F365824

General Info

Members Datasets Scaffolds Average Seq Length
255 191 510 159

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100043551|Ga0307416_1000435514
Length 186
Sequence MQPDERQQLIAQYTDGYRVVAEALVKATPEQLDAAPGPGKWTARQIVHHLADSEMTAAVRFRLLLAEDRPAIKGYDQDRFADRLHYERPHEASLELFRAARASTAELMGCLDESDWLREGTHSEVGRFGLDTWLRIYGPHAHRHAEQIRVALRAAAQAKEPADAISTKDTCLEGRGRRLRRDPSPS

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
181 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
190 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
191 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.41
Nodule 0
Rhizoplane 3.14
Rhizosphere 87.06
Stem 0
Stem Tuber 0
Unclassified 14.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100043551 3300032002 Bacteria 3516
2 JGI24751J29686_10033967 3300002459 Bacteria 1057
3 Ga0065712_10138898 3300005290 Bacteria 1469
4 Ga0065715_10463762 3300005293 Unclassified 773
5 Ga0065707_10095120 3300005295 Bacteria 3414
6 Ga0070683_100099158 3300005329 Bacteria 2742
7 Ga0070690_100017025 3300005330 Bacteria 4363
8 Ga0070690_100069201 3300005330 Bacteria 2290
9 Ga0070670_100010119 3300005331 Bacteria 8047
10 Ga0070670_100038608 3300005331 Bacteria 4106
11 Ga0070677_10073198 3300005333 Bacteria 1447
12 Ga0070677_10643330 3300005333 Bacteria 592
13 Ga0068869_100043104 3300005334 Bacteria 3239
14 Ga0068869_100549693 3300005334 Unclassified 970
15 Ga0070666_10008495 3300005335 Bacteria 6379
16 Ga0070666_10051544 3300005335 Bacteria 2772
17 Ga0068868_100320764 3300005338 Bacteria 1320
18 Ga0068868_100781193 3300005338 Unclassified 860
19 Ga0070660_100324534 3300005339 Bacteria 1265
20 Ga0070689_100041658 3300005340 Bacteria 3525
21 Ga0070691_10177902 3300005341 Bacteria 1106
22 Ga0070687_100167241 3300005343 Bacteria 1305
23 Ga0070661_100823101 3300005344 Bacteria 763
24 Ga0070661_100843052 3300005344 Unclassified 754
25 Ga0070661_100866293 3300005344 Bacteria 744
26 Ga0070668_100707140 3300005347 Bacteria 889
27 Ga0070669_100103133 3300005353 Bacteria 2154
28 Ga0070675_100244117 3300005354 Bacteria 1570
29 Ga0070671_100056071 3300005355 Bacteria 3278
30 Ga0070671_100319125 3300005355 Bacteria 1324
31 Ga0070674_100416224 3300005356 Bacteria 1102
32 Ga0070673_100003701 3300005364 Bacteria 9575
33 Ga0070688_100179605 3300005365 Bacteria 1467
34 Ga0070659_100294261 3300005366 Bacteria 1352
35 Ga0070659_100383762 3300005366 Bacteria 1184
36 Ga0070659_100396367 3300005366 Unclassified 1165
37 Ga0070667_100411810 3300005367 Bacteria 1232
38 Ga0070705_100252455 3300005440 Unclassified 1239
39 Ga0070694_100317740 3300005444 Bacteria 1198
40 Ga0070708_100264970 3300005445 Bacteria 1616
41 Ga0070678_100374061 3300005456 Bacteria 1231
42 Ga0070662_100062975 3300005457 Bacteria 2712
43 Ga0070662_100258581 3300005457 Bacteria 1402
44 Ga0070681_10169555 3300005458 Bacteria 2105
45 Ga0070681_11040546 3300005458 Bacteria 739
46 Ga0070681_11101191 3300005458 Bacteria 715
47 Ga0068867_100008828 3300005459 Bacteria 7113
48 Ga0070706_101296211 3300005467 Bacteria 668
49 Ga0070707_100604013 3300005468 Bacteria 1060
50 Ga0070699_100064873 3300005518 Bacteria 3168
51 Ga0070699_100465046 3300005518 Unclassified 1147
52 Ga0070699_100685359 3300005518 Bacteria 936
53 Ga0070679_100751429 3300005530 Unclassified 918
54 Ga0070684_100220861 3300005535 Bacteria 1729
55 Ga0070697_100712839 3300005536 Bacteria 885
56 Ga0070672_100020898 3300005543 Bacteria 4782
57 Ga0070686_100000485 3300005544 Bacteria 24083
58 Ga0070686_100023107 3300005544 Bacteria 3713
59 Ga0070695_100107299 3300005545 Bacteria 1889
60 Ga0070693_100021295 3300005547 Bacteria 3432
61 Ga0070664_100985795 3300005564 Bacteria 792
62 Ga0068857_100571914 3300005577 Bacteria 1066
63 Ga0068854_100001623 3300005578 Bacteria 13675
64 Ga0068854_100040378 3300005578 Bacteria 3292
65 Ga0068854_100231159 3300005578 Bacteria 1468
66 Ga0068856_100405456 3300005614 Bacteria 1383
67 Ga0068852_100031693 3300005616 Bacteria 4367
68 Ga0068864_100569313 3300005618 Bacteria 1097
69 Ga0068864_100614010 3300005618 Bacteria 1056
70 Ga0068851_10433899 3300005834 Bacteria 778
71 Ga0068863_100964884 3300005841 Unclassified 854
72 Ga0068858_100159106 3300005842 Bacteria 2126
73 Ga0068858_101097364 3300005842 Unclassified 781
74 Ga0068860_100025941 3300005843 Bacteria 5655
75 Ga0068860_100898656 3300005843 Unclassified 902
76 Ga0068862_100055993 3300005844 Bacteria 3378
77 Ga0081455_10221630 3300005937 Bacteria 1401
78 Ga0070717_10359298 3300006028 Bacteria 1303
79 Ga0075365_10185342 3300006038 Bacteria 1456
80 Ga0075368_10054977 3300006042 Bacteria 1587
81 Ga0075364_10004703 3300006051 Bacteria 7878
82 Ga0075364_10023344 3300006051 Bacteria 3916
83 Ga0075364_10057597 3300006051 Bacteria 2546
84 Ga0070716_100520829 3300006173 Unclassified 881
85 Ga0075362_10028984 3300006177 Bacteria 2382
86 Ga0075367_10108954 3300006178 Bacteria 1698
87 Ga0075367_10199854 3300006178 Bacteria 1249
88 Ga0075369_10158689 3300006186 Bacteria 1036
89 Ga0075366_10057120 3300006195 Bacteria 2319
90 Ga0075370_10001417 3300006353 Bacteria 10375
91 Ga0068871_100485134 3300006358 Bacteria 1112
92 Ga0075430_100196669 3300006846 Bacteria 1675
93 Ga0075431_100254062 3300006847 Bacteria 1785
94 Ga0075433_10574182 3300006852 Bacteria 991
95 Ga0075434_100000047 3300006871 Bacteria 57554
96 Ga0075434_100113051 3300006871 Bacteria 2727
97 Ga0075434_100312864 3300006871 Bacteria 1591
98 Ga0068865_100315932 3300006881 Bacteria 1255
99 Ga0075436_100000182 3300006914 Bacteria 39329
100 Ga0097620_100086571 3300006931 Bacteria 3180
101 Ga0075435_100000027 3300007076 Bacteria 84051
102 Ga0075435_100004678 3300007076 Bacteria 9439
103 Ga0075435_100532778 3300007076 Bacteria 1016
104 Ga0105240_10513633 3300009093 Bacteria 1330
105 Ga0105240_10664826 3300009093 Bacteria 1140
106 Ga0105240_10924290 3300009093 Unclassified 937
107 Ga0111539_10229337 3300009094 Bacteria 2162
108 Ga0111539_11419424 3300009094 Bacteria 805
109 Ga0105245_10081067 3300009098 Bacteria 2966
110 Ga0105247_10197485 3300009101 Bacteria 1350
111 Ga0114129_10253234 3300009147 Bacteria 2363
112 Ga0105243_10880414 3300009148 Bacteria 889
113 Ga0105241_10323541 3300009174 Bacteria 1331
114 Ga0105242_10100556 3300009176 Bacteria 2449
115 Ga0105248_10015381 3300009177 Bacteria 8440
116 Ga0105248_10092059 3300009177 Bacteria 3414
117 Ga0105237_11710736 3300009545 Unclassified 636
118 Ga0105238_10466055 3300009551 Bacteria 1261
119 Ga0105249_11434778 3300009553 Bacteria 762
120 Ga0105239_10042233 3300010375 Bacteria 4997
121 Ga0105239_11871468 3300010375 Unclassified 696
122 Ga0157370_10121887 3300013104 Bacteria 2435
123 Ga0157369_10437255 3300013105 Unclassified 1355
124 Ga0157378_10888933 3300013297 Bacteria 921
125 Ga0163162_11656754 3300013306 Bacteria 730
126 Ga0157372_10371935 3300013307 Bacteria 1665
127 Ga0157372_10793093 3300013307 Unclassified 1101
128 Ga0157375_10723358 3300013308 Bacteria 1148
129 Ga0163163_12423993 3300014325 Bacteria 583
130 Ga0157377_10406149 3300014745 Unclassified 929
131 Ga0206353_11385891 3300020082 Bacteria 1018
132 Ga0154015_1451187 3300020610 Bacteria 850
133 Ga0207697_10095729 3300025315 Bacteria 1262
134 Ga0207656_10030440 3300025321 Bacteria 2230
135 Ga0207682_10066081 3300025893 Bacteria 1524
136 Ga0207682_10471729 3300025893 Unclassified 594
137 Ga0207682_10507503 3300025893 Unclassified 571
138 Ga0207688_10150297 3300025901 Bacteria 1375
139 Ga0207680_10029896 3300025903 Bacteria 3066
140 Ga0207647_10199390 3300025904 Unclassified 1158
141 Ga0207645_10034203 3300025907 Bacteria 3265
142 Ga0207654_10533941 3300025911 Unclassified 832
143 Ga0207707_10034303 3300025912 Bacteria 4439
144 Ga0207707_10699825 3300025912 Bacteria 851
145 Ga0207695_10086081 3300025913 Bacteria 3170
146 Ga0207695_10140193 3300025913 Bacteria 2367
147 Ga0207662_10001391 3300025918 Bacteria 11688
148 Ga0207662_10122447 3300025918 Bacteria 1632
149 Ga0207649_10242628 3300025920 Bacteria 1294
150 Ga0207649_10322348 3300025920 Bacteria 1136
151 Ga0207649_11042090 3300025920 Unclassified 644
152 Ga0207646_10595159 3300025922 Bacteria 993
153 Ga0207681_10034898 3300025923 Bacteria 3311
154 Ga0207650_10030521 3300025925 Bacteria 3883
155 Ga0207650_10050516 3300025925 Bacteria 3075
156 Ga0207687_10034428 3300025927 Bacteria 3439
157 Ga0207690_10208669 3300025932 Bacteria 1488
158 Ga0207706_10042147 3300025933 Bacteria 4045
159 Ga0207686_10115108 3300025934 Bacteria 1821
160 Ga0207709_11175280 3300025935 Bacteria 632
161 Ga0207670_10020109 3300025936 Bacteria 4094
162 Ga0207669_10405606 3300025937 Bacteria 1069
163 Ga0207704_10238937 3300025938 Bacteria 1356
164 Ga0207665_10492833 3300025939 Bacteria 946
165 Ga0207691_10005436 3300025940 Bacteria 12303
166 Ga0207711_10111611 3300025941 Bacteria 2432
167 Ga0207711_11503248 3300025941 Unclassified 616
168 Ga0207689_10055037 3300025942 Bacteria 3275
169 Ga0207689_10451974 3300025942 Unclassified 1074
170 Ga0207661_10107027 3300025944 Bacteria 2358
171 Ga0207679_10774812 3300025945 Bacteria 873
172 Ga0207651_10001488 3300025960 Bacteria 10657
173 Ga0207668_10649852 3300025972 Bacteria 923
174 Ga0207640_10023801 3300025981 Bacteria 3686
175 Ga0207677_10433430 3300026023 Bacteria 1122
176 Ga0207703_10098727 3300026035 Bacteria 2470
177 Ga0207648_10004640 3300026089 Bacteria 14063
178 Ga0207676_10281146 3300026095 Bacteria 1511
179 Ga0207676_10541411 3300026095 Unclassified 1111
180 Ga0207676_12041449 3300026095 Bacteria 572
181 Ga0207674_10509594 3300026116 Bacteria 1162
182 Ga0207675_100063763 3300026118 Bacteria 3443
183 Ga0207675_100639902 3300026118 Bacteria 1069
184 Ga0207683_11468294 3300026121 Unclassified 630
185 Ga0207698_10032932 3300026142 Bacteria 3760
186 Ga0207698_10835269 3300026142 Unclassified 925
187 Ga0209813_10035515 3300027866 Archaea 1493
188 Ga0268265_10148807 3300028380 Bacteria 1972
189 Ga0268265_10513836 3300028380 Bacteria 1131
190 Ga0268264_10215071 3300028381 Bacteria 1767
191 Ga0307416_100049292 3300032002 Bacteria 3348
192 Ga0307416_101732974 3300032002 Bacteria 729
193 Ga0373930_0011133 3300034816 Bacteria 1620
194 Ga0373959_0152501 3300034820 Bacteria 585
195 Ga0373951_0018466 3300035091 Bacteria 1585
196 Ga0373962_0034177 3300035242 Bacteria 1407
197 Ga0373931_0029756 3300035691 Bacteria 2807
198 Ga0373927_0342658 3300035695 Bacteria 985
199 Ga0373947_0004675 3300035725 Bacteria 8024
200 Ga0395905_0805793 3300037471 Unclassified 842
201 Ga0395901_0770104 3300038443 Bacteria 954
202 Ga0436365_0315995 3300039437 Bacteria 1075
203 Ga0439439_0192600 3300041406 Bacteria 590
204 Ga0439431_0051250 3300041997 Bacteria 1070
205 Ga0439448_0192883 3300042005 Bacteria 713
206 Ga0439434_0182493 3300042435 Bacteria 703
207 Ga0439464_0228651 3300042439 Bacteria 598
208 Ga0439440_0060980 3300042993 Bacteria 963
209 Ga0466967_0403077 3300045976 Bacteria 1331
210 Ga0495630_0442740 3300046517 Bacteria 996
211 Ga0495634_0432971 3300046642 Unclassified 778
212 Ga0495635_0398658 3300046663 Unclassified 914
213 Ga0495624_0624250 3300046690 Bacteria 642
214 Ga0496101_0743545 3300048904 Bacteria 774
215 Ga0496101_0938689 3300048904 Bacteria 681
216 Ga0496102_0466929 3300048905 Bacteria 1183
217 Ga0496104_0550179 3300048907 Bacteria 1065
218 Ga0496104_1290132 3300048907 Bacteria 633
219 Ga0496106_0081576 3300048909 Bacteria 2485
220 Ga0496112_0472491 3300048915 Bacteria 1191
221 Ga0496113_0537150 3300048916 Bacteria 938
222 Ga0501034_0002146 3300049571 Bacteria 24492
223 Ga0501036_0715036 3300049572 Unclassified 827
224 Ga0501043_0638559 3300049579 Unclassified 783
225 Ga0501047_0667579 3300049581 Bacteria 858
226 Ga0501067_0025318 3300049583 Bacteria 3289
227 Ga0501067_0403046 3300049583 Bacteria 763
228 Ga0501069_0180751 3300049585 Bacteria 1219
229 nmdc:mga03683_137726_c1 3300050489 Bacteria 1096
230 nmdc:mga03n38_450918_c1 3300050490 Unclassified 715
231 nmdc:mga00v17_149197_c1 3300050491 Bacteria 1502
232 nmdc:mga00v17_18887_c1 3300050491 Bacteria 3924
233 nmdc:mga0yw44_344466_c1 3300050492 Bacteria 1003
234 nmdc:mga0k408_2937_c1 3300050493 Bacteria 9036
235 nmdc:mga0k408_48668_c1 3300050493 Bacteria 2453
236 nmdc:mga06z11_4588_c1 3300050494 Bacteria 5447
237 nmdc:mga04h51_29396_c1 3300050495 Unclassified 1721
238 nmdc:mga07m45_2323_c1 3300050496 Bacteria 8910
239 nmdc:mga07m45_303516_c1 3300050496 Unclassified 928
240 nmdc:mga05p37_185437_c1 3300050507 Bacteria 2530
241 nmdc:mga06r32_220481_c1 3300050510 Bacteria 1885
242 nmdc:mga08y16_1619933_c1 3300050511 Bacteria 605
243 nmdc:mga08y16_788576_c1 3300050511 Bacteria 944
244 nmdc:mga0n895_3_c1 3300050512 Bacteria 134167
245 nmdc:mga0n895_91690_c1 3300050512 Bacteria 3041
246 nmdc:mga0rr50_159083_c1 3300050513 Bacteria 1832
247 nmdc:mga0rr50_2861_c1 3300050513 Bacteria 9826
248 nmdc:mga0rr50_39_c1 3300050513 Bacteria 84395
249 nmdc:mga08x19_259_c1 3300050514 Bacteria 40273
250 nmdc:mga08x19_290315_c1 3300050514 Bacteria 1134
251 nmdc:mga08x19_54703_c1 3300050514 Bacteria 2570
252 nmdc:mga0a205_143289_c1 3300050515 Bacteria 2290
253 Ga0500628_016532 3300053129 Bacteria 1427
254 Ga0590075_000589 3300059424 Bacteria 9783
255 Ga0590077_000230 3300059426 Bacteria 16099
256 Ga0307416_100043551
257 JGI24751J29686_10033967
258 Ga0065712_10138898
259 Ga0065715_10463762
260 Ga0065707_10095120
261 Ga0070683_100099158
262 Ga0070690_100017025
263 Ga0070690_100069201
264 Ga0070670_100010119
265 Ga0070670_100038608
266 Ga0070677_10073198
267 Ga0070677_10643330
268 Ga0068869_100043104
269 Ga0068869_100549693
270 Ga0070666_10008495
271 Ga0070666_10051544
272 Ga0068868_100320764
273 Ga0068868_100781193
274 Ga0070660_100324534
275 Ga0070689_100041658
276 Ga0070691_10177902
277 Ga0070687_100167241
278 Ga0070661_100823101
279 Ga0070661_100843052
280 Ga0070661_100866293
281 Ga0070668_100707140
282 Ga0070669_100103133
283 Ga0070675_100244117
284 Ga0070671_100056071
285 Ga0070671_100319125
286 Ga0070674_100416224
287 Ga0070673_100003701
288 Ga0070688_100179605
289 Ga0070659_100294261
290 Ga0070659_100383762
291 Ga0070659_100396367
292 Ga0070667_100411810
293 Ga0070705_100252455
294 Ga0070694_100317740
295 Ga0070708_100264970
296 Ga0070678_100374061
297 Ga0070662_100062975
298 Ga0070662_100258581
299 Ga0070681_10169555
300 Ga0070681_11040546
301 Ga0070681_11101191
302 Ga0068867_100008828
303 Ga0070706_101296211
304 Ga0070707_100604013
305 Ga0070699_100064873
306 Ga0070699_100465046
307 Ga0070699_100685359
308 Ga0070679_100751429
309 Ga0070684_100220861
310 Ga0070697_100712839
311 Ga0070672_100020898
312 Ga0070686_100000485
313 Ga0070686_100023107
314 Ga0070695_100107299
315 Ga0070693_100021295
316 Ga0070664_100985795
317 Ga0068857_100571914
318 Ga0068854_100001623
319 Ga0068854_100040378
320 Ga0068854_100231159
321 Ga0068856_100405456
322 Ga0068852_100031693
323 Ga0068864_100569313
324 Ga0068864_100614010
325 Ga0068851_10433899
326 Ga0068863_100964884
327 Ga0068858_100159106
328 Ga0068858_101097364
329 Ga0068860_100025941
330 Ga0068860_100898656
331 Ga0068862_100055993
332 Ga0081455_10221630
333 Ga0070717_10359298
334 Ga0075365_10185342
335 Ga0075368_10054977
336 Ga0075364_10004703
337 Ga0075364_10023344
338 Ga0075364_10057597
339 Ga0070716_100520829
340 Ga0075362_10028984
341 Ga0075367_10108954
342 Ga0075367_10199854
343 Ga0075369_10158689
344 Ga0075366_10057120
345 Ga0075370_10001417
346 Ga0068871_100485134
347 Ga0075430_100196669
348 Ga0075431_100254062
349 Ga0075433_10574182
350 Ga0075434_100000047
351 Ga0075434_100113051
352 Ga0075434_100312864
353 Ga0068865_100315932
354 Ga0075436_100000182
355 Ga0097620_100086571
356 Ga0075435_100000027
357 Ga0075435_100004678
358 Ga0075435_100532778
359 Ga0105240_10513633
360 Ga0105240_10664826
361 Ga0105240_10924290
362 Ga0111539_10229337
363 Ga0111539_11419424
364 Ga0105245_10081067
365 Ga0105247_10197485
366 Ga0114129_10253234
367 Ga0105243_10880414
368 Ga0105241_10323541
369 Ga0105242_10100556
370 Ga0105248_10015381
371 Ga0105248_10092059
372 Ga0105237_11710736
373 Ga0105238_10466055
374 Ga0105249_11434778
375 Ga0105239_10042233
376 Ga0105239_11871468
377 Ga0157370_10121887
378 Ga0157369_10437255
379 Ga0157378_10888933
380 Ga0163162_11656754
381 Ga0157372_10371935
382 Ga0157372_10793093
383 Ga0157375_10723358
384 Ga0163163_12423993
385 Ga0157377_10406149
386 Ga0206353_11385891
387 Ga0154015_1451187
388 Ga0207697_10095729
389 Ga0207656_10030440
390 Ga0207682_10066081
391 Ga0207682_10471729
392 Ga0207682_10507503
393 Ga0207688_10150297
394 Ga0207680_10029896
395 Ga0207647_10199390
396 Ga0207645_10034203
397 Ga0207654_10533941
398 Ga0207707_10034303
399 Ga0207707_10699825
400 Ga0207695_10086081
401 Ga0207695_10140193
402 Ga0207662_10001391
403 Ga0207662_10122447
404 Ga0207649_10242628
405 Ga0207649_10322348
406 Ga0207649_11042090
407 Ga0207646_10595159
408 Ga0207681_10034898
409 Ga0207650_10030521
410 Ga0207650_10050516
411 Ga0207687_10034428
412 Ga0207690_10208669
413 Ga0207706_10042147
414 Ga0207686_10115108
415 Ga0207709_11175280
416 Ga0207670_10020109
417 Ga0207669_10405606
418 Ga0207704_10238937
419 Ga0207665_10492833
420 Ga0207691_10005436
421 Ga0207711_10111611
422 Ga0207711_11503248
423 Ga0207689_10055037
424 Ga0207689_10451974
425 Ga0207661_10107027
426 Ga0207679_10774812
427 Ga0207651_10001488
428 Ga0207668_10649852
429 Ga0207640_10023801
430 Ga0207677_10433430
431 Ga0207703_10098727
432 Ga0207648_10004640
433 Ga0207676_10281146
434 Ga0207676_10541411
435 Ga0207676_12041449
436 Ga0207674_10509594
437 Ga0207675_100063763
438 Ga0207675_100639902
439 Ga0207683_11468294
440 Ga0207698_10032932
441 Ga0207698_10835269
442 Ga0209813_10035515
443 Ga0268265_10148807
444 Ga0268265_10513836
445 Ga0268264_10215071
446 Ga0307416_100049292
447 Ga0307416_101732974
448 Ga0373930_0011133
449 Ga0373959_0152501
450 Ga0373951_0018466
451 Ga0373962_0034177
452 Ga0373931_0029756
453 Ga0373927_0342658
454 Ga0373947_0004675
455 Ga0395905_0805793
456 Ga0395901_0770104
457 Ga0436365_0315995
458 Ga0439439_0192600
459 Ga0439431_0051250
460 Ga0439448_0192883
461 Ga0439434_0182493
462 Ga0439464_0228651
463 Ga0439440_0060980
464 Ga0466967_0403077
465 Ga0495630_0442740
466 Ga0495634_0432971
467 Ga0495635_0398658
468 Ga0495624_0624250
469 Ga0496101_0743545
470 Ga0496101_0938689
471 Ga0496102_0466929
472 Ga0496104_0550179
473 Ga0496104_1290132
474 Ga0496106_0081576
475 Ga0496112_0472491
476 Ga0496113_0537150
477 Ga0501034_0002146
478 Ga0501036_0715036
479 Ga0501043_0638559
480 Ga0501047_0667579
481 Ga0501067_0025318
482 Ga0501067_0403046
483 Ga0501069_0180751
484 nmdc:mga03683_137726_c1
485 nmdc:mga03n38_450918_c1
486 nmdc:mga00v17_149197_c1
487 nmdc:mga00v17_18887_c1
488 nmdc:mga0yw44_344466_c1
489 nmdc:mga0k408_2937_c1
490 nmdc:mga0k408_48668_c1
491 nmdc:mga06z11_4588_c1
492 nmdc:mga04h51_29396_c1
493 nmdc:mga07m45_2323_c1
494 nmdc:mga07m45_303516_c1
495 nmdc:mga05p37_185437_c1
496 nmdc:mga06r32_220481_c1
497 nmdc:mga08y16_1619933_c1
498 nmdc:mga08y16_788576_c1
499 nmdc:mga0n895_3_c1
500 nmdc:mga0n895_91690_c1
501 nmdc:mga0rr50_159083_c1
502 nmdc:mga0rr50_2861_c1
503 nmdc:mga0rr50_39_c1
504 nmdc:mga08x19_259_c1
505 nmdc:mga08x19_290315_c1
506 nmdc:mga08x19_54703_c1
507 nmdc:mga0a205_143289_c1
508 Ga0500628_016532
509 Ga0590075_000589
510 Ga0590077_000230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

12

148

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.9061 1 156
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8902 1 156
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8068 7 149
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.8053 6 149
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.801 6 148
ID Description Score Start End Superfamily
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8951 1 148 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8373 1 148 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8068 7 149 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.801 6 148 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7849 7 158 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7C2EB52-F1-model_v4 DUF664 domain-containing protein 0.9803 1 158
AF-A0A3N5GKK3-F1-model_v4 DinB-like domain-containing protein 0.9799 1 156
AF-A0A359KPX7-F1-model_v4 DinB-like domain-containing protein 0.9782 2 157
AF-A0A7C2EB52-F1-model_v4 DUF664 domain-containing protein 0.9742 1 158
AF-A0A838RTR0-F1-model_v4 DinB family protein 0.9719 1 156

Map