F365675

General Info

Members Datasets Scaffolds Average Seq Length
255 166 510 228

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10273550|Ga0105249_102735502
Length 255
Sequence MDDCPPGEHHSLQSGPILMPFTTKVTEVTMSEPATQIPTAAAVDLKLEVVVIPVSDVDRARRFYQSLGWRLDADFAAGDDWHLVQMTPPGSPCSVMFGKGFTTAAPGSVQGTFLVVDDVEAARAALTGQGVDVSEVFHFEGNLLRVAGTRGRLAGPDPNGGSYFSFASFSDPDGNSFLLQEIKTRFPGRGFSNLDVPALTELLRETETRHGEYERTAPKHHWSEWYAAYIVARERGRTPEEAAGDSARHMERARR

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
123 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
124 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
125 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
126 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
141 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
142 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
143 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
149 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
150 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
151 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
166 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 2.75
Rhizosphere 95.29
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10273550 3300009553 Bacteria 1684
2 Ga0065712_10107824 3300005290 Bacteria 1888
3 Ga0070676_10146824 3300005328 Unclassified 1506
4 Ga0070676_10441733 3300005328 Bacteria 913
5 Ga0070683_100129011 3300005329 Bacteria 2392
6 Ga0070690_100194492 3300005330 Unclassified 1408
7 Ga0070670_100815959 3300005331 Bacteria 843
8 Ga0070677_10023547 3300005333 Bacteria 2282
9 Ga0070666_10009915 3300005335 Bacteria 5945
10 Ga0068868_100000941 3300005338 Bacteria 19766
11 Ga0070689_100167489 3300005340 Bacteria 1779
12 Ga0070661_100059149 3300005344 Bacteria 2809
13 Ga0070668_100109745 3300005347 Bacteria 2195
14 Ga0070668_100237816 3300005347 Bacteria 1508
15 Ga0070675_100016033 3300005354 Bacteria 5939
16 Ga0070675_100426595 3300005354 Bacteria 1186
17 Ga0070671_100008535 3300005355 Bacteria 8213
18 Ga0070673_100009608 3300005364 Bacteria 6503
19 Ga0070688_100072534 3300005365 Bacteria 2206
20 Ga0070667_100084550 3300005367 Bacteria 2720
21 Ga0070667_100743526 3300005367 Bacteria 909
22 Ga0070711_100089516 3300005439 Bacteria 2214
23 Ga0070708_100207056 3300005445 Bacteria 1837
24 Ga0070678_100000547 3300005456 Bacteria 18344
25 Ga0070678_100065676 3300005456 Bacteria 2695
26 Ga0070678_100504140 3300005456 Bacteria 1068
27 Ga0070662_100034058 3300005457 Bacteria 3590
28 Ga0070662_100254047 3300005457 Bacteria 1414
29 Ga0070681_10100322 3300005458 Bacteria 2841
30 Ga0068867_100060825 3300005459 Unclassified 2802
31 Ga0068867_100418735 3300005459 Bacteria 1134
32 Ga0068867_100662710 3300005459 Bacteria 917
33 Ga0070685_10016812 3300005466 Bacteria 3904
34 Ga0070685_10092437 3300005466 Bacteria 1833
35 Ga0070684_100061903 3300005535 Bacteria 3277
36 Ga0070697_100054785 3300005536 Bacteria 3242
37 Ga0070672_100035772 3300005543 Bacteria 3776
38 Ga0070695_100005564 3300005545 Bacteria 7418
39 Ga0070696_100337534 3300005546 Bacteria 1164
40 Ga0070665_100353912 3300005548 Bacteria 1474
41 Ga0070664_100081439 3300005564 Bacteria 2790
42 Ga0068854_100010779 3300005578 Bacteria 5931
43 Ga0068856_100852903 3300005614 Bacteria 930
44 Ga0068852_100015598 3300005616 Bacteria 5901
45 Ga0068859_100002626 3300005617 Bacteria 18286
46 Ga0068864_100000198 3300005618 Bacteria 54959
47 Ga0068864_100743572 3300005618 Bacteria 961
48 Ga0068861_100193592 3300005719 Bacteria 1702
49 Ga0068863_100094886 3300005841 Bacteria 2831
50 Ga0068863_100508941 3300005841 Bacteria 1186
51 Ga0068863_101005830 3300005841 Bacteria 836
52 Ga0068858_100020252 3300005842 Bacteria 6221
53 Ga0068858_100201734 3300005842 Unclassified 1881
54 Ga0068858_100799461 3300005842 Bacteria 920
55 Ga0068860_100013202 3300005843 Bacteria 8104
56 Ga0068860_100368848 3300005843 Bacteria 1415
57 Ga0068862_100492628 3300005844 Bacteria 1162
58 Ga0081538_10085073 3300005981 Bacteria 1663
59 Ga0070712_100126024 3300006175 Bacteria 1934
60 Ga0068871_100064915 3300006358 Bacteria 2989
61 Ga0068871_100123464 3300006358 Bacteria 2190
62 Ga0068871_100388105 3300006358 Unclassified 1241
63 Ga0075428_100022838 3300006844 Bacteria 6921
64 Ga0075428_100027870 3300006844 Bacteria 6250
65 Ga0075428_100037269 3300006844 Bacteria 5354
66 Ga0075428_100043191 3300006844 Bacteria 4956
67 Ga0075428_100666863 3300006844 Bacteria 1109
68 Ga0075430_100007845 3300006846 Bacteria 9023
69 Ga0075430_100010191 3300006846 Bacteria 7959
70 Ga0075430_100055422 3300006846 Bacteria 3333
71 Ga0075431_100014527 3300006847 Bacteria 7966
72 Ga0075431_100028316 3300006847 Bacteria 5755
73 Ga0075431_100047264 3300006847 Bacteria 4437
74 Ga0075431_100437177 3300006847 Bacteria 1306
75 Ga0075434_100102760 3300006871 Bacteria 2866
76 Ga0075434_100111346 3300006871 Bacteria 2748
77 Ga0075434_100905728 3300006871 Bacteria 897
78 Ga0075429_100013870 3300006880 Bacteria 6989
79 Ga0075429_100026185 3300006880 Bacteria 5062
80 Ga0075429_100054163 3300006880 Bacteria 3490
81 Ga0075429_100069530 3300006880 Bacteria 3066
82 Ga0075436_100010158 3300006914 Bacteria 6446
83 Ga0097620_100002626 3300006931 Bacteria 18286
84 Ga0075435_100024718 3300007076 Bacteria 4666
85 Ga0111539_10009462 3300009094 Bacteria 12297
86 Ga0105245_10002193 3300009098 Bacteria 17695
87 Ga0105245_10378551 3300009098 Bacteria 1409
88 Ga0105247_10257732 3300009101 Bacteria 1195
89 Ga0114129_10018607 3300009147 Bacteria 9889
90 Ga0114129_10023851 3300009147 Bacteria 8670
91 Ga0114129_10025542 3300009147 Bacteria 8368
92 Ga0114129_10038134 3300009147 Bacteria 6781
93 Ga0114129_10046211 3300009147 Bacteria 6120
94 Ga0114129_10061603 3300009147 Bacteria 5244
95 Ga0105242_10013172 3300009176 Bacteria 6382
96 Ga0105242_10329621 3300009176 Unclassified 1403
97 Ga0105248_10062611 3300009177 Bacteria 4177
98 Ga0105248_10103596 3300009177 Bacteria 3208
99 Ga0157369_10140998 3300013105 Bacteria 2551
100 Ga0157374_10001284 3300013296 Bacteria 21379
101 Ga0157374_10008812 3300013296 Bacteria 8637
102 Ga0157378_10007058 3300013297 Bacteria 9809
103 Ga0157378_10035731 3300013297 Bacteria 4397
104 Ga0157378_10203874 3300013297 Bacteria 1872
105 Ga0163162_10021022 3300013306 Bacteria 6421
106 Ga0163162_10151407 3300013306 Bacteria 2438
107 Ga0157372_10126787 3300013307 Bacteria 2935
108 Ga0157372_11259767 3300013307 Bacteria 854
109 Ga0157375_10020914 3300013308 Bacteria 5989
110 Ga0163163_10032580 3300014325 Bacteria 5034
111 Ga0163163_10101084 3300014325 Bacteria 2905
112 Ga0157380_10097962 3300014326 Bacteria 2435
113 Ga0157379_10117713 3300014968 Bacteria 2390
114 Ga0157379_10264820 3300014968 Bacteria 1562
115 Ga0157376_10004884 3300014969 Bacteria 9342
116 Ga0207697_10000661 3300025315 Bacteria 19575
117 Ga0207656_10203753 3300025321 Bacteria 956
118 Ga0207682_10011584 3300025893 Bacteria 3444
119 Ga0207688_10010550 3300025901 Bacteria 5026
120 Ga0207680_10025799 3300025903 Bacteria 3247
121 Ga0207680_10043558 3300025903 Bacteria 2633
122 Ga0207645_10065537 3300025907 Bacteria 2322
123 Ga0207643_10115037 3300025908 Bacteria 1588
124 Ga0207707_10024039 3300025912 Bacteria 5328
125 Ga0207693_10003442 3300025915 Bacteria 13505
126 Ga0207650_10111643 3300025925 Bacteria 2117
127 Ga0207659_10010046 3300025926 Bacteria 5929
128 Ga0207687_10000941 3300025927 Bacteria 19857
129 Ga0207644_10033200 3300025931 Bacteria 3605
130 Ga0207644_10484549 3300025931 Bacteria 1019
131 Ga0207686_10103062 3300025934 Bacteria 1909
132 Ga0207704_10130785 3300025938 Unclassified 1738
133 Ga0207665_10678701 3300025939 Bacteria 809
134 Ga0207691_10006034 3300025940 Bacteria 11692
135 Ga0207711_10199585 3300025941 Bacteria 1825
136 Ga0207711_10941197 3300025941 Bacteria 803
137 Ga0207679_10148467 3300025945 Bacteria 1905
138 Ga0207667_10028037 3300025949 Bacteria 6119
139 Ga0207651_10140662 3300025960 Bacteria 1864
140 Ga0207651_10419862 3300025960 Bacteria 1142
141 Ga0207651_10486374 3300025960 Bacteria 1065
142 Ga0207668_10089598 3300025972 Bacteria 2256
143 Ga0207658_10407735 3300025986 Bacteria 1196
144 Ga0207658_10516196 3300025986 Bacteria 1066
145 Ga0207658_10794561 3300025986 Bacteria 859
146 Ga0207677_10000486 3300026023 Bacteria 25874
147 Ga0207677_10109664 3300026023 Bacteria 2053
148 Ga0207703_10172005 3300026035 Unclassified 1906
149 Ga0207678_10249425 3300026067 Bacteria 1520
150 Ga0207678_10698547 3300026067 Bacteria 893
151 Ga0207708_10464762 3300026075 Bacteria 1056
152 Ga0207702_10753129 3300026078 Bacteria 961
153 Ga0207641_10013057 3300026088 Bacteria 6813
154 Ga0207641_10992644 3300026088 Bacteria 836
155 Ga0207676_10000996 3300026095 Bacteria 21831
156 Ga0207676_10691287 3300026095 Bacteria 987
157 Ga0207674_10242652 3300026116 Bacteria 1749
158 Ga0207683_10000366 3300026121 Bacteria 41419
159 Ga0207683_10066384 3300026121 Bacteria 3181
160 Ga0207683_10110889 3300026121 Bacteria 2456
161 Ga0207683_10224530 3300026121 Bacteria 1712
162 Ga0207698_10609537 3300026142 Unclassified 1077
163 Ga0207428_10005639 3300027907 Bacteria 11636
164 Ga0268265_10721505 3300028380 Bacteria 965
165 Ga0268264_10645448 3300028381 Bacteria 1047
166 Ga0307513_10191700 3300031456 Bacteria 1895
167 Ga0307408_100096090 3300031548 Bacteria 2247
168 Ga0307408_100180306 3300031548 Bacteria 1693
169 Ga0307408_100202912 3300031548 Bacteria 1606
170 Ga0307408_100520672 3300031548 Bacteria 1044
171 Ga0307405_10115205 3300031731 Bacteria 1828
172 Ga0307405_10115711 3300031731 Bacteria 1825
173 Ga0307413_10368425 3300031824 Bacteria 1115
174 Ga0307413_10576791 3300031824 Bacteria 917
175 Ga0307410_10031405 3300031852 Bacteria 3408
176 Ga0307410_10366077 3300031852 Bacteria 1156
177 Ga0307406_10030594 3300031901 Bacteria 3271
178 Ga0307406_10220649 3300031901 Bacteria 1409
179 Ga0307407_10036450 3300031903 Bacteria 2710
180 Ga0307407_10083639 3300031903 Bacteria 1937
181 Ga0307407_10413627 3300031903 Bacteria 970
182 Ga0307412_10056827 3300031911 Viruses 2610
183 Ga0307412_10060535 3300031911 Bacteria 2542
184 Ga0307412_10291110 3300031911 Bacteria 1286
185 Ga0307409_100090193 3300031995 Bacteria 2508
186 Ga0307409_100107671 3300031995 Bacteria 2329
187 Ga0307409_100166198 3300031995 Bacteria 1936
188 Ga0307416_100020354 3300032002 Bacteria 4732
189 Ga0307416_100124026 3300032002 Bacteria 2310
190 Ga0307414_10082297 3300032004 Bacteria 2360
191 Ga0307411_10295619 3300032005 Bacteria 1296
192 Ga0307415_100323845 3300032126 Bacteria 1286
193 Ga0307415_100457478 3300032126 Bacteria 1105
194 Ga0373923_0178161 3300035111 Bacteria 976
195 Ga0373953_0053759 3300035117 Bacteria 1633
196 Ga0373933_0196847 3300035724 Bacteria 1289
197 Ga0373937_0271404 3300036401 Bacteria 1601
198 Ga0439453_0003509 3300041408 Bacteria 2263
199 Ga0439431_0050707 3300041997 Bacteria 1075
200 Ga0439443_003306 3300042003 Bacteria 2021
201 Ga0439450_072238 3300042008 Bacteria 848
202 Ga0439454_002762 3300042011 Bacteria 1888
203 Ga0439435_0023853 3300042436 Bacteria 1609
204 Ga0439444_0010865 3300042437 Bacteria 1463
205 Ga0439464_0006323 3300042439 Bacteria 3082
206 Ga0439460_0101634 3300042461 Bacteria 924
207 Ga0450916_010496 3300042530 Bacteria 1159
208 Ga0451576_1050269 3300045051 Bacteria 853
209 Ga0495659_0008452 3300046664 Bacteria 3276
210 Ga0496104_0202354 3300048907 Bacteria 1898
211 Ga0496108_0033465 3300048911 Bacteria 4271
212 Ga0496108_0681736 3300048911 Bacteria 892
213 Ga0496109_0389858 3300048912 Bacteria 1316
214 Ga0496110_0014677 3300048913 Bacteria 6512
215 Ga0496112_0100937 3300048915 Bacteria 2855
216 Ga0496112_0141693 3300048915 Bacteria 2373
217 Ga0501309_024245 3300049129 Bacteria 866
218 Ga0501292_028162 3300049515 Bacteria 934
219 Ga0501298_033615 3300049521 Bacteria 1017
220 Ga0501299_000874 3300049522 Bacteria 3700
221 Ga0501301_015256 3300049524 Bacteria 684
222 Ga0501040_0283180 3300049576 Bacteria 1184
223 Ga0501048_0278764 3300049582 Unclassified 1189
224 Ga0501071_0592636 3300049587 Bacteria 852
225 Ga0501075_0350626 3300049591 Bacteria 1125
226 Ga0501249_020466 3300049679 Bacteria 1439
227 Ga0501225_0088272 3300049705 Bacteria 896
228 Ga0501263_019049 3300049760 Bacteria 912
229 Ga0501212_028026 3300049851 Bacteria 898
230 nmdc:mga05p37_15099_c1 3300050507 Bacteria 9273
231 nmdc:mga05p37_19081_c1 3300050507 Bacteria 8294
232 nmdc:mga05p37_30094_c1 3300050507 Bacteria 6625
233 nmdc:mga05p37_6438_c1 3300050507 Bacteria 13846
234 nmdc:mga05p37_648_c1 3300050507 Bacteria 38499
235 nmdc:mga05p37_690822_c1 3300050507 Bacteria 1135
236 nmdc:mga09592_11213_c1 3300050508 Bacteria 7293
237 nmdc:mga09592_13654_c1 3300050508 Bacteria 6637
238 nmdc:mga09592_52378_c1 3300050508 Bacteria 3445
239 nmdc:mga09592_83178_c1 3300050508 Bacteria 2728
240 nmdc:mga0qj67_425325_c1 3300050509 Bacteria 1071
241 nmdc:mga06r32_13073_c1 3300050510 Bacteria 7513
242 nmdc:mga06r32_206209_c1 3300050510 Bacteria 1954
243 nmdc:mga08y16_7395_c1 3300050511 Bacteria 11513
244 nmdc:mga0n895_194696_c1 3300050512 Bacteria 2058
245 nmdc:mga0n895_34300_c1 3300050512 Bacteria 4884
246 nmdc:mga0n895_556520_c1 3300050512 Bacteria 1152
247 nmdc:mga0rr50_10456_c1 3300050513 Bacteria 5889
248 nmdc:mga08x19_22403_c1 3300050514 Bacteria 3913
249 nmdc:mga0a205_247961_c1 3300050515 Bacteria 1661
250 Ga0500644_0036061 3300053088 Bacteria 1607
251 Ga0500555_000360 3300053103 Bacteria 19391
252 Ga0500616_0000422 3300053153 Bacteria 56691
253 Ga0500645_000097 3300053730 Bacteria 69232
254 Ga0501082_0699760 3300060353 Bacteria 887
255 Ga0530510_0215871 3300061734 Bacteria 1425
256 Ga0105249_10273550
257 Ga0065712_10107824
258 Ga0070676_10146824
259 Ga0070676_10441733
260 Ga0070683_100129011
261 Ga0070690_100194492
262 Ga0070670_100815959
263 Ga0070677_10023547
264 Ga0070666_10009915
265 Ga0068868_100000941
266 Ga0070689_100167489
267 Ga0070661_100059149
268 Ga0070668_100109745
269 Ga0070668_100237816
270 Ga0070675_100016033
271 Ga0070675_100426595
272 Ga0070671_100008535
273 Ga0070673_100009608
274 Ga0070688_100072534
275 Ga0070667_100084550
276 Ga0070667_100743526
277 Ga0070711_100089516
278 Ga0070708_100207056
279 Ga0070678_100000547
280 Ga0070678_100065676
281 Ga0070678_100504140
282 Ga0070662_100034058
283 Ga0070662_100254047
284 Ga0070681_10100322
285 Ga0068867_100060825
286 Ga0068867_100418735
287 Ga0068867_100662710
288 Ga0070685_10016812
289 Ga0070685_10092437
290 Ga0070684_100061903
291 Ga0070697_100054785
292 Ga0070672_100035772
293 Ga0070695_100005564
294 Ga0070696_100337534
295 Ga0070665_100353912
296 Ga0070664_100081439
297 Ga0068854_100010779
298 Ga0068856_100852903
299 Ga0068852_100015598
300 Ga0068859_100002626
301 Ga0068864_100000198
302 Ga0068864_100743572
303 Ga0068861_100193592
304 Ga0068863_100094886
305 Ga0068863_100508941
306 Ga0068863_101005830
307 Ga0068858_100020252
308 Ga0068858_100201734
309 Ga0068858_100799461
310 Ga0068860_100013202
311 Ga0068860_100368848
312 Ga0068862_100492628
313 Ga0081538_10085073
314 Ga0070712_100126024
315 Ga0068871_100064915
316 Ga0068871_100123464
317 Ga0068871_100388105
318 Ga0075428_100022838
319 Ga0075428_100027870
320 Ga0075428_100037269
321 Ga0075428_100043191
322 Ga0075428_100666863
323 Ga0075430_100007845
324 Ga0075430_100010191
325 Ga0075430_100055422
326 Ga0075431_100014527
327 Ga0075431_100028316
328 Ga0075431_100047264
329 Ga0075431_100437177
330 Ga0075434_100102760
331 Ga0075434_100111346
332 Ga0075434_100905728
333 Ga0075429_100013870
334 Ga0075429_100026185
335 Ga0075429_100054163
336 Ga0075429_100069530
337 Ga0075436_100010158
338 Ga0097620_100002626
339 Ga0075435_100024718
340 Ga0111539_10009462
341 Ga0105245_10002193
342 Ga0105245_10378551
343 Ga0105247_10257732
344 Ga0114129_10018607
345 Ga0114129_10023851
346 Ga0114129_10025542
347 Ga0114129_10038134
348 Ga0114129_10046211
349 Ga0114129_10061603
350 Ga0105242_10013172
351 Ga0105242_10329621
352 Ga0105248_10062611
353 Ga0105248_10103596
354 Ga0157369_10140998
355 Ga0157374_10001284
356 Ga0157374_10008812
357 Ga0157378_10007058
358 Ga0157378_10035731
359 Ga0157378_10203874
360 Ga0163162_10021022
361 Ga0163162_10151407
362 Ga0157372_10126787
363 Ga0157372_11259767
364 Ga0157375_10020914
365 Ga0163163_10032580
366 Ga0163163_10101084
367 Ga0157380_10097962
368 Ga0157379_10117713
369 Ga0157379_10264820
370 Ga0157376_10004884
371 Ga0207697_10000661
372 Ga0207656_10203753
373 Ga0207682_10011584
374 Ga0207688_10010550
375 Ga0207680_10025799
376 Ga0207680_10043558
377 Ga0207645_10065537
378 Ga0207643_10115037
379 Ga0207707_10024039
380 Ga0207693_10003442
381 Ga0207650_10111643
382 Ga0207659_10010046
383 Ga0207687_10000941
384 Ga0207644_10033200
385 Ga0207644_10484549
386 Ga0207686_10103062
387 Ga0207704_10130785
388 Ga0207665_10678701
389 Ga0207691_10006034
390 Ga0207711_10199585
391 Ga0207711_10941197
392 Ga0207679_10148467
393 Ga0207667_10028037
394 Ga0207651_10140662
395 Ga0207651_10419862
396 Ga0207651_10486374
397 Ga0207668_10089598
398 Ga0207658_10407735
399 Ga0207658_10516196
400 Ga0207658_10794561
401 Ga0207677_10000486
402 Ga0207677_10109664
403 Ga0207703_10172005
404 Ga0207678_10249425
405 Ga0207678_10698547
406 Ga0207708_10464762
407 Ga0207702_10753129
408 Ga0207641_10013057
409 Ga0207641_10992644
410 Ga0207676_10000996
411 Ga0207676_10691287
412 Ga0207674_10242652
413 Ga0207683_10000366
414 Ga0207683_10066384
415 Ga0207683_10110889
416 Ga0207683_10224530
417 Ga0207698_10609537
418 Ga0207428_10005639
419 Ga0268265_10721505
420 Ga0268264_10645448
421 Ga0307513_10191700
422 Ga0307408_100096090
423 Ga0307408_100180306
424 Ga0307408_100202912
425 Ga0307408_100520672
426 Ga0307405_10115205
427 Ga0307405_10115711
428 Ga0307413_10368425
429 Ga0307413_10576791
430 Ga0307410_10031405
431 Ga0307410_10366077
432 Ga0307406_10030594
433 Ga0307406_10220649
434 Ga0307407_10036450
435 Ga0307407_10083639
436 Ga0307407_10413627
437 Ga0307412_10056827
438 Ga0307412_10060535
439 Ga0307412_10291110
440 Ga0307409_100090193
441 Ga0307409_100107671
442 Ga0307409_100166198
443 Ga0307416_100020354
444 Ga0307416_100124026
445 Ga0307414_10082297
446 Ga0307411_10295619
447 Ga0307415_100323845
448 Ga0307415_100457478
449 Ga0373923_0178161
450 Ga0373953_0053759
451 Ga0373933_0196847
452 Ga0373937_0271404
453 Ga0439453_0003509
454 Ga0439431_0050707
455 Ga0439443_003306
456 Ga0439450_072238
457 Ga0439454_002762
458 Ga0439435_0023853
459 Ga0439444_0010865
460 Ga0439464_0006323
461 Ga0439460_0101634
462 Ga0450916_010496
463 Ga0451576_1050269
464 Ga0495659_0008452
465 Ga0496104_0202354
466 Ga0496108_0033465
467 Ga0496108_0681736
468 Ga0496109_0389858
469 Ga0496110_0014677
470 Ga0496112_0100937
471 Ga0496112_0141693
472 Ga0501309_024245
473 Ga0501292_028162
474 Ga0501298_033615
475 Ga0501299_000874
476 Ga0501301_015256
477 Ga0501040_0283180
478 Ga0501048_0278764
479 Ga0501071_0592636
480 Ga0501075_0350626
481 Ga0501249_020466
482 Ga0501225_0088272
483 Ga0501263_019049
484 Ga0501212_028026
485 nmdc:mga05p37_15099_c1
486 nmdc:mga05p37_19081_c1
487 nmdc:mga05p37_30094_c1
488 nmdc:mga05p37_6438_c1
489 nmdc:mga05p37_648_c1
490 nmdc:mga05p37_690822_c1
491 nmdc:mga09592_11213_c1
492 nmdc:mga09592_13654_c1
493 nmdc:mga09592_52378_c1
494 nmdc:mga09592_83178_c1
495 nmdc:mga0qj67_425325_c1
496 nmdc:mga06r32_13073_c1
497 nmdc:mga06r32_206209_c1
498 nmdc:mga08y16_7395_c1
499 nmdc:mga0n895_194696_c1
500 nmdc:mga0n895_34300_c1
501 nmdc:mga0n895_556520_c1
502 nmdc:mga0rr50_10456_c1
503 nmdc:mga08x19_22403_c1
504 nmdc:mga0a205_247961_c1
505 Ga0500644_0036061
506 Ga0500555_000360
507 Ga0500616_0000422
508 Ga0500645_000097
509 Ga0501082_0699760
510 Ga0530510_0215871

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

49

79

0.89

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

46

179

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8257 26 159
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.8185 25 158
5ujp-assembly1.cif.gz_B the crystal structure of a glyoxalase/bleomycin resistance protein from streptomyces sp. cb03234 0.7989 25 158
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.7865 25 158
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.7847 25 161
ID Description Score Start End Superfamily
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8106 25 158 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.791 25 158 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7777 20 158 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7763 25 162 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7663 20 158 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A387BKC5-F1-model_v4 Glyoxalase 0.9309 21 166
AF-A0A6B2DH88-F1-model_v4 VOC family protein 0.9229 21 167
AF-A0A387BKC5-F1-model_v4 Glyoxalase 0.9189 21 166
AF-A0A7W5D5G8-F1-model_v4 VOC domain-containing protein 0.9187 91 167
AF-A0A1Z4GUG3-F1-model_v4 deleted 0.9182 74 166

Map