F365673
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 183 | 247 | 365 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10072004|Ga0105238_100720042 |
| Length | 393 |
| Sequence | MQQHNLPATRTPRLPMSGVWTAMGLLAAVATTSLAASPAPKPSVAHAPFGRAGNEAVELYTLTNAHGVEVQVMTYGATLVSIKTPDRTGQLANIILGFDTLQPYLAGVPYFGATVGRYANRIANARFTLDGKQYELSRNDGPNSLHGGSRGFDKRIWQVEPSPGKSAATLRMKYVSAAGEEGYPGELTAHVSYRLSDDDRLVIEYSATTTAATPVNLANHAYFNLTGDPHQTILGHVLTIDASRFTPVNSTLIPLGELRPVAGTPFDFRTPMAIGSRIAADDEQLRLGHGYDHNWVLEPAAGHEARLAAVLTDPTSGRSLEIRTTQPGLQFYSGNFLDGKPAGHGTVFPYRTGLCLETQHFPDSPNQPAFPDTILRPGQRYSATTVLRFSVQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 2 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 3 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 4 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 5 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 6 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 101 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 103 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 104 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 108 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 109 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 110 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 111 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 112 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 116 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 117 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 118 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 119 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 120 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 121 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 122 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 123 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 124 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 125 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 157 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 158 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 159 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 160 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 161 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 163 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 164 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 165 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 166 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 167 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 168 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 169 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 170 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 171 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 172 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 177 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 178 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 179 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 180 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 181 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 183 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.47 |
| Metatranscriptomes | 0.78 |
| Isolates | 2.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.96 |
| Nodule | 0 |
| Rhizoplane | 3.14 |
| Rhizosphere | 84.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10127356 | 3300003320 | Unclassified | 3197 |
| 2 | rootL2_10070531 | 3300003322 | Bacteria | 7438 |
| 3 | Ga0065715_10021453 | 3300005293 | Unclassified | 2465 |
| 4 | Ga0070658_10076358 | 3300005327 | Bacteria | 2748 |
| 5 | Ga0070683_100043926 | 3300005329 | Bacteria | 4120 |
| 6 | Ga0070682_100029594 | 3300005337 | Bacteria | 3298 |
| 7 | Ga0070660_100013161 | 3300005339 | Bacteria | 5929 |
| 8 | Ga0070660_100063787 | 3300005339 | Bacteria | 2864 |
| 9 | Ga0070668_100002288 | 3300005347 | Bacteria | 14127 |
| 10 | Ga0070669_100053085 | 3300005353 | Bacteria | 2966 |
| 11 | Ga0070671_100002260 | 3300005355 | Bacteria | 14870 |
| 12 | Ga0070673_100071518 | 3300005364 | Bacteria | 2788 |
| 13 | Ga0070659_100063112 | 3300005366 | Bacteria | 2930 |
| 14 | Ga0070713_100224383 | 3300005436 | Bacteria | 1706 |
| 15 | Ga0070678_100082989 | 3300005456 | Bacteria | 2435 |
| 16 | Ga0070681_10001905 | 3300005458 | Bacteria | 18821 |
| 17 | Ga0070681_10351520 | 3300005458 | Unclassified | 1384 |
| 18 | Ga0070698_100010458 | 3300005471 | Bacteria | 9906 |
| 19 | Ga0070679_100030446 | 3300005530 | Bacteria | 5328 |
| 20 | Ga0068853_100039546 | 3300005539 | Bacteria | 4023 |
| 21 | Ga0070672_100151706 | 3300005543 | Bacteria | 1917 |
| 22 | Ga0070665_100093902 | 3300005548 | Bacteria | 3005 |
| 23 | Ga0070665_100150518 | 3300005548 | Bacteria | 2330 |
| 24 | Ga0068855_100000047 | 3300005563 | Bacteria | 145355 |
| 25 | Ga0068855_100065376 | 3300005563 | Bacteria | 4240 |
| 26 | Ga0068855_100218510 | 3300005563 | Bacteria | 2138 |
| 27 | Ga0068855_100280948 | 3300005563 | Bacteria | 1849 |
| 28 | Ga0070664_100304058 | 3300005564 | Bacteria | 1442 |
| 29 | Ga0068856_100000551 | 3300005614 | Bacteria | 41390 |
| 30 | Ga0068856_100000838 | 3300005614 | Bacteria | 33188 |
| 31 | Ga0068852_100003811 | 3300005616 | Bacteria | 10583 |
| 32 | Ga0068852_100264228 | 3300005616 | Bacteria | 1653 |
| 33 | Ga0068859_100000050 | 3300005617 | Bacteria | 131351 |
| 34 | Ga0068859_100054016 | 3300005617 | Bacteria | 4040 |
| 35 | Ga0068864_100058459 | 3300005618 | Bacteria | 3333 |
| 36 | Ga0068861_100080337 | 3300005719 | Bacteria | 2551 |
| 37 | Ga0068863_100017074 | 3300005841 | Bacteria | 6960 |
| 38 | Ga0068863_100018629 | 3300005841 | Bacteria | 6642 |
| 39 | Ga0068863_100120009 | 3300005841 | Bacteria | 2506 |
| 40 | Ga0068858_100008500 | 3300005842 | Bacteria | 9865 |
| 41 | Ga0068858_100008788 | 3300005842 | Bacteria | 9688 |
| 42 | Ga0068860_100001030 | 3300005843 | Bacteria | 30734 |
| 43 | Ga0068862_100005969 | 3300005844 | Bacteria | 10140 |
| 44 | Ga0075436_100024103 | 3300006914 | Bacteria | 4183 |
| 45 | Ga0097620_100000050 | 3300006931 | Bacteria | 131351 |
| 46 | Ga0097620_100054016 | 3300006931 | Bacteria | 4040 |
| 47 | Ga0105250_10061748 | 3300009092 | Bacteria | 1507 |
| 48 | Ga0105240_10000647 | 3300009093 | Bacteria | 64299 |
| 49 | Ga0105240_10014185 | 3300009093 | Bacteria | 10883 |
| 50 | Ga0105240_10095008 | 3300009093 | Bacteria | 3636 |
| 51 | Ga0111539_10363409 | 3300009094 | Bacteria | 1685 |
| 52 | Ga0105247_10000173 | 3300009101 | Bacteria | 63815 |
| 53 | Ga0105247_10011040 | 3300009101 | Bacteria | 5450 |
| 54 | Ga0105247_10021775 | 3300009101 | Bacteria | 3856 |
| 55 | Ga0114129_10111562 | 3300009147 | Bacteria | 3773 |
| 56 | Ga0114129_10287068 | 3300009147 | Bacteria | 2197 |
| 57 | Ga0105243_10011176 | 3300009148 | Bacteria | 6791 |
| 58 | Ga0105242_10007911 | 3300009176 | Bacteria | 8183 |
| 59 | Ga0105242_10181216 | 3300009176 | Bacteria | 1858 |
| 60 | Ga0105248_10080629 | 3300009177 | Bacteria | 3658 |
| 61 | Ga0105238_10072004 | 3300009551 | Bacteria | 3453 |
| 62 | Ga0105238_10169853 | 3300009551 | Bacteria | 2157 |
| 63 | Ga0105238_10253628 | 3300009551 | Bacteria | 1738 |
| 64 | Ga0105249_10025127 | 3300009553 | Bacteria | 5361 |
| 65 | Ga0105249_10168550 | 3300009553 | Bacteria | 2122 |
| 66 | Ga0105239_10001683 | 3300010375 | Bacteria | 29162 |
| 67 | Ga0105239_10014732 | 3300010375 | Bacteria | 8672 |
| 68 | Ga0105239_10581784 | 3300010375 | Bacteria | 1276 |
| 69 | Ga0157369_10019573 | 3300013105 | Bacteria | 7575 |
| 70 | Ga0157369_10030560 | 3300013105 | Bacteria | 5941 |
| 71 | Ga0157369_10076474 | 3300013105 | Bacteria | 3588 |
| 72 | Ga0157369_10442085 | 3300013105 | Unclassified | 1347 |
| 73 | Ga0157374_10014479 | 3300013296 | Bacteria | 6902 |
| 74 | Ga0163162_10148371 | 3300013306 | Bacteria | 2462 |
| 75 | Ga0163162_10157089 | 3300013306 | Bacteria | 2395 |
| 76 | Ga0157372_10086739 | 3300013307 | Bacteria | 3551 |
| 77 | Ga0157372_10106838 | 3300013307 | Bacteria | 3202 |
| 78 | Ga0157372_10110407 | 3300013307 | Bacteria | 3150 |
| 79 | Ga0163163_10030302 | 3300014325 | Bacteria | 5212 |
| 80 | Ga0157380_10053635 | 3300014326 | Unclassified | 3197 |
| 81 | Ga0157380_10125597 | 3300014326 | Bacteria | 2180 |
| 82 | Ga0157379_10034747 | 3300014968 | Bacteria | 4496 |
| 83 | Ga0157376_10018876 | 3300014969 | Bacteria | 5301 |
| 84 | Ga0207655_1038180 | 3300025728 | Bacteria | 2103 |
| 85 | Ga0207710_10000187 | 3300025900 | Bacteria | 60181 |
| 86 | Ga0207710_10007504 | 3300025900 | Bacteria | 4618 |
| 87 | Ga0207710_10103306 | 3300025900 | Bacteria | 1346 |
| 88 | Ga0207654_10032118 | 3300025911 | Bacteria | 2897 |
| 89 | Ga0207707_10005427 | 3300025912 | Bacteria | 11146 |
| 90 | Ga0207695_10000003 | 3300025913 | Bacteria | 1368691 |
| 91 | Ga0207695_10016976 | 3300025913 | Bacteria | 8493 |
| 92 | Ga0207695_10250459 | 3300025913 | Bacteria | 1671 |
| 93 | Ga0207657_10065850 | 3300025919 | Bacteria | 3087 |
| 94 | Ga0207657_10109849 | 3300025919 | Bacteria | 2278 |
| 95 | Ga0207649_10039785 | 3300025920 | Bacteria | 2853 |
| 96 | Ga0207652_10030835 | 3300025921 | Bacteria | 4495 |
| 97 | Ga0207681_10113660 | 3300025923 | Bacteria | 1974 |
| 98 | Ga0207694_10000011 | 3300025924 | Bacteria | 417640 |
| 99 | Ga0207694_10082604 | 3300025924 | Bacteria | 2525 |
| 100 | Ga0207694_10275092 | 3300025924 | Bacteria | 1382 |
| 101 | Ga0207659_10122607 | 3300025926 | Bacteria | 1994 |
| 102 | Ga0207644_10009174 | 3300025931 | Bacteria | 6487 |
| 103 | Ga0207690_10158942 | 3300025932 | Bacteria | 1683 |
| 104 | Ga0207706_10065258 | 3300025933 | Bacteria | 3206 |
| 105 | Ga0207686_10000978 | 3300025934 | Bacteria | 17007 |
| 106 | Ga0207670_10026808 | 3300025936 | Bacteria | 3636 |
| 107 | Ga0207691_10086712 | 3300025940 | Bacteria | 2809 |
| 108 | Ga0207711_10043420 | 3300025941 | Bacteria | 3834 |
| 109 | Ga0207711_10234192 | 3300025941 | Bacteria | 1682 |
| 110 | Ga0207679_10299785 | 3300025945 | Bacteria | 1385 |
| 111 | Ga0207667_10000050 | 3300025949 | Bacteria | 234390 |
| 112 | Ga0207667_10118285 | 3300025949 | Bacteria | 2731 |
| 113 | Ga0207667_10340299 | 3300025949 | Bacteria | 1531 |
| 114 | Ga0207651_10094457 | 3300025960 | Bacteria | 2199 |
| 115 | Ga0207712_10045330 | 3300025961 | Bacteria | 3044 |
| 116 | Ga0207658_10004435 | 3300025986 | Bacteria | 9760 |
| 117 | Ga0207677_10159525 | 3300026023 | Bacteria | 1751 |
| 118 | Ga0207703_10000380 | 3300026035 | Bacteria | 47455 |
| 119 | Ga0207703_10002799 | 3300026035 | Bacteria | 14896 |
| 120 | Ga0207639_10266319 | 3300026041 | Bacteria | 1501 |
| 121 | Ga0207678_10046000 | 3300026067 | Bacteria | 3774 |
| 122 | Ga0207702_10000964 | 3300026078 | Bacteria | 29579 |
| 123 | Ga0207702_10032946 | 3300026078 | Bacteria | 4325 |
| 124 | Ga0207641_10002173 | 3300026088 | Bacteria | 18468 |
| 125 | Ga0207641_10003004 | 3300026088 | Bacteria | 15238 |
| 126 | Ga0207641_10110464 | 3300026088 | Bacteria | 2436 |
| 127 | Ga0207676_10035930 | 3300026095 | Bacteria | 3766 |
| 128 | Ga0207675_100191801 | 3300026118 | Bacteria | 1960 |
| 129 | Ga0207683_10112170 | 3300026121 | Bacteria | 2442 |
| 130 | Ga0207698_10003695 | 3300026142 | Bacteria | 9255 |
| 131 | Ga0207428_10171487 | 3300027907 | Bacteria | 1643 |
| 132 | Ga0268266_10007902 | 3300028379 | Bacteria | 9522 |
| 133 | Ga0268266_10069236 | 3300028379 | Bacteria | 3057 |
| 134 | Ga0268264_10000145 | 3300028381 | Bacteria | 167262 |
| 135 | Ga0265334_10011122 | 3300028573 | Bacteria | 3792 |
| 136 | Ga0265318_10000047 | 3300028577 | Bacteria | 123944 |
| 137 | Ga0265318_10000072 | 3300028577 | Bacteria | 96797 |
| 138 | Ga0307515_10168245 | 3300028794 | Bacteria | 2199 |
| 139 | Ga0265338_10002891 | 3300028800 | Bacteria | 25029 |
| 140 | Ga0265338_10059038 | 3300028800 | Bacteria | 3382 |
| 141 | Ga0307511_10000112 | 3300030521 | Bacteria | 73319 |
| 142 | Ga0265760_10008234 | 3300031090 | Bacteria | 2980 |
| 143 | Ga0265320_10007681 | 3300031240 | Bacteria | 6668 |
| 144 | Ga0265327_10000369 | 3300031251 | Bacteria | 85139 |
| 145 | Ga0307509_10000002 | 3300031507 | Bacteria | 607551 |
| 146 | Ga0265313_10031952 | 3300031595 | Bacteria | 2694 |
| 147 | Ga0265313_10034372 | 3300031595 | Bacteria | 2564 |
| 148 | Ga0265314_10000872 | 3300031711 | Bacteria | 35886 |
| 149 | Ga0307406_10284827 | 3300031901 | Bacteria | 1262 |
| 150 | Ga0307412_10015457 | 3300031911 | Bacteria | 4528 |
| 151 | Ga0307411_10142931 | 3300032005 | Unclassified | 1767 |
| 152 | Ga0307510_10000007 | 3300033180 | Bacteria | 558582 |
| 153 | Ga0307510_10002115 | 3300033180 | Bacteria | 22465 |
| 154 | Ga0395899_0009673 | 3300037312 | Bacteria | 7400 |
| 155 | Ga0395899_0111678 | 3300037312 | Bacteria | 1964 |
| 156 | Ga0395900_0028326 | 3300037418 | Bacteria | 5736 |
| 157 | Ga0395900_0119214 | 3300037418 | Bacteria | 2708 |
| 158 | Ga0395898_0040251 | 3300037466 | Bacteria | 4622 |
| 159 | Ga0395905_0169278 | 3300037471 | Bacteria | 2052 |
| 160 | Ga0395905_0228677 | 3300037471 | Bacteria | 1739 |
| 161 | Ga0395901_0005719 | 3300038443 | Bacteria | 12589 |
| 162 | Ga0436365_0661594 | 3300039437 | Bacteria | 1327 |
| 163 | Ga0439431_0005102 | 3300041997 | Bacteria | 2895 |
| 164 | Ga0439448_0001293 | 3300042005 | Bacteria | 6400 |
| 165 | Ga0439450_010534 | 3300042008 | Bacteria | 1786 |
| 166 | Ga0439455_0002515 | 3300042012 | Bacteria | 3347 |
| 167 | Ga0450904_000258 | 3300042139 | Bacteria | 11411 |
| 168 | Ga0450893_0012793 | 3300042532 | Bacteria | 1395 |
| 169 | Ga0466972_0009564 | 3300044658 | Bacteria | 4866 |
| 170 | Ga0466965_0007237 | 3300044683 | Bacteria | 5086 |
| 171 | Ga0466965_0015756 | 3300044683 | Bacteria | 3592 |
| 172 | Ga0466966_0006384 | 3300044684 | Bacteria | 7795 |
| 173 | Ga0466966_0097487 | 3300044684 | Bacteria | 1821 |
| 174 | Ga0466964_0001348 | 3300044706 | Bacteria | 8384 |
| 175 | Ga0466964_0025245 | 3300044706 | Bacteria | 2319 |
| 176 | Ga0466968_0004950 | 3300044735 | Bacteria | 4989 |
| 177 | Ga0466957_0000104 | 3300044842 | Bacteria | 34466 |
| 178 | Ga0466957_0049729 | 3300044842 | Bacteria | 2549 |
| 179 | Ga0466959_0104131 | 3300045049 | Bacteria | 2030 |
| 180 | Ga0451576_0001309 | 3300045051 | Bacteria | 43108 |
| 181 | Ga0466958_0032623 | 3300045836 | Bacteria | 3099 |
| 182 | Ga0466967_0150808 | 3300045976 | Bacteria | 2172 |
| 183 | Ga0495638_0000305 | 3300046460 | Bacteria | 63286 |
| 184 | Ga0495605_0000065 | 3300046474 | Bacteria | 139441 |
| 185 | Ga0495607_0060402 | 3300046501 | Bacteria | 2157 |
| 186 | Ga0495583_0000008 | 3300046506 | Bacteria | 411092 |
| 187 | Ga0495583_0000710 | 3300046506 | Bacteria | 42765 |
| 188 | Ga0495632_0002377 | 3300046519 | Bacteria | 14391 |
| 189 | Ga0495643_0018663 | 3300046522 | Bacteria | 4024 |
| 190 | Ga0495648_0000235 | 3300046524 | Bacteria | 63436 |
| 191 | Ga0495648_0027847 | 3300046524 | Bacteria | 3775 |
| 192 | Ga0495642_0023947 | 3300046528 | Bacteria | 2413 |
| 193 | Ga0495652_0039472 | 3300046529 | Bacteria | 4082 |
| 194 | Ga0495645_0005405 | 3300046543 | Bacteria | 8761 |
| 195 | Ga0495645_0194434 | 3300046543 | Bacteria | 1380 |
| 196 | Ga0495661_0000715 | 3300046665 | Bacteria | 32660 |
| 197 | Ga0495658_0154650 | 3300046683 | Bacteria | 1411 |
| 198 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 199 | Ga0495649_0082992 | 3300046694 | Bacteria | 1712 |
| 200 | Ga0495649_0145397 | 3300046694 | Bacteria | 1247 |
| 201 | Ga0495589_0000100 | 3300046794 | Bacteria | 83307 |
| 202 | Ga0495660_0000027 | 3300046810 | Bacteria | 254331 |
| 203 | Ga0495660_0036568 | 3300046810 | Bacteria | 2738 |
| 204 | Ga0495636_0038669 | 3300047318 | Bacteria | 1975 |
| 205 | Ga0495672_0002802 | 3300047320 | Bacteria | 15553 |
| 206 | Ga0495683_0034750 | 3300047323 | Bacteria | 2563 |
| 207 | Ga0495687_017468 | 3300047443 | Bacteria | 3578 |
| 208 | Ga0495687_029140 | 3300047443 | Bacteria | 2559 |
| 209 | Ga0495675_0006253 | 3300047444 | Bacteria | 7285 |
| 210 | Ga0495677_0014893 | 3300047445 | Bacteria | 2828 |
| 211 | Ga0495677_0033631 | 3300047445 | Bacteria | 1868 |
| 212 | Ga0495673_0000316 | 3300047469 | Bacteria | 62814 |
| 213 | Ga0495626_0000222 | 3300048091 | Bacteria | 67304 |
| 214 | Ga0496102_0036549 | 3300048905 | Bacteria | 4425 |
| 215 | Ga0496104_0444931 | 3300048907 | Bacteria | 1208 |
| 216 | Ga0496105_0119960 | 3300048908 | Bacteria | 2169 |
| 217 | Ga0496106_0169862 | 3300048909 | Bacteria | 1728 |
| 218 | Ga0496107_0275217 | 3300048910 | Bacteria | 1253 |
| 219 | Ga0496109_0354080 | 3300048912 | Bacteria | 1387 |
| 220 | Ga0496109_0413683 | 3300048912 | Bacteria | 1274 |
| 221 | Ga0496112_0022457 | 3300048915 | Bacteria | 6014 |
| 222 | Ga0496117_0000044 | 3300048920 | Bacteria | 301076 |
| 223 | Ga0496118_0000019 | 3300048921 | Bacteria | 489649 |
| 224 | Ga0496119_0000655 | 3300048922 | Bacteria | 46562 |
| 225 | Ga0496119_0014877 | 3300048922 | Bacteria | 6049 |
| 226 | Ga0496120_0000381 | 3300048923 | Bacteria | 71695 |
| 227 | Ga0496120_0014178 | 3300048923 | Bacteria | 5321 |
| 228 | Ga0496121_0001385 | 3300048924 | Bacteria | 41022 |
| 229 | Ga0496122_0020696 | 3300048925 | Bacteria | 5926 |
| 230 | Ga0496123_0003516 | 3300048926 | Bacteria | 17450 |
| 231 | Ga0496124_0038009 | 3300048927 | Bacteria | 4181 |
| 232 | Ga0496125_0000606 | 3300048928 | Bacteria | 60912 |
| 233 | Ga0496125_0020908 | 3300048928 | Bacteria | 6123 |
| 234 | Ga0496125_0022813 | 3300048928 | Bacteria | 5801 |
| 235 | Ga0496126_0021106 | 3300048929 | Bacteria | 6368 |
| 236 | Ga0496126_0198504 | 3300048929 | Bacteria | 1695 |
| 237 | Ga0501034_0193160 | 3300049571 | Bacteria | 1997 |
| 238 | nmdc:mga05p37_38118_c1 | 3300050507 | Bacteria | 5895 |
| 239 | nmdc:mga08y16_382997_c1 | 3300050511 | Bacteria | 1441 |
| 240 | nmdc:mga08y16_421961_c1 | 3300050511 | Bacteria | 1363 |
| 241 | Ga0500583_0140316 | 3300053092 | Bacteria | 1201 |
| 242 | Ga0500568_0033379 | 3300053139 | Bacteria | 2112 |
| 243 | Ga0500588_0012122 | 3300053146 | Bacteria | 2129 |
| 244 | Ga0500622_0012004 | 3300053156 | Bacteria | 4711 |
| 245 | Ga0500637_0001621 | 3300053178 | Bacteria | 9643 |
| 246 | Ga0587105_001997 | 3300059651 | Bacteria | 1124 |
| 247 | Ga0466962_0076981 | 3300061719 | Bacteria | 1594 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046694 | Ga0495649_0145397 | Ga0495649_0145397_293_1237 | 314 |
| 2 | 3300047318 | Ga0495636_0038669 | Ga0495636_0038669_990_1955 | 317 |
| 3 | 3300013307 | Ga0157372_10106838 | Ga0157372_101068382 | 325 |
| 4 | 3300037471 | Ga0395905_0169278 | Ga0395905_0169278_409_1470 | 331 |
| 5 | 3300046694 | Ga0495649_0082992 | Ga0495649_0082992_670_1674 | 332 |
| 6 | 3300031251 | Ga0265327_10000369 | Ga0265327_1000036959 | 335 |
| 7 | 3300005347 | Ga0070668_100002288 | Ga0070668_1000022882 | 336 |
| 8 | 3300005543 | Ga0070672_100151706 | Ga0070672_1001517062 | 336 |
| 9 | 3300025926 | Ga0207659_10122607 | Ga0207659_101226072 | 336 |
| 10 | 3300026041 | Ga0207639_10266319 | Ga0207639_102663191 | 336 |
| 11 | 3300047443 | Ga0495687_029140 | Ga0495687_029140_27_1043 | 336 |
| 12 | 3300053092 | Ga0500583_0140316 | Ga0500583_0140316_26_1036 | 336 |
| 13 | 3300039437 | Ga0436365_0661594 | Ga0436365_0661594_83_1096 | 337 |
| 14 | 3300044684 | Ga0466966_0006384 | Ga0466966_0006384_6149_7171 | 337 |
| 15 | 3300044706 | Ga0466964_0001348 | Ga0466964_0001348_2769_3791 | 337 |
| 16 | 3300048926 | Ga0496123_0003516 | Ga0496123_0003516_4954_5976 | 337 |
| 17 | 3300061719 | Ga0466962_0076981 | Ga0466962_0076981_231_1253 | 337 |
| 18 | 3300013105 | Ga0157369_10442085 | Ga0157369_104420852 | 338 |
| 19 | 3300046506 | Ga0495583_0000008 | Ga0495583_0000008_214874_215926 | 341 |
| 20 | 3300046506 | Ga0495583_0000008 | Ga0495583_0000008_238343_239398 | 341 |
| 21 | 3300031901 | Ga0307406_10284827 | Ga0307406_102848271 | 342 |
| 22 | 3300032005 | Ga0307411_10142931 | Ga0307411_101429312 | 342 |
| 23 | 3300042139 | Ga0450904_000258 | Ga0450904_000258_2999_4060 | 343 |
| 24 | 3300009148 | Ga0105243_10011176 | Ga0105243_100111765 | 344 |
| 25 | 3300025728 | Ga0207655_1038180 | Ga0207655_10381802 | 344 |
| 26 | 3300046460 | Ga0495638_0000305 | Ga0495638_0000305_51178_52230 | 344 |
| 27 | 3300046506 | Ga0495583_0000710 | Ga0495583_0000710_27838_28890 | 344 |
| 28 | 3300046519 | Ga0495632_0002377 | Ga0495632_0002377_4536_5588 | 344 |
| 29 | 3300046524 | Ga0495648_0000235 | Ga0495648_0000235_11240_12292 | 344 |
| 30 | 3300046528 | Ga0495642_0023947 | Ga0495642_0023947_1306_2361 | 344 |
| 31 | 3300046692 | Ga0495671_0000020 | Ga0495671_0000020_256107_257159 | 344 |
| 32 | 3300047445 | Ga0495677_0014893 | Ga0495677_0014893_385_1440 | 344 |
| 33 | 3300047469 | Ga0495673_0000316 | Ga0495673_0000316_11148_12200 | 344 |
| 34 | 3300048907 | Ga0496104_0444931 | Ga0496104_0444931_107_1162 | 344 |
| 35 | 3300048908 | Ga0496105_0119960 | Ga0496105_0119960_677_1732 | 344 |
| 36 | 3300050511 | nmdc:mga08y16_382997_c1 | nmdc:mga08y16_382997_c1_29_1153 | 344 |
| 37 | 3300003322 | rootL2_10070531 | rootL2_100705316 | 345 |
| 38 | 3300005339 | Ga0070660_100013161 | Ga0070660_1000131613 | 345 |
| 39 | 3300005339 | Ga0070660_100063787 | Ga0070660_1000637873 | 345 |
| 40 | 3300005366 | Ga0070659_100063112 | Ga0070659_1000631123 | 345 |
| 41 | 3300005563 | Ga0068855_100065376 | Ga0068855_1000653763 | 345 |
| 42 | 3300005564 | Ga0070664_100304058 | Ga0070664_1003040582 | 345 |
| 43 | 3300005616 | Ga0068852_100264228 | Ga0068852_1002642282 | 345 |
| 44 | 3300010375 | Ga0105239_10581784 | Ga0105239_105817842 | 345 |
| 45 | 3300025911 | Ga0207654_10032118 | Ga0207654_100321183 | 345 |
| 46 | 3300025919 | Ga0207657_10065850 | Ga0207657_100658503 | 345 |
| 47 | 3300025919 | Ga0207657_10109849 | Ga0207657_101098492 | 345 |
| 48 | 3300025932 | Ga0207690_10158942 | Ga0207690_101589422 | 345 |
| 49 | 3300025933 | Ga0207706_10065258 | Ga0207706_100652582 | 345 |
| 50 | 3300037312 | Ga0395899_0009673 | Ga0395899_0009673_1235_2293 | 345 |
| 51 | 3300037312 | Ga0395899_0111678 | Ga0395899_0111678_55_1113 | 345 |
| 52 | 3300037418 | Ga0395900_0028326 | Ga0395900_0028326_1385_2443 | 345 |
| 53 | 3300037418 | Ga0395900_0119214 | Ga0395900_0119214_1596_2654 | 345 |
| 54 | 3300037466 | Ga0395898_0040251 | Ga0395898_0040251_2330_3388 | 345 |
| 55 | 3300037471 | Ga0395905_0228677 | Ga0395905_0228677_584_1642 | 345 |
| 56 | 3300038443 | Ga0395901_0005719 | Ga0395901_0005719_1235_2293 | 345 |
| 57 | 3300042005 | Ga0439448_0001293 | Ga0439448_0001293_2578_3636 | 345 |
| 58 | 3300042008 | Ga0439450_010534 | Ga0439450_010534_387_1445 | 345 |
| 59 | 3300042012 | Ga0439455_0002515 | Ga0439455_0002515_402_1460 | 345 |
| 60 | 3300042532 | Ga0450893_0012793 | Ga0450893_0012793_147_1205 | 345 |
| 61 | 3300044658 | Ga0466972_0009564 | Ga0466972_0009564_2616_3674 | 345 |
| 62 | 3300044683 | Ga0466965_0007237 | Ga0466965_0007237_2090_3148 | 345 |
| 63 | 3300044683 | Ga0466965_0015756 | Ga0466965_0015756_182_1240 | 345 |
| 64 | 3300044684 | Ga0466966_0097487 | Ga0466966_0097487_386_1444 | 345 |
| 65 | 3300044706 | Ga0466964_0025245 | Ga0466964_0025245_1251_2309 | 345 |
| 66 | 3300044735 | Ga0466968_0004950 | Ga0466968_0004950_1896_2954 | 345 |
| 67 | 3300044842 | Ga0466957_0000104 | Ga0466957_0000104_1318_2376 | 345 |
| 68 | 3300044842 | Ga0466957_0049729 | Ga0466957_0049729_98_1156 | 345 |
| 69 | 3300045049 | Ga0466959_0104131 | Ga0466959_0104131_881_1939 | 345 |
| 70 | 3300046474 | Ga0495605_0000065 | Ga0495605_0000065_32706_33764 | 345 |
| 71 | 3300046501 | Ga0495607_0060402 | Ga0495607_0060402_1033_2091 | 345 |
| 72 | 3300046522 | Ga0495643_0018663 | Ga0495643_0018663_1934_2992 | 345 |
| 73 | 3300046524 | Ga0495648_0027847 | Ga0495648_0027847_1171_2229 | 345 |
| 74 | 3300046665 | Ga0495661_0000715 | Ga0495661_0000715_25809_26867 | 345 |
| 75 | 3300046794 | Ga0495589_0000100 | Ga0495589_0000100_59026_60084 | 345 |
| 76 | 3300046810 | Ga0495660_0000027 | Ga0495660_0000027_186934_187992 | 345 |
| 77 | 3300046810 | Ga0495660_0036568 | Ga0495660_0036568_660_1718 | 345 |
| 78 | 3300047320 | Ga0495672_0002802 | Ga0495672_0002802_13051_14109 | 345 |
| 79 | 3300047323 | Ga0495683_0034750 | Ga0495683_0034750_1329_2387 | 345 |
| 80 | 3300047443 | Ga0495687_017468 | Ga0495687_017468_2257_3315 | 345 |
| 81 | 3300047445 | Ga0495677_0033631 | Ga0495677_0033631_362_1420 | 345 |
| 82 | 3300048091 | Ga0495626_0000222 | Ga0495626_0000222_31611_32669 | 345 |
| 83 | 3300048905 | Ga0496102_0036549 | Ga0496102_0036549_537_1661 | 345 |
| 84 | 3300048912 | Ga0496109_0354080 | Ga0496109_0354080_51_1109 | 345 |
| 85 | 3300048920 | Ga0496117_0000044 | Ga0496117_0000044_223703_224827 | 345 |
| 86 | 3300048921 | Ga0496118_0000019 | Ga0496118_0000019_21157_22281 | 345 |
| 87 | 3300048925 | Ga0496122_0020696 | Ga0496122_0020696_2627_3685 | 345 |
| 88 | 3300048927 | Ga0496124_0038009 | Ga0496124_0038009_538_1662 | 345 |
| 89 | 3300048929 | Ga0496126_0021106 | Ga0496126_0021106_1248_2372 | 345 |
| 90 | 3300059651 | Ga0587105_001997 | Ga0587105_001997_44_1099 | 345 |
| 91 | iso_pu_bacteria | 2643221556 | 2643801499 | 345 |
| 92 | iso_pu_bacteria | 2643221684 | 2644471439 | 345 |
| 93 | iso_pu_bacteria | 8047673197 | 8047677197 | 345 |
| 94 | 3300009176 | Ga0105242_10007911 | Ga0105242_100079113 | 346 |
| 95 | 3300013306 | Ga0163162_10157089 | Ga0163162_101570892 | 346 |
| 96 | 3300014969 | Ga0157376_10018876 | Ga0157376_100188762 | 346 |
| 97 | 3300031911 | Ga0307412_10015457 | Ga0307412_100154573 | 346 |
| 98 | 3300028573 | Ga0265334_10011122 | Ga0265334_100111222 | 347 |
| 99 | 3300028577 | Ga0265318_10000047 | Ga0265318_10000047104 | 347 |
| 100 | 3300031240 | Ga0265320_10007681 | Ga0265320_100076812 | 347 |
| 101 | 3300031595 | Ga0265313_10034372 | Ga0265313_100343721 | 347 |
| 102 | 3300031711 | Ga0265314_10000872 | Ga0265314_1000087222 | 347 |
| 103 | 3300028794 | Ga0307515_10168245 | Ga0307515_101682452 | 348 |
| 104 | 3300005293 | Ga0065715_10021453 | Ga0065715_100214533 | 349 |
| 105 | 3300009147 | Ga0114129_10287068 | Ga0114129_102870682 | 349 |
| 106 | iso_pu_bacteria | 2995463766 | 2995464311 | 349 |
| 107 | 3300006914 | Ga0075436_100024103 | Ga0075436_1000241034 | 350 |
| 108 | 3300028800 | Ga0265338_10059038 | Ga0265338_100590382 | 350 |
| 109 | 3300046683 | Ga0495658_0154650 | Ga0495658_0154650_35_1171 | 350 |
| 110 | 3300053139 | Ga0500568_0033379 | Ga0500568_0033379_856_1944 | 350 |
| 111 | 3300053146 | Ga0500588_0012122 | Ga0500588_0012122_499_1587 | 350 |
| 112 | 3300053156 | Ga0500622_0012004 | Ga0500622_0012004_2300_3388 | 350 |
| 113 | 3300005614 | Ga0068856_100000551 | Ga0068856_1000005519 | 351 |
| 114 | 3300014326 | Ga0157380_10053635 | Ga0157380_100536352 | 351 |
| 115 | 3300026078 | Ga0207702_10000964 | Ga0207702_1000096417 | 351 |
| 116 | 3300045051 | Ga0451576_0001309 | Ga0451576_0001309_4163_5263 | 351 |
| 117 | 3300005456 | Ga0070678_100082989 | Ga0070678_1000829892 | 352 |
| 118 | 3300005614 | Ga0068856_100000838 | Ga0068856_10000083823 | 352 |
| 119 | 3300013105 | Ga0157369_10030560 | Ga0157369_100305604 | 352 |
| 120 | 3300013296 | Ga0157374_10014479 | Ga0157374_100144796 | 352 |
| 121 | 3300013307 | Ga0157372_10086739 | Ga0157372_100867392 | 352 |
| 122 | 3300025945 | Ga0207679_10299785 | Ga0207679_102997852 | 352 |
| 123 | 3300025949 | Ga0207667_10118285 | Ga0207667_101182852 | 352 |
| 124 | 3300026078 | Ga0207702_10032946 | Ga0207702_100329462 | 352 |
| 125 | 3300026121 | Ga0207683_10112170 | Ga0207683_101121702 | 352 |
| 126 | 3300048915 | Ga0496112_0022457 | Ga0496112_0022457_2738_3805 | 352 |
| 127 | iso_pu_bacteria | 2954767861 | 2954770700 | 352 |
| 128 | 3300027907 | Ga0207428_10171487 | Ga0207428_101714872 | 353 |
| 129 | 3300050511 | nmdc:mga08y16_421961_c1 | nmdc:mga08y16_421961_c1_17_1150 | 353 |
| 130 | 3300045836 | Ga0466958_0032623 | Ga0466958_0032623_1712_2830 | 355 |
| 131 | 3300045976 | Ga0466967_0150808 | Ga0466967_0150808_1025_2143 | 355 |
| 132 | iso_pu_bacteria | 2883068021 | 2883072149 | 355 |
| 133 | 3300009092 | Ga0105250_10061748 | Ga0105250_100617481 | 356 |
| 134 | 3300009101 | Ga0105247_10000173 | Ga0105247_1000017324 | 356 |
| 135 | 3300009553 | Ga0105249_10025127 | Ga0105249_100251273 | 356 |
| 136 | 3300013306 | Ga0163162_10148371 | Ga0163162_101483712 | 356 |
| 137 | 3300014325 | Ga0163163_10030302 | Ga0163163_100303022 | 356 |
| 138 | 3300014968 | Ga0157379_10034747 | Ga0157379_100347475 | 356 |
| 139 | 3300048909 | Ga0496106_0169862 | Ga0496106_0169862_398_1528 | 356 |
| 140 | 3300048910 | Ga0496107_0275217 | Ga0496107_0275217_85_1215 | 356 |
| 141 | 3300048912 | Ga0496109_0413683 | Ga0496109_0413683_97_1227 | 356 |
| 142 | 3300048924 | Ga0496121_0001385 | Ga0496121_0001385_37765_38895 | 356 |
| 143 | 3300048928 | Ga0496125_0022813 | Ga0496125_0022813_3186_4316 | 356 |
| 144 | 3300005471 | Ga0070698_100010458 | Ga0070698_1000104582 | 357 |
| 145 | 3300005337 | Ga0070682_100029594 | Ga0070682_1000295942 | 358 |
| 146 | 3300005353 | Ga0070669_100053085 | Ga0070669_1000530851 | 358 |
| 147 | 3300005364 | Ga0070673_100071518 | Ga0070673_1000715182 | 358 |
| 148 | 3300005618 | Ga0068864_100058459 | Ga0068864_1000584592 | 358 |
| 149 | 3300005841 | Ga0068863_100120009 | Ga0068863_1001200092 | 358 |
| 150 | 3300009176 | Ga0105242_10181216 | Ga0105242_101812161 | 358 |
| 151 | 3300014326 | Ga0157380_10125597 | Ga0157380_101255972 | 358 |
| 152 | 3300025923 | Ga0207681_10113660 | Ga0207681_101136602 | 358 |
| 153 | 3300025934 | Ga0207686_10000978 | Ga0207686_100009785 | 358 |
| 154 | 3300025936 | Ga0207670_10026808 | Ga0207670_100268082 | 358 |
| 155 | 3300025960 | Ga0207651_10094457 | Ga0207651_100944571 | 358 |
| 156 | 3300025961 | Ga0207712_10045330 | Ga0207712_100453302 | 358 |
| 157 | 3300026023 | Ga0207677_10159525 | Ga0207677_101595252 | 358 |
| 158 | 3300026095 | Ga0207676_10035930 | Ga0207676_100359302 | 358 |
| 159 | 3300028800 | Ga0265338_10002891 | Ga0265338_1000289111 | 358 |
| 160 | iso_pu_bacteria | 2896085136 | 2896088692 | 358 |
| 161 | 3300009094 | Ga0111539_10363409 | Ga0111539_103634092 | 359 |
| 162 | 3300025940 | Ga0207691_10086712 | Ga0207691_100867122 | 359 |
| 163 | 3300041997 | Ga0439431_0005102 | Ga0439431_0005102_303_1433 | 359 |
| 164 | 3300049571 | Ga0501034_0193160 | Ga0501034_0193160_722_1852 | 359 |
| 165 | 3300026118 | Ga0207675_100191801 | Ga0207675_1001918012 | 360 |
| 166 | 3300005458 | Ga0070681_10001905 | Ga0070681_1000190510 | 361 |
| 167 | 3300005530 | Ga0070679_100030446 | Ga0070679_1000304462 | 361 |
| 168 | 3300025912 | Ga0207707_10005427 | Ga0207707_100054274 | 361 |
| 169 | 3300025921 | Ga0207652_10030835 | Ga0207652_100308352 | 361 |
| 170 | 3300028577 | Ga0265318_10000072 | Ga0265318_1000007249 | 363 |
| 171 | 3300009093 | Ga0105240_10014185 | Ga0105240_100141852 | 364 |
| 172 | 3300009101 | Ga0105247_10021775 | Ga0105247_100217753 | 365 |
| 173 | 3300013105 | Ga0157369_10019573 | Ga0157369_100195732 | 365 |
| 174 | 3300025900 | Ga0207710_10103306 | Ga0207710_101033061 | 365 |
| 175 | 3300025920 | Ga0207649_10039785 | Ga0207649_100397853 | 365 |
| 176 | 3300031090 | Ga0265760_10008234 | Ga0265760_100082342 | 365 |
| 177 | 3300005329 | Ga0070683_100043926 | Ga0070683_1000439263 | 366 |
| 178 | 3300005539 | Ga0068853_100039546 | Ga0068853_1000395463 | 366 |
| 179 | 3300005563 | Ga0068855_100000047 | Ga0068855_10000004725 | 366 |
| 180 | 3300005563 | Ga0068855_100280948 | Ga0068855_1002809481 | 366 |
| 181 | 3300005616 | Ga0068852_100003811 | Ga0068852_1000038116 | 366 |
| 182 | 3300009093 | Ga0105240_10000647 | Ga0105240_100006477 | 366 |
| 183 | 3300010375 | Ga0105239_10001683 | Ga0105239_100016837 | 366 |
| 184 | 3300010375 | Ga0105239_10014732 | Ga0105239_100147325 | 366 |
| 185 | 3300025913 | Ga0207695_10000003 | Ga0207695_10000003720 | 366 |
| 186 | 3300025924 | Ga0207694_10000011 | Ga0207694_10000011103 | 366 |
| 187 | 3300025949 | Ga0207667_10000050 | Ga0207667_10000050104 | 366 |
| 188 | 3300025949 | Ga0207667_10340299 | Ga0207667_103402992 | 366 |
| 189 | 3300026142 | Ga0207698_10003695 | Ga0207698_100036952 | 366 |
| 190 | 3300046529 | Ga0495652_0039472 | Ga0495652_0039472_2137_3276 | 367 |
| 191 | 3300046543 | Ga0495645_0194434 | Ga0495645_0194434_47_1186 | 367 |
| 192 | 3300005355 | Ga0070671_100002260 | Ga0070671_1000022601 | 368 |
| 193 | 3300005617 | Ga0068859_100000050 | Ga0068859_100000050100 | 368 |
| 194 | 3300005719 | Ga0068861_100080337 | Ga0068861_1000803372 | 368 |
| 195 | 3300005841 | Ga0068863_100018629 | Ga0068863_1000186291 | 368 |
| 196 | 3300005842 | Ga0068858_100008500 | Ga0068858_10000850010 | 368 |
| 197 | 3300006931 | Ga0097620_100000050 | Ga0097620_100000050100 | 368 |
| 198 | 3300025900 | Ga0207710_10000187 | Ga0207710_100001874 | 368 |
| 199 | 3300025931 | Ga0207644_10009174 | Ga0207644_100091743 | 368 |
| 200 | 3300025941 | Ga0207711_10043420 | Ga0207711_100434202 | 368 |
| 201 | 3300025986 | Ga0207658_10004435 | Ga0207658_100044353 | 368 |
| 202 | 3300026035 | Ga0207703_10002799 | Ga0207703_100027996 | 368 |
| 203 | 3300026088 | Ga0207641_10003004 | Ga0207641_100030046 | 368 |
| 204 | 3300031595 | Ga0265313_10031952 | Ga0265313_100319522 | 368 |
| 205 | 3300046543 | Ga0495645_0005405 | Ga0495645_0005405_2900_4039 | 368 |
| 206 | 3300047444 | Ga0495675_0006253 | Ga0495675_0006253_3494_4633 | 368 |
| 207 | 3300005458 | Ga0070681_10351520 | Ga0070681_103515202 | 369 |
| 208 | 3300009147 | Ga0114129_10111562 | Ga0114129_101115622 | 369 |
| 209 | 3300050507 | nmdc:mga05p37_38118_c1 | nmdc:mga05p37_38118_c1_2221_3405 | 369 |
| 210 | 3300005436 | Ga0070713_100224383 | Ga0070713_1002243832 | 370 |
| 211 | 3300005844 | Ga0068862_100005969 | Ga0068862_1000059692 | 370 |
| 212 | 3300009551 | Ga0105238_10169853 | Ga0105238_101698532 | 370 |
| 213 | 3300025913 | Ga0207695_10016976 | Ga0207695_100169764 | 370 |
| 214 | 3300028379 | Ga0268266_10007902 | Ga0268266_100079023 | 370 |
| 215 | 3300048922 | Ga0496119_0014877 | Ga0496119_0014877_2834_3958 | 370 |
| 216 | 3300048923 | Ga0496120_0014178 | Ga0496120_0014178_3427_4551 | 370 |
| 217 | 3300048928 | Ga0496125_0020908 | Ga0496125_0020908_3956_5080 | 370 |
| 218 | 3300031507 | Ga0307509_10000002 | Ga0307509_10000002489 | 371 |
| 219 | 3300005327 | Ga0070658_10076358 | Ga0070658_100763582 | 372 |
| 220 | 3300005548 | Ga0070665_100093902 | Ga0070665_1000939022 | 372 |
| 221 | 3300009551 | Ga0105238_10072004 | Ga0105238_100720042 | 372 |
| 222 | 3300013105 | Ga0157369_10076474 | Ga0157369_100764742 | 372 |
| 223 | 3300013307 | Ga0157372_10110407 | Ga0157372_101104072 | 372 |
| 224 | 3300028379 | Ga0268266_10069236 | Ga0268266_100692363 | 372 |
| 225 | 3300030521 | Ga0307511_10000112 | Ga0307511_1000011252 | 372 |
| 226 | 3300033180 | Ga0307510_10002115 | Ga0307510_100021159 | 372 |
| 227 | 3300053178 | Ga0500637_0001621 | Ga0500637_0001621_3148_4323 | 372 |
| 228 | 3300003320 | rootH2_10127356 | rootH2_101273564 | 373 |
| 229 | 3300005548 | Ga0070665_100150518 | Ga0070665_1001505182 | 373 |
| 230 | 3300005563 | Ga0068855_100218510 | Ga0068855_1002185102 | 373 |
| 231 | 3300005617 | Ga0068859_100054016 | Ga0068859_1000540162 | 373 |
| 232 | 3300005841 | Ga0068863_100017074 | Ga0068863_1000170742 | 373 |
| 233 | 3300005842 | Ga0068858_100008788 | Ga0068858_1000087884 | 373 |
| 234 | 3300005843 | Ga0068860_100001030 | Ga0068860_10000103011 | 373 |
| 235 | 3300006931 | Ga0097620_100054016 | Ga0097620_1000540162 | 373 |
| 236 | 3300009093 | Ga0105240_10095008 | Ga0105240_100950083 | 373 |
| 237 | 3300009101 | Ga0105247_10011040 | Ga0105247_100110403 | 373 |
| 238 | 3300009177 | Ga0105248_10080629 | Ga0105248_100806292 | 373 |
| 239 | 3300009551 | Ga0105238_10253628 | Ga0105238_102536282 | 373 |
| 240 | 3300009553 | Ga0105249_10168550 | Ga0105249_101685502 | 373 |
| 241 | 3300025900 | Ga0207710_10007504 | Ga0207710_100075043 | 373 |
| 242 | 3300025913 | Ga0207695_10250459 | Ga0207695_102504592 | 373 |
| 243 | 3300025924 | Ga0207694_10082604 | Ga0207694_100826042 | 373 |
| 244 | 3300025924 | Ga0207694_10275092 | Ga0207694_102750921 | 373 |
| 245 | 3300025941 | Ga0207711_10234192 | Ga0207711_102341921 | 373 |
| 246 | 3300026035 | Ga0207703_10000380 | Ga0207703_1000038037 | 373 |
| 247 | 3300026067 | Ga0207678_10046000 | Ga0207678_100460002 | 373 |
| 248 | 3300026088 | Ga0207641_10002173 | Ga0207641_1000217310 | 373 |
| 249 | 3300026088 | Ga0207641_10110464 | Ga0207641_101104641 | 373 |
| 250 | 3300028381 | Ga0268264_10000145 | Ga0268264_1000014527 | 373 |
| 251 | 3300033180 | Ga0307510_10000007 | Ga0307510_1000000723 | 373 |
| 252 | 3300048922 | Ga0496119_0000655 | Ga0496119_0000655_18816_19949 | 373 |
| 253 | 3300048923 | Ga0496120_0000381 | Ga0496120_0000381_68450_69583 | 373 |
| 254 | 3300048928 | Ga0496125_0000606 | Ga0496125_0000606_26921_28066 | 373 |
| 255 | 3300048929 | Ga0496126_0198504 | Ga0496126_0198504_90_1235 | 373 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.9456 | 22 | 372 |
| 1so0-assembly4.cif.gz_D | crystal structure of human galactose mutarotase complexed with galactose | 0.9402 | 22 | 372 |
| 4rnl-assembly1.cif.gz_A | the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus | 0.9388 | 21 | 371 |
| 3imh-assembly1.cif.gz_A | crystal structure of galactose 1-epimerase from lactobacillus acidophilus ncfm | 0.9303 | 22 | 373 |
| 4rnl-assembly1.cif.gz_A | the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus | 0.928 | 21 | 371 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q66HG4_1_342_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9503 | 22 | 372 | 2.70.98.10 |
| af_Q66HG4_1_342_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9449 | 22 | 372 | 2.70.98.10 |
| af_Q33AZ5_28_362_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9401 | 39 | 371 | 2.70.98.10 |
| 4rnlC00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9381 | 20 | 371 | 2.70.98.10 |
| af_P0A9C3_9_344_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9337 | 39 | 370 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354HW97-F1-model_v4 | Galactose-1-epimerase | 0.9868 | 212 | 317 |
GO:0004034
GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A3D0M1M4-F1-model_v4 | Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase) (Type-1 mutarotase) | 0.9799 | 23 | 307 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A6B3IPK7-F1-model_v4 | Galactose-1-epimerase | 0.979 | 54 | 208 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
| AF-A0A4U9KM16-F1-model_v4 | deleted | 0.9744 | 60 | 282 |
|
| AF-A0A0P0L4Z5-F1-model_v4 | Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase) (Type-1 mutarotase) | 0.973 | 72 | 373 |
GO:0004034
GO:0005737 GO:0006006 GO:0030246 GO:0033499 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar