 Ga0439462_0044281
307 Ga0450898_005544
308 Ga0450899_002623
309 Ga0450903_025212
310 Ga0450906_008328
311 Ga0466965_0004280
312 Ga0466966_0099860
313 Ga0466966_0424046
314 Ga0466961_0000403
315 Ga0466964_0000909
316 Ga0466971_0004038
317 Ga0466970_0000470
318 Ga0466970_0014007
319 Ga0466957_0000355
320 Ga0466960_0245407
321 Ga0466959_0002377
322 Ga0466958_0001104
323 Ga0466967_0044113
324 Ga0466967_0048838
325 Ga0466967_0091269
326 Ga0495617_118275
327 Ga0495627_097329
328 Ga0495592_0090215
329 Ga0495603_0014483
330 Ga0495603_0086088
331 Ga0495629_0007248
332 Ga0495629_0013605
333 Ga0495629_0044592
334 Ga0495629_0174363
335 Ga0495629_0179282
336 Ga0495629_0284059
337 Ga0495638_0031490
338 Ga0495651_0013802
339 Ga0495605_0025438
340 Ga0495662_0013590
341 Ga0495662_0028786
342 Ga0495662_0154941
343 Ga0495664_0000157
344 Ga0495584_0305441
345 Ga0495585_0193691
346 Ga0495594_0023853
347 Ga0495594_0057982
348 Ga0495594_0102697
349 Ga0495596_0069656
350 Ga0495596_0095692
351 Ga0495607_0115178
352 Ga0495583_0036459
353 Ga0495583_0124467
354 Ga0495583_0321262
355 Ga0495606_0007291
356 Ga0495608_0256817
357 Ga0495610_0038650
358 Ga0495616_0008376
359 Ga0495618_0072889
360 Ga0495620_0003368
361 Ga0495620_0011341
362 Ga0495628_0124630
363 Ga0495628_0127372
364 Ga0495630_0144312
365 Ga0495630_0245588
366 Ga0495631_0248963
367 Ga0495643_0002749
368 Ga0495648_0088746
369 Ga0495666_0026436
370 Ga0495640_0013438
371 Ga0495640_0177272
372 Ga0495587_0006543
373 Ga0495587_0253933
374 Ga0495609_0163182
375 Ga0495597_0065669
376 Ga0495597_0262227
377 Ga0495645_0245496
378 Ga0495645_0250306
379 Ga0495622_0092402
380 Ga0495633_0075187
381 Ga0495668_0006551
382 Ga0495634_0024092
383 Ga0495634_0120537
384 Ga0495634_0311152
385 Ga0495611_0015991
386 Ga0495625_0013746
387 Ga0495625_0097559
388 Ga0495635_0002714
389 Ga0495635_0055798
390 Ga0495635_0174215
391 Ga0495661_0064191
392 Ga0495588_0004380
393 Ga0495588_0024897
394 Ga0495588_0187911
395 Ga0495657_0013282
396 Ga0495623_0091592
397 Ga0495646_0346789
398 Ga0495613_0006692
399 Ga0495613_0059359
400 Ga0495613_0193535
401 Ga0495613_0287553
402 Ga0495624_0456548
403 Ga0495649_0046170
404 Ga0495649_0186249
405 Ga0495649_0298297
406 Ga0495589_0009442
407 Ga0495589_0036252
408 Ga0495600_0081837
409 Ga0495600_0190364
410 Ga0495581_0088362
411 Ga0495604_0000533
412 Ga0495636_0016756
413 Ga0495636_0228402
414 Ga0495674_0999180
415 Ga0495676_0003444
416 Ga0495676_0015921
417 Ga0495676_0044188
418 Ga0495680_0007332
419 Ga0495683_0150517
420 Ga0495687_005980
421 Ga0495687_036889
422 Ga0495687_049760
423 Ga0495687_061199
424 Ga0495687_095471
425 Ga0495675_0033288
426 Ga0495685_000546
427 Ga0495685_010239
428 Ga0495685_022826
429 Ga0495681_0021824
430 Ga0495681_0137399
431 Ga0495686_0005138
432 Ga0495686_0152773
433 Ga0495686_0525086
434 Ga0495593_0018466
435 Ga0495593_0036424
436 Ga0495614_0007420
437 Ga0495614_0012799
438 Ga0495614_0150001
439 Ga0495614_0255415
440 Ga0495626_0032813
441 Ga0496109_0027096
442 Ga0501031_0072847
443 Ga0501031_0792883
444 Ga0501032_0031708
445 Ga0501032_0254506
446 Ga0501032_0502396
447 Ga0501033_0010021
448 Ga0501033_0033374
449 Ga0501034_0011198
450 Ga0501034_0043807
451 Ga0501036_0253281
452 Ga0501036_0429435
453 Ga0501037_0086388
454 Ga0501037_0262892
455 Ga0501038_0020802
456 Ga0501038_0036028
457 Ga0501039_0240561
458 Ga0501043_0007117
459 Ga0501043_0227301
460 Ga0501046_0016549
461 Ga0501046_0077234
462 Ga0501047_0005685
463 Ga0501047_0022190
464 Ga0501047_0047110
465 Ga0501048_0008362
466 Ga0501048_0133729
467 Ga0501070_0232919
468 Ga0501070_0531359
469 Ga0501080_0056362
470 Ga0501035_0002387
471 Ga0501035_0059818
472 Ga0501035_0076838
473 Ga0501035_0091080
474 Ga0501044_0006252
475 Ga0501044_0024575
476 Ga0501044_0118275
477 Ga0501044_0152493
478 Ga0501045_0078676
479 nmdc:mga03n38_3316_c1
480 nmdc:mga06z11_40268_c1
481 nmdc:mga04h51_43032_c1
482 Ga0500640_039016
483 Ga0500650_0184234
484 Ga0500560_001498
485 Ga0500573_0202175
486 Ga0466962_0000374
487 Ga0466962_0073431
488 2547409332
489 2585315138
490 2616696357
491 2784592288
492 2785339280
493 2808915530
494 2809235931
495 2812353902
496 2812483061
497 2852639095
498 2862282718
499 2862385566
500 2912715599
501 2912728416
502 2946071794
503 2947232683
504 2990064367
505 3006396444
506 3006495787
507 8008564701
508 8023626588
509 8048411233
510 8056832355

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02441

Flavoprotein

Flavoprotein

19

165

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tgv-assembly1.cif.gz_C crystal structure of mycobacterium smegmatis coabc in complex with ctp and fmn 0.8252 7 176
6tgv-assembly1.cif.gz_A-3 crystal structure of mycobacterium smegmatis coabc in complex with ctp and fmn 0.8237 5 176
6tgv-assembly1.cif.gz_B crystal structure of mycobacterium smegmatis coabc in complex with ctp and fmn 0.8204 6 176
3mcu-assembly1.cif.gz_E crystal structure of the dipicolinate synthase chain b from bacillus cereus. northeast structural genomics consortium target bcr215. 0.8091 6 148
3mcu-assembly1.cif.gz_B crystal structure of the dipicolinate synthase chain b from bacillus cereus. northeast structural genomics consortium target bcr215. 0.8048 8 148
ID Description Score Start End Superfamily
af_Q58323_19_187_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8297 8 177 3.40.50.1950
af_K7LGA7_1_112_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8239 80 162 3.40.50.1950
af_P9WNZ1_7_185_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8137 6 176 3.40.50.1950
af_Q58323_19_187_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8076 8 177 3.40.50.1950
af_Q2G268_1_185_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8002 8 174 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A7K2JPU5-F1-model_v4 Flavoprotein 0.9792 82 177 GO:0003824
AF-A0A7K2JPU5-F1-model_v4 Flavoprotein 0.9693 82 177 GO:0003824
AF-A0A2G9DJS6-F1-model_v4 deleted 0.9679 5 177
AF-S5VDN1-F1-model_v4 Flavoprotein domain-containing protein 0.9643 1 177 GO:0004633
GO:0010181
GO:0015937
GO:0071513
AF-A0A542PMN6-F1-model_v4 deleted 0.9635 2 177

Map