F365715

General Info

Members Datasets Scaffolds Average Seq Length
255 156 510 364

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10067245|Ga0157379_100672453
Length 411
Sequence MAQVLLNKVEKTYPGGFQAVKGIDLEIKDREFIVLVGPSGCGKSTTLRMVAGLEEITGGTISIGNRVVNDVPPKDRDIAMVFQNYALYPHMTVYKNMAFGLKLRGMPKADIDKRVQEAAKILEITHLLERKPKALSGGQRQRVAVGRAIVREPAAFLFDEPLSNLDAKLRVTTRAELKRLHQRLKTTTIYVTHDQEEAMTLGDRIVIMKDGIIQQSDTPLRTYQRPTNRFVAGFIGMPPMNFFDGAIKLVDGQMVFEEGRLTNVRGADAKAQAAIAGKADSDEPVVMVGELTLPGNGFTLVIPDHLRDALAGKVGSHVVLGIRPEHFHLSPVAGGSEMRVTLNVVEPLGNDMDVYMSTKLNDHVVGRVEASSGLEMGATTVYVDAAKVHFFEPGATGMNLSLSKASTHANA

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
68 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
102 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
143 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
144 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
145 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
146 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
147 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
148 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
149 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
150 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
151 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
152 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
153 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
154 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
155 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
156 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 1.57
Isolates 5.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 5.49
Rhizoplane 0.78
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10067245 3300014968 Bacteria 3203
2 Ga0070658_10023273 3300005327 Bacteria 4973
3 Ga0070690_100162845 3300005330 Bacteria 1530
4 Ga0070680_100115158 3300005336 Bacteria 2240
5 Ga0070714_100120548 3300005435 Bacteria 2333
6 Ga0070714_100228338 3300005435 Bacteria 1714
7 Ga0070708_100349998 3300005445 Bacteria 1392
8 Ga0070681_10003651 3300005458 Bacteria 14442
9 Ga0070681_10097431 3300005458 Bacteria 2888
10 Ga0070685_10227143 3300005466 Bacteria 1226
11 Ga0070698_100012451 3300005471 Bacteria 9002
12 Ga0070679_100005924 3300005530 Bacteria 11357
13 Ga0070679_100411808 3300005530 Bacteria 1297
14 Ga0070697_100026814 3300005536 Bacteria 4606
15 Ga0068853_100012363 3300005539 Bacteria 6945
16 Ga0070686_100080382 3300005544 Bacteria 2157
17 Ga0068855_100000039 3300005563 Bacteria 154012
18 Ga0068857_100090565 3300005577 Bacteria 2737
19 Ga0068856_100010470 3300005614 Bacteria 9003
20 Ga0068859_100110309 3300005617 Bacteria 2813
21 Ga0068859_100385203 3300005617 Bacteria 1498
22 Ga0068851_10000023 3300005834 Bacteria 126799
23 Ga0081455_10000426 3300005937 Bacteria 55338
24 Ga0075428_100188908 3300006844 Bacteria 2228
25 Ga0075431_100010420 3300006847 Bacteria 9344
26 Ga0075436_100126108 3300006914 Bacteria 1793
27 Ga0075436_100151873 3300006914 Bacteria 1630
28 Ga0097620_100110311 3300006931 Bacteria 2813
29 Ga0097620_100385199 3300006931 Bacteria 1498
30 Ga0099794_10087119 3300007265 Bacteria 1547
31 Ga0111539_10084825 3300009094 Bacteria 3723
32 Ga0114129_10000703 3300009147 Bacteria 42137
33 Ga0105241_10008749 3300009174 Bacteria 7438
34 Ga0105249_10093470 3300009553 Bacteria 2817
35 Ga0157371_10039185 3300013102 Bacteria 3388
36 Ga0157372_10088146 3300013307 Bacteria 3523
37 Ga0157376_10118748 3300014969 Bacteria 2340
38 Ga0157376_10132515 3300014969 Bacteria 2226
39 Ga0206354_10581586 3300020081 Bacteria 1371
40 Ga0206353_10279373 3300020082 Bacteria 1864
41 Ga0206353_11050657 3300020082 Bacteria 2179
42 Ga0207656_10000911 3300025321 Bacteria 9627
43 Ga0207707_10001265 3300025912 Bacteria 23604
44 Ga0207707_10051419 3300025912 Bacteria 3588
45 Ga0207693_10016636 3300025915 Bacteria 5876
46 Ga0207657_10001542 3300025919 Bacteria 24681
47 Ga0207652_10004507 3300025921 Bacteria 11312
48 Ga0207687_10007544 3300025927 Bacteria 7153
49 Ga0207700_10147784 3300025928 Bacteria 1939
50 Ga0207700_10190967 3300025928 Bacteria 1721
51 Ga0207664_10012786 3300025929 Bacteria 6010
52 Ga0207664_10160758 3300025929 Bacteria 1916
53 Ga0207706_10046792 3300025933 Bacteria 3829
54 Ga0207667_10000085 3300025949 Bacteria 151830
55 Ga0207667_10013899 3300025949 Bacteria 9196
56 Ga0207678_10008650 3300026067 Bacteria 8971
57 Ga0207702_10206699 3300026078 Bacteria 1823
58 Ga0207674_10001959 3300026116 Bacteria 26075
59 Ga0265323_10003703 3300028653 Bacteria 6688
60 Ga0265323_10008548 3300028653 Bacteria 4218
61 Ga0265322_10000797 3300028654 Bacteria 11324
62 Ga0265336_10007131 3300028666 Bacteria 3993
63 Ga0265338_10000139 3300028800 Bacteria 135334
64 Ga0265338_10033274 3300028800 Bacteria 5006
65 Ga0265338_10039293 3300028800 Bacteria 4467
66 Ga0265338_10049260 3300028800 Bacteria 3821
67 Ga0265338_10055289 3300028800 Bacteria 3532
68 Ga0265338_10198661 3300028800 Bacteria 1514
69 Ga0265320_10087164 3300031240 Bacteria 1450
70 Ga0265325_10030567 3300031241 Bacteria 2887
71 Ga0265339_10000080 3300031249 Bacteria 83570
72 Ga0265316_10000536 3300031344 Bacteria 42732
73 Ga0265316_10000762 3300031344 Bacteria 35455
74 Ga0265313_10000330 3300031595 Bacteria 51547
75 Ga0307508_10004551 3300031616 Bacteria 13507
76 Ga0265342_10033442 3300031712 Bacteria 3162
77 Ga0307516_10004862 3300031730 Bacteria 16369
78 Ga0307415_100068067 3300032126 Bacteria 2491
79 Ga0316588_1023386 3300033528 Bacteria 1418
80 Ga0373936_0014245 3300035113 Bacteria 3039
81 Ga0373945_0006829 3300035116 Bacteria 3688
82 Ga0373943_0000385 3300035170 Bacteria 18514
83 Ga0373946_0001197 3300035171 Bacteria 8994
84 Ga0373955_0067436 3300035172 Bacteria 1992
85 Ga0373935_0003884 3300035692 Bacteria 8716
86 Ga0373935_0023093 3300035692 Bacteria 3819
87 Ga0373927_0012489 3300035695 Bacteria 5655
88 Ga0373927_0077119 3300035695 Bacteria 2158
89 Ga0373933_0069125 3300035724 Bacteria 2146
90 Ga0373947_0024746 3300035725 Bacteria 3500
91 Ga0373947_0040217 3300035725 Bacteria 2784
92 Ga0373937_0007625 3300036401 Bacteria 9374
93 Ga0373925_0005682 3300037068 Bacteria 9272
94 Ga0373925_0052705 3300037068 Bacteria 3040
95 Ga0395905_0009587 3300037471 Bacteria 9455
96 Ga0395905_0058909 3300037471 Bacteria 3591
97 Ga0436360_1106634 3300039438 Bacteria 1656
98 Ga0436361_0227952 3300039447 Bacteria 3188
99 Ga0451577_0037058 3300042876 Bacteria 4391
100 Ga0451577_0076882 3300042876 Bacteria 2976
101 Ga0453684_0179428 3300044712 Bacteria 2487
102 Ga0466957_0032430 3300044842 Bacteria 3128
103 Ga0466959_0216273 3300045049 Bacteria 1330
104 Ga0451576_0021592 3300045051 Bacteria 6996
105 Ga0451576_0192237 3300045051 Bacteria 2132
106 Ga0466958_0037515 3300045836 Bacteria 2904
107 Ga0495653_0052919 3300046463 Bacteria 3109
108 Ga0495662_0000465 3300046476 Bacteria 18312
109 Ga0495664_0000571 3300046477 Bacteria 18502
110 Ga0495618_0007414 3300046514 Bacteria 6631
111 Ga0495630_0089781 3300046517 Bacteria 2321
112 Ga0495630_0138684 3300046517 Bacteria 1848
113 Ga0495652_0011766 3300046529 Bacteria 7906
114 Ga0495665_0043061 3300046531 Bacteria 2401
115 Ga0495640_0000382 3300046533 Bacteria 31430
116 Ga0495586_0005122 3300046535 Bacteria 7015
117 Ga0495645_0018422 3300046543 Bacteria 5013
118 Ga0495645_0121000 3300046543 Bacteria 1843
119 Ga0495634_0070458 3300046642 Bacteria 2304
120 Ga0495635_0000971 3300046663 Bacteria 18891
121 Ga0495635_0031951 3300046663 Bacteria 3653
122 Ga0495613_0068172 3300046689 Bacteria 2595
123 Ga0495624_0005477 3300046690 Bacteria 9147
124 Ga0495624_0027074 3300046690 Bacteria 3756
125 Ga0495600_0090146 3300046809 Bacteria 2000
126 Ga0495581_0029711 3300047315 Bacteria 3167
127 Ga0495604_0193437 3300047317 Bacteria 1416
128 Ga0495674_0004029 3300047319 Bacteria 14225
129 Ga0495676_0062717 3300047321 Bacteria 2900
130 Ga0495684_0000602 3300047471 Bacteria 28930
131 Ga0495684_0033589 3300047471 Bacteria 3934
132 Ga0495684_0068033 3300047471 Bacteria 2708
133 Ga0495593_0003671 3300047673 Bacteria 9163
134 Ga0496110_0009018 3300048913 Bacteria 8048
135 Ga0496111_0003559 3300048914 Bacteria 9641
136 Ga0496125_0000612 3300048928 Bacteria 60537
137 Ga0501032_0071759 3300049569 Bacteria 2308
138 Ga0501033_0058614 3300049570 Bacteria 2844
139 Ga0501033_0094072 3300049570 Bacteria 2192
140 Ga0501036_0001382 3300049572 Bacteria 18652
141 Ga0501036_0021715 3300049572 Bacteria 5396
142 Ga0501036_0132045 3300049572 Bacteria 2108
143 Ga0501036_0166020 3300049572 Bacteria 1861
144 Ga0501037_0068176 3300049573 Bacteria 2590
145 Ga0501038_0000646 3300049574 Bacteria 30992
146 Ga0501039_0001534 3300049575 Bacteria 16970
147 Ga0501039_0185872 3300049575 Bacteria 1634
148 Ga0501040_0001157 3300049576 Bacteria 16800
149 Ga0501040_0010641 3300049576 Bacteria 6017
150 Ga0501040_0016951 3300049576 Bacteria 4830
151 Ga0501040_0143394 3300049576 Bacteria 1683
152 Ga0501041_0003350 3300049577 Bacteria 9223
153 Ga0501041_0003732 3300049577 Bacteria 8759
154 Ga0501041_0010888 3300049577 Bacteria 5367
155 Ga0501042_0007876 3300049578 Bacteria 7009
156 Ga0501042_0033951 3300049578 Bacteria 3618
157 Ga0501042_0044181 3300049578 Bacteria 3174
158 Ga0501042_0057909 3300049578 Bacteria 2765
159 Ga0501046_0016761 3300049580 Bacteria 6126
160 Ga0501046_0023761 3300049580 Bacteria 5038
161 Ga0501046_0036793 3300049580 Bacteria 3937
162 Ga0501046_0071114 3300049580 Bacteria 2704
163 Ga0501048_0001228 3300049582 Bacteria 19413
164 Ga0501048_0038931 3300049582 Bacteria 3412
165 Ga0501068_0034995 3300049584 Bacteria 2997
166 Ga0501068_0037015 3300049584 Bacteria 2921
167 Ga0501068_0147971 3300049584 Bacteria 1475
168 Ga0501070_0300278 3300049586 Bacteria 1308
169 Ga0501071_0000156 3300049587 Bacteria 28990
170 Ga0501071_0108220 3300049587 Bacteria 2053
171 Ga0501071_0167533 3300049587 Bacteria 1644
172 Ga0501072_0000252 3300049588 Bacteria 39255
173 Ga0501072_0007569 3300049588 Bacteria 8240
174 Ga0501072_0017848 3300049588 Bacteria 5457
175 Ga0501072_0125222 3300049588 Bacteria 2047
176 Ga0501073_0184728 3300049589 Bacteria 1443
177 Ga0501074_0019364 3300049590 Bacteria 4945
178 Ga0501074_0080715 3300049590 Bacteria 2333
179 Ga0501074_0192013 3300049590 Bacteria 1456
180 Ga0501075_0000004 3300049591 Bacteria 148813
181 Ga0501075_0002835 3300049591 Bacteria 11626
182 Ga0501075_0013704 3300049591 Bacteria 5794
183 Ga0501075_0016340 3300049591 Bacteria 5343
184 Ga0501076_0000044 3300049592 Bacteria 61984
185 Ga0501076_0000729 3300049592 Bacteria 21290
186 Ga0501076_0013564 3300049592 Bacteria 6111
187 Ga0501076_0040314 3300049592 Bacteria 3669
188 Ga0501076_0064965 3300049592 Bacteria 2909
189 Ga0501077_0001712 3300049593 Bacteria 13223
190 Ga0501077_0022497 3300049593 Bacteria 3993
191 Ga0501077_0181211 3300049593 Bacteria 1339
192 Ga0501079_0004291 3300049741 Bacteria 10579
193 Ga0501079_0009159 3300049741 Bacteria 7495
194 Ga0501079_0012857 3300049741 Bacteria 6390
195 Ga0501079_0018639 3300049741 Bacteria 5302
196 Ga0501079_0050520 3300049741 Bacteria 3210
197 Ga0501079_0063106 3300049741 Bacteria 2858
198 Ga0501079_0106915 3300049741 Bacteria 2171
199 Ga0501080_0001368 3300049742 Bacteria 20407
200 Ga0501080_0014240 3300049742 Bacteria 7322
201 Ga0501080_0017716 3300049742 Bacteria 6591
202 Ga0501080_0271018 3300049742 Bacteria 1545
203 Ga0501081_0018215 3300049743 Bacteria 4662
204 Ga0501081_0023806 3300049743 Bacteria 4107
205 Ga0501081_0025274 3300049743 Bacteria 3994
206 Ga0501081_0034689 3300049743 Bacteria 3433
207 Ga0501081_0156851 3300049743 Bacteria 1638
208 Ga0501083_0041485 3300049744 Bacteria 3121
209 Ga0501083_0050142 3300049744 Bacteria 2811
210 Ga0501083_0195414 3300049744 Bacteria 1320
211 Ga0501083_0254832 3300049744 Bacteria 1142
212 Ga0501035_0001252 3300049822 Bacteria 26379
213 Ga0501045_0001164 3300049824 Bacteria 17428
214 Ga0501045_0024014 3300049824 Bacteria 4376
215 Ga0501045_0044742 3300049824 Bacteria 3225
216 nmdc:mga05p37_2191_c1 3300050507 Bacteria 22774
217 nmdc:mga0n895_365155_c1 3300050512 Bacteria 1462
218 nmdc:mga08x19_72477_c1 3300050514 Bacteria 2247
219 nmdc:mga0a205_269556_c1 3300050515 Bacteria 1579
220 Ga0495601_0001929 3300053077 Bacteria 11602
221 Ga0495612_0003805 3300053078 Bacteria 6273
222 Ga0495619_0003564 3300053085 Bacteria 10043
223 Ga0495619_0048881 3300053085 Bacteria 2787
224 Ga0501084_0000157 3300054114 Bacteria 52388
225 Ga0501084_0051004 3300054114 Bacteria 3463
226 Ga0501084_0331504 3300054114 Bacteria 1285
227 Ga0590077_018092 3300059426 Bacteria 1486
228 Ga0501082_0000341 3300060353 Bacteria 41171
229 Ga0501082_0007830 3300060353 Bacteria 9221
230 Ga0501082_0011099 3300060353 Bacteria 7745
231 Ga0501082_0044327 3300060353 Bacteria 3837
232 Ga0530510_0000084 3300061734 Bacteria 49991
233 Ga0530510_0000381 3300061734 Bacteria 28800
234 Ga0530510_0006278 3300061734 Bacteria 8270
235 Ga0530510_0036244 3300061734 Bacteria 3555
236 Ga0530510_0078914 3300061734 Bacteria 2394
237 Ga0530510_0091267 3300061734 Bacteria 2222
238 Ga0530510_0106636 3300061734 Bacteria 2050
239 Ga0530510_0155642 3300061734 Bacteria 1689
240 Ga0530510_0230019 3300061734 Bacteria 1379
241 2513888008 2513237141 Bacteria 8496279
242 2871499983 2871495908 Bacteria 6935695
243 2878764126 2878760144 Bacteria 6823465
244 2878771174 2878767105 Bacteria 6898628
245 2885305878 2885305155 Bacteria 7348390
246 2903544795 2903540706 Bacteria 7062119
247 2929200473 2929199973 Bacteria 7260745
248 2937998642 2937994558 Bacteria 7036190
249 2958169120 2958165035 Bacteria 6906348
250 2961167580 2961163497 Bacteria 6901077
251 2965022401 2965018300 Bacteria 6883036
252 2968175985 2968171901 Bacteria 6894245
253 2970558971 2970554993 Bacteria 6814252
254 2987663588 2987659509 Bacteria 6966464
255 3004192647 3004188549 Bacteria 6952365
256 Ga0157379_10067245
257 Ga0070658_10023273
258 Ga0070690_100162845
259 Ga0070680_100115158
260 Ga0070714_100120548
261 Ga0070714_100228338
262 Ga0070708_100349998
263 Ga0070681_10003651
264 Ga0070681_10097431
265 Ga0070685_10227143
266 Ga0070698_100012451
267 Ga0070679_100005924
268 Ga0070679_100411808
269 Ga0070697_100026814
270 Ga0068853_100012363
271 Ga0070686_100080382
272 Ga0068855_100000039
273 Ga0068857_100090565
274 Ga0068856_100010470
275 Ga0068859_100110309
276 Ga0068859_100385203
277 Ga0068851_10000023
278 Ga0081455_10000426
279 Ga0075428_100188908
280 Ga0075431_100010420
281 Ga0075436_100126108
282 Ga0075436_100151873
283 Ga0097620_100110311
284 Ga0097620_100385199
285 Ga0099794_10087119
286 Ga0111539_10084825
287 Ga0114129_10000703
288 Ga0105241_10008749
289 Ga0105249_10093470
290 Ga0157371_10039185
291 Ga0157372_10088146
292 Ga0157376_10118748
293 Ga0157376_10132515
294 Ga0206354_10581586
295 Ga0206353_10279373
296 Ga0206353_11050657
297 Ga0207656_10000911
298 Ga0207707_10001265
299 Ga0207707_10051419
300 Ga0207693_10016636
301 Ga0207657_10001542
302 Ga0207652_10004507
303 Ga0207687_10007544
304 Ga0207700_10147784
305 Ga0207700_10190967
306 Ga0207664_10012786
307 Ga0207664_10160758
308 Ga0207706_10046792
309 Ga0207667_10000085
310 Ga0207667_10013899
311 Ga0207678_10008650
312 Ga0207702_10206699
313 Ga0207674_10001959
314 Ga0265323_10003703
315 Ga0265323_10008548
316 Ga0265322_10000797
317 Ga0265336_10007131
318 Ga0265338_10000139
319 Ga0265338_10033274
320 Ga0265338_10039293
321 Ga0265338_10049260
322 Ga0265338_10055289
323 Ga0265338_10198661
324 Ga0265320_10087164
325 Ga0265325_10030567
326 Ga0265339_10000080
327 Ga0265316_10000536
328 Ga0265316_10000762
329 Ga0265313_10000330
330 Ga0307508_10004551
331 Ga0265342_10033442
332 Ga0307516_10004862
333 Ga0307415_100068067
334 Ga0316588_1023386
335 Ga0373936_0014245
336 Ga0373945_0006829
337 Ga0373943_0000385
338 Ga0373946_0001197
339 Ga0373955_0067436
340 Ga0373935_0003884
341 Ga0373935_0023093
342 Ga0373927_0012489
343 Ga0373927_0077119
344 Ga0373933_0069125
345 Ga0373947_0024746
346 Ga0373947_0040217
347 Ga0373937_0007625
348 Ga0373925_0005682
349 Ga0373925_0052705
350 Ga0395905_0009587
351 Ga0395905_0058909
352 Ga0436360_1106634
353 Ga0436361_0227952
354 Ga0451577_0037058
355 Ga0451577_0076882
356 Ga0453684_0179428
357 Ga0466957_0032430
358 Ga0466959_0216273
359 Ga0451576_0021592
360 Ga0451576_0192237
361 Ga0466958_0037515
362 Ga0495653_0052919
363 Ga0495662_0000465
364 Ga0495664_0000571
365 Ga0495618_0007414
366 Ga0495630_0089781
367 Ga0495630_0138684
368 Ga0495652_0011766
369 Ga0495665_0043061
370 Ga0495640_0000382
371 Ga0495586_0005122
372 Ga0495645_0018422
373 Ga0495645_0121000
374 Ga0495634_0070458
375 Ga0495635_0000971
376 Ga0495635_0031951
377 Ga0495613_0068172
378 Ga0495624_0005477
379 Ga0495624_0027074
380 Ga0495600_0090146
381 Ga0495581_0029711
382 Ga0495604_0193437
383 Ga0495674_0004029
384 Ga0495676_0062717
385 Ga0495684_0000602
386 Ga0495684_0033589
387 Ga0495684_0068033
388 Ga0495593_0003671
389 Ga0496110_0009018
390 Ga0496111_0003559
391 Ga0496125_0000612
392 Ga0501032_0071759
393 Ga0501033_0058614
394 Ga0501033_0094072
395 Ga0501036_0001382
396 Ga0501036_0021715
397 Ga0501036_0132045
398 Ga0501036_0166020
399 Ga0501037_0068176
400 Ga0501038_0000646
401 Ga0501039_0001534
402 Ga0501039_0185872
403 Ga0501040_0001157
404 Ga0501040_0010641
405 Ga0501040_0016951
406 Ga0501040_0143394
407 Ga0501041_0003350
408 Ga0501041_0003732
409 Ga0501041_0010888
410 Ga0501042_0007876
411 Ga0501042_0033951
412 Ga0501042_0044181
413 Ga0501042_0057909
414 Ga0501046_0016761
415 Ga0501046_0023761
416 Ga0501046_0036793
417 Ga0501046_0071114
418 Ga0501048_0001228
419 Ga0501048_0038931
420 Ga0501068_0034995
421 Ga0501068_0037015
422 Ga0501068_0147971
423 Ga0501070_0300278
424 Ga0501071_0000156
425 Ga0501071_0108220
426 Ga0501071_0167533
427 Ga0501072_0000252
428 Ga0501072_0007569
429 Ga0501072_0017848
430 Ga0501072_0125222
431 Ga0501073_0184728
432 Ga0501074_0019364
433 Ga0501074_0080715
434 Ga0501074_0192013
435 Ga0501075_0000004
436 Ga0501075_0002835
437 Ga0501075_0013704
438 Ga0501075_0016340
439 Ga0501076_0000044
440 Ga0501076_0000729
441 Ga0501076_0013564
442 Ga0501076_0040314
443 Ga0501076_0064965
444 Ga0501077_0001712
445 Ga0501077_0022497
446 Ga0501077_0181211
447 Ga0501079_0004291
448 Ga0501079_0009159
449 Ga0501079_0012857
450 Ga0501079_0018639
451 Ga0501079_0050520
452 Ga0501079_0063106
453 Ga0501079_0106915
454 Ga0501080_0001368
455 Ga0501080_0014240
456 Ga0501080_0017716
457 Ga0501080_0271018
458 Ga0501081_0018215
459 Ga0501081_0023806
460 Ga0501081_0025274
461 Ga0501081_0034689
462 Ga0501081_0156851
463 Ga0501083_0041485
464 Ga0501083_0050142
465 Ga0501083_0195414
466 Ga0501083_0254832
467 Ga0501035_0001252
468 Ga0501045_0001164
469 Ga0501045_0024014
470 Ga0501045_0044742
471 nmdc:mga05p37_2191_c1
472 nmdc:mga0n895_365155_c1
473 nmdc:mga08x19_72477_c1
474 nmdc:mga0a205_269556_c1
475 Ga0495601_0001929
476 Ga0495612_0003805
477 Ga0495619_0003564
478 Ga0495619_0048881
479 Ga0501084_0000157
480 Ga0501084_0051004
481 Ga0501084_0331504
482 Ga0590077_018092
483 Ga0501082_0000341
484 Ga0501082_0007830
485 Ga0501082_0011099
486 Ga0501082_0044327
487 Ga0530510_0000084
488 Ga0530510_0000381
489 Ga0530510_0006278
490 Ga0530510_0036244
491 Ga0530510_0078914
492 Ga0530510_0091267
493 Ga0530510_0106636
494 Ga0530510_0155642
495 Ga0530510_0230019
496 2513888008
497 2871499983
498 2878764126
499 2878771174
500 2885305878
501 2903544795
502 2929200473
503 2937998642
504 2958169120
505 2961167580
506 2965022401
507 2968175985
508 2970558971
509 2987663588
510 3004192647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

163

0.98

PF08402

TOBE_2

TOBE domain

320

391

0.87

PF17912

OB_MalK

MalK OB fold domain

275

327

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.956 4 233
2it1-assembly1.cif.gz_B structure of ph0203 protein from pyrococcus horikoshii 0.947 3 366
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9414 4 233
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9387 4 217
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9387 4 212
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9843 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9736 1 217 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9716 4 237 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9707 3 216 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9703 4 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9933 1 221 GO:0005524
GO:0016887
GO:0055052
AF-A0A5J4F8B2-F1-model_v4 Sulfate/thiosulfate import ATP-binding protein CysA (EC 3.6.3.25) 0.9872 3 242 GO:0005524
GO:0015419
GO:0016887
GO:0043190
AF-A0A519YL00-F1-model_v4 deleted 0.9859 4 233
AF-A0A3D0PSJ0-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9852 1 141 GO:0005524
GO:0016887
GO:0055052
AF-A0A371MRW7-F1-model_v4 ABC transporter ATP-binding protein 0.9844 63 149 GO:0005524
GO:0016887
GO:0055052

Map