F365673

General Info

Members Datasets Scaffolds Average Seq Length
255 183 247 365

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10072004|Ga0105238_100720042
Length 393
Sequence MQQHNLPATRTPRLPMSGVWTAMGLLAAVATTSLAASPAPKPSVAHAPFGRAGNEAVELYTLTNAHGVEVQVMTYGATLVSIKTPDRTGQLANIILGFDTLQPYLAGVPYFGATVGRYANRIANARFTLDGKQYELSRNDGPNSLHGGSRGFDKRIWQVEPSPGKSAATLRMKYVSAAGEEGYPGELTAHVSYRLSDDDRLVIEYSATTTAATPVNLANHAYFNLTGDPHQTILGHVLTIDASRFTPVNSTLIPLGELRPVAGTPFDFRTPMAIGSRIAADDEQLRLGHGYDHNWVLEPAAGHEARLAAVLTDPTSGRSLEIRTTQPGLQFYSGNFLDGKPAGHGTVFPYRTGLCLETQHFPDSPNQPAFPDTILRPGQRYSATTVLRFSVQK

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
4 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
5 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
6 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
119 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
120 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
121 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
155 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
179 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
180 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
181 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0.78
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.96
Nodule 0
Rhizoplane 3.14
Rhizosphere 84.31
Stem 0
Stem Tuber 0
Unclassified 10.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10127356 3300003320 Unclassified 3197
2 rootL2_10070531 3300003322 Bacteria 7438
3 Ga0065715_10021453 3300005293 Unclassified 2465
4 Ga0070658_10076358 3300005327 Bacteria 2748
5 Ga0070683_100043926 3300005329 Bacteria 4120
6 Ga0070682_100029594 3300005337 Bacteria 3298
7 Ga0070660_100013161 3300005339 Bacteria 5929
8 Ga0070660_100063787 3300005339 Bacteria 2864
9 Ga0070668_100002288 3300005347 Bacteria 14127
10 Ga0070669_100053085 3300005353 Bacteria 2966
11 Ga0070671_100002260 3300005355 Bacteria 14870
12 Ga0070673_100071518 3300005364 Bacteria 2788
13 Ga0070659_100063112 3300005366 Bacteria 2930
14 Ga0070713_100224383 3300005436 Bacteria 1706
15 Ga0070678_100082989 3300005456 Bacteria 2435
16 Ga0070681_10001905 3300005458 Bacteria 18821
17 Ga0070681_10351520 3300005458 Unclassified 1384
18 Ga0070698_100010458 3300005471 Bacteria 9906
19 Ga0070679_100030446 3300005530 Bacteria 5328
20 Ga0068853_100039546 3300005539 Bacteria 4023
21 Ga0070672_100151706 3300005543 Bacteria 1917
22 Ga0070665_100093902 3300005548 Bacteria 3005
23 Ga0070665_100150518 3300005548 Bacteria 2330
24 Ga0068855_100000047 3300005563 Bacteria 145355
25 Ga0068855_100065376 3300005563 Bacteria 4240
26 Ga0068855_100218510 3300005563 Bacteria 2138
27 Ga0068855_100280948 3300005563 Bacteria 1849
28 Ga0070664_100304058 3300005564 Bacteria 1442
29 Ga0068856_100000551 3300005614 Bacteria 41390
30 Ga0068856_100000838 3300005614 Bacteria 33188
31 Ga0068852_100003811 3300005616 Bacteria 10583
32 Ga0068852_100264228 3300005616 Bacteria 1653
33 Ga0068859_100000050 3300005617 Bacteria 131351
34 Ga0068859_100054016 3300005617 Bacteria 4040
35 Ga0068864_100058459 3300005618 Bacteria 3333
36 Ga0068861_100080337 3300005719 Bacteria 2551
37 Ga0068863_100017074 3300005841 Bacteria 6960
38 Ga0068863_100018629 3300005841 Bacteria 6642
39 Ga0068863_100120009 3300005841 Bacteria 2506
40 Ga0068858_100008500 3300005842 Bacteria 9865
41 Ga0068858_100008788 3300005842 Bacteria 9688
42 Ga0068860_100001030 3300005843 Bacteria 30734
43 Ga0068862_100005969 3300005844 Bacteria 10140
44 Ga0075436_100024103 3300006914 Bacteria 4183
45 Ga0097620_100000050 3300006931 Bacteria 131351
46 Ga0097620_100054016 3300006931 Bacteria 4040
47 Ga0105250_10061748 3300009092 Bacteria 1507
48 Ga0105240_10000647 3300009093 Bacteria 64299
49 Ga0105240_10014185 3300009093 Bacteria 10883
50 Ga0105240_10095008 3300009093 Bacteria 3636
51 Ga0111539_10363409 3300009094 Bacteria 1685
52 Ga0105247_10000173 3300009101 Bacteria 63815
53 Ga0105247_10011040 3300009101 Bacteria 5450
54 Ga0105247_10021775 3300009101 Bacteria 3856
55 Ga0114129_10111562 3300009147 Bacteria 3773
56 Ga0114129_10287068 3300009147 Bacteria 2197
57 Ga0105243_10011176 3300009148 Bacteria 6791
58 Ga0105242_10007911 3300009176 Bacteria 8183
59 Ga0105242_10181216 3300009176 Bacteria 1858
60 Ga0105248_10080629 3300009177 Bacteria 3658
61 Ga0105238_10072004 3300009551 Bacteria 3453
62 Ga0105238_10169853 3300009551 Bacteria 2157
63 Ga0105238_10253628 3300009551 Bacteria 1738
64 Ga0105249_10025127 3300009553 Bacteria 5361
65 Ga0105249_10168550 3300009553 Bacteria 2122
66 Ga0105239_10001683 3300010375 Bacteria 29162
67 Ga0105239_10014732 3300010375 Bacteria 8672
68 Ga0105239_10581784 3300010375 Bacteria 1276
69 Ga0157369_10019573 3300013105 Bacteria 7575
70 Ga0157369_10030560 3300013105 Bacteria 5941
71 Ga0157369_10076474 3300013105 Bacteria 3588
72 Ga0157369_10442085 3300013105 Unclassified 1347
73 Ga0157374_10014479 3300013296 Bacteria 6902
74 Ga0163162_10148371 3300013306 Bacteria 2462
75 Ga0163162_10157089 3300013306 Bacteria 2395
76 Ga0157372_10086739 3300013307 Bacteria 3551
77 Ga0157372_10106838 3300013307 Bacteria 3202
78 Ga0157372_10110407 3300013307 Bacteria 3150
79 Ga0163163_10030302 3300014325 Bacteria 5212
80 Ga0157380_10053635 3300014326 Unclassified 3197
81 Ga0157380_10125597 3300014326 Bacteria 2180
82 Ga0157379_10034747 3300014968 Bacteria 4496
83 Ga0157376_10018876 3300014969 Bacteria 5301
84 Ga0207655_1038180 3300025728 Bacteria 2103
85 Ga0207710_10000187 3300025900 Bacteria 60181
86 Ga0207710_10007504 3300025900 Bacteria 4618
87 Ga0207710_10103306 3300025900 Bacteria 1346
88 Ga0207654_10032118 3300025911 Bacteria 2897
89 Ga0207707_10005427 3300025912 Bacteria 11146
90 Ga0207695_10000003 3300025913 Bacteria 1368691
91 Ga0207695_10016976 3300025913 Bacteria 8493
92 Ga0207695_10250459 3300025913 Bacteria 1671
93 Ga0207657_10065850 3300025919 Bacteria 3087
94 Ga0207657_10109849 3300025919 Bacteria 2278
95 Ga0207649_10039785 3300025920 Bacteria 2853
96 Ga0207652_10030835 3300025921 Bacteria 4495
97 Ga0207681_10113660 3300025923 Bacteria 1974
98 Ga0207694_10000011 3300025924 Bacteria 417640
99 Ga0207694_10082604 3300025924 Bacteria 2525
100 Ga0207694_10275092 3300025924 Bacteria 1382
101 Ga0207659_10122607 3300025926 Bacteria 1994
102 Ga0207644_10009174 3300025931 Bacteria 6487
103 Ga0207690_10158942 3300025932 Bacteria 1683
104 Ga0207706_10065258 3300025933 Bacteria 3206
105 Ga0207686_10000978 3300025934 Bacteria 17007
106 Ga0207670_10026808 3300025936 Bacteria 3636
107 Ga0207691_10086712 3300025940 Bacteria 2809
108 Ga0207711_10043420 3300025941 Bacteria 3834
109 Ga0207711_10234192 3300025941 Bacteria 1682
110 Ga0207679_10299785 3300025945 Bacteria 1385
111 Ga0207667_10000050 3300025949 Bacteria 234390
112 Ga0207667_10118285 3300025949 Bacteria 2731
113 Ga0207667_10340299 3300025949 Bacteria 1531
114 Ga0207651_10094457 3300025960 Bacteria 2199
115 Ga0207712_10045330 3300025961 Bacteria 3044
116 Ga0207658_10004435 3300025986 Bacteria 9760
117 Ga0207677_10159525 3300026023 Bacteria 1751
118 Ga0207703_10000380 3300026035 Bacteria 47455
119 Ga0207703_10002799 3300026035 Bacteria 14896
120 Ga0207639_10266319 3300026041 Bacteria 1501
121 Ga0207678_10046000 3300026067 Bacteria 3774
122 Ga0207702_10000964 3300026078 Bacteria 29579
123 Ga0207702_10032946 3300026078 Bacteria 4325
124 Ga0207641_10002173 3300026088 Bacteria 18468
125 Ga0207641_10003004 3300026088 Bacteria 15238
126 Ga0207641_10110464 3300026088 Bacteria 2436
127 Ga0207676_10035930 3300026095 Bacteria 3766
128 Ga0207675_100191801 3300026118 Bacteria 1960
129 Ga0207683_10112170 3300026121 Bacteria 2442
130 Ga0207698_10003695 3300026142 Bacteria 9255
131 Ga0207428_10171487 3300027907 Bacteria 1643
132 Ga0268266_10007902 3300028379 Bacteria 9522
133 Ga0268266_10069236 3300028379 Bacteria 3057
134 Ga0268264_10000145 3300028381 Bacteria 167262
135 Ga0265334_10011122 3300028573 Bacteria 3792
136 Ga0265318_10000047 3300028577 Bacteria 123944
137 Ga0265318_10000072 3300028577 Bacteria 96797
138 Ga0307515_10168245 3300028794 Bacteria 2199
139 Ga0265338_10002891 3300028800 Bacteria 25029
140 Ga0265338_10059038 3300028800 Bacteria 3382
141 Ga0307511_10000112 3300030521 Bacteria 73319
142 Ga0265760_10008234 3300031090 Bacteria 2980
143 Ga0265320_10007681 3300031240 Bacteria 6668
144 Ga0265327_10000369 3300031251 Bacteria 85139
145 Ga0307509_10000002 3300031507 Bacteria 607551
146 Ga0265313_10031952 3300031595 Bacteria 2694
147 Ga0265313_10034372 3300031595 Bacteria 2564
148 Ga0265314_10000872 3300031711 Bacteria 35886
149 Ga0307406_10284827 3300031901 Bacteria 1262
150 Ga0307412_10015457 3300031911 Bacteria 4528
151 Ga0307411_10142931 3300032005 Unclassified 1767
152 Ga0307510_10000007 3300033180 Bacteria 558582
153 Ga0307510_10002115 3300033180 Bacteria 22465
154 Ga0395899_0009673 3300037312 Bacteria 7400
155 Ga0395899_0111678 3300037312 Bacteria 1964
156 Ga0395900_0028326 3300037418 Bacteria 5736
157 Ga0395900_0119214 3300037418 Bacteria 2708
158 Ga0395898_0040251 3300037466 Bacteria 4622
159 Ga0395905_0169278 3300037471 Bacteria 2052
160 Ga0395905_0228677 3300037471 Bacteria 1739
161 Ga0395901_0005719 3300038443 Bacteria 12589
162 Ga0436365_0661594 3300039437 Bacteria 1327
163 Ga0439431_0005102 3300041997 Bacteria 2895
164 Ga0439448_0001293 3300042005 Bacteria 6400
165 Ga0439450_010534 3300042008 Bacteria 1786
166 Ga0439455_0002515 3300042012 Bacteria 3347
167 Ga0450904_000258 3300042139 Bacteria 11411
168 Ga0450893_0012793 3300042532 Bacteria 1395
169 Ga0466972_0009564 3300044658 Bacteria 4866
170 Ga0466965_0007237 3300044683 Bacteria 5086
171 Ga0466965_0015756 3300044683 Bacteria 3592
172 Ga0466966_0006384 3300044684 Bacteria 7795
173 Ga0466966_0097487 3300044684 Bacteria 1821
174 Ga0466964_0001348 3300044706 Bacteria 8384
175 Ga0466964_0025245 3300044706 Bacteria 2319
176 Ga0466968_0004950 3300044735 Bacteria 4989
177 Ga0466957_0000104 3300044842 Bacteria 34466
178 Ga0466957_0049729 3300044842 Bacteria 2549
179 Ga0466959_0104131 3300045049 Bacteria 2030
180 Ga0451576_0001309 3300045051 Bacteria 43108
181 Ga0466958_0032623 3300045836 Bacteria 3099
182 Ga0466967_0150808 3300045976 Bacteria 2172
183 Ga0495638_0000305 3300046460 Bacteria 63286
184 Ga0495605_0000065 3300046474 Bacteria 139441
185 Ga0495607_0060402 3300046501 Bacteria 2157
186 Ga0495583_0000008 3300046506 Bacteria 411092
187 Ga0495583_0000710 3300046506 Bacteria 42765
188 Ga0495632_0002377 3300046519 Bacteria 14391
189 Ga0495643_0018663 3300046522 Bacteria 4024
190 Ga0495648_0000235 3300046524 Bacteria 63436
191 Ga0495648_0027847 3300046524 Bacteria 3775
192 Ga0495642_0023947 3300046528 Bacteria 2413
193 Ga0495652_0039472 3300046529 Bacteria 4082
194 Ga0495645_0005405 3300046543 Bacteria 8761
195 Ga0495645_0194434 3300046543 Bacteria 1380
196 Ga0495661_0000715 3300046665 Bacteria 32660
197 Ga0495658_0154650 3300046683 Bacteria 1411
198 Ga0495671_0000020 3300046692 Bacteria 268306
199 Ga0495649_0082992 3300046694 Bacteria 1712
200 Ga0495649_0145397 3300046694 Bacteria 1247
201 Ga0495589_0000100 3300046794 Bacteria 83307
202 Ga0495660_0000027 3300046810 Bacteria 254331
203 Ga0495660_0036568 3300046810 Bacteria 2738
204 Ga0495636_0038669 3300047318 Bacteria 1975
205 Ga0495672_0002802 3300047320 Bacteria 15553
206 Ga0495683_0034750 3300047323 Bacteria 2563
207 Ga0495687_017468 3300047443 Bacteria 3578
208 Ga0495687_029140 3300047443 Bacteria 2559
209 Ga0495675_0006253 3300047444 Bacteria 7285
210 Ga0495677_0014893 3300047445 Bacteria 2828
211 Ga0495677_0033631 3300047445 Bacteria 1868
212 Ga0495673_0000316 3300047469 Bacteria 62814
213 Ga0495626_0000222 3300048091 Bacteria 67304
214 Ga0496102_0036549 3300048905 Bacteria 4425
215 Ga0496104_0444931 3300048907 Bacteria 1208
216 Ga0496105_0119960 3300048908 Bacteria 2169
217 Ga0496106_0169862 3300048909 Bacteria 1728
218 Ga0496107_0275217 3300048910 Bacteria 1253
219 Ga0496109_0354080 3300048912 Bacteria 1387
220 Ga0496109_0413683 3300048912 Bacteria 1274
221 Ga0496112_0022457 3300048915 Bacteria 6014
222 Ga0496117_0000044 3300048920 Bacteria 301076
223 Ga0496118_0000019 3300048921 Bacteria 489649
224 Ga0496119_0000655 3300048922 Bacteria 46562
225 Ga0496119_0014877 3300048922 Bacteria 6049
226 Ga0496120_0000381 3300048923 Bacteria 71695
227 Ga0496120_0014178 3300048923 Bacteria 5321
228 Ga0496121_0001385 3300048924 Bacteria 41022
229 Ga0496122_0020696 3300048925 Bacteria 5926
230 Ga0496123_0003516 3300048926 Bacteria 17450
231 Ga0496124_0038009 3300048927 Bacteria 4181
232 Ga0496125_0000606 3300048928 Bacteria 60912
233 Ga0496125_0020908 3300048928 Bacteria 6123
234 Ga0496125_0022813 3300048928 Bacteria 5801
235 Ga0496126_0021106 3300048929 Bacteria 6368
236 Ga0496126_0198504 3300048929 Bacteria 1695
237 Ga0501034_0193160 3300049571 Bacteria 1997
238 nmdc:mga05p37_38118_c1 3300050507 Bacteria 5895
239 nmdc:mga08y16_382997_c1 3300050511 Bacteria 1441
240 nmdc:mga08y16_421961_c1 3300050511 Bacteria 1363
241 Ga0500583_0140316 3300053092 Bacteria 1201
242 Ga0500568_0033379 3300053139 Bacteria 2112
243 Ga0500588_0012122 3300053146 Bacteria 2129
244 Ga0500622_0012004 3300053156 Bacteria 4711
245 Ga0500637_0001621 3300053178 Bacteria 9643
246 Ga0587105_001997 3300059651 Bacteria 1124
247 Ga0466962_0076981 3300061719 Bacteria 1594

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0145397 Ga0495649_0145397_293_1237 314
2 3300047318 Ga0495636_0038669 Ga0495636_0038669_990_1955 317
3 3300013307 Ga0157372_10106838 Ga0157372_101068382 325
4 3300037471 Ga0395905_0169278 Ga0395905_0169278_409_1470 331
5 3300046694 Ga0495649_0082992 Ga0495649_0082992_670_1674 332
6 3300031251 Ga0265327_10000369 Ga0265327_1000036959 335
7 3300005347 Ga0070668_100002288 Ga0070668_1000022882 336
8 3300005543 Ga0070672_100151706 Ga0070672_1001517062 336
9 3300025926 Ga0207659_10122607 Ga0207659_101226072 336
10 3300026041 Ga0207639_10266319 Ga0207639_102663191 336
11 3300047443 Ga0495687_029140 Ga0495687_029140_27_1043 336
12 3300053092 Ga0500583_0140316 Ga0500583_0140316_26_1036 336
13 3300039437 Ga0436365_0661594 Ga0436365_0661594_83_1096 337
14 3300044684 Ga0466966_0006384 Ga0466966_0006384_6149_7171 337
15 3300044706 Ga0466964_0001348 Ga0466964_0001348_2769_3791 337
16 3300048926 Ga0496123_0003516 Ga0496123_0003516_4954_5976 337
17 3300061719 Ga0466962_0076981 Ga0466962_0076981_231_1253 337
18 3300013105 Ga0157369_10442085 Ga0157369_104420852 338
19 3300046506 Ga0495583_0000008 Ga0495583_0000008_214874_215926 341
20 3300046506 Ga0495583_0000008 Ga0495583_0000008_238343_239398 341
21 3300031901 Ga0307406_10284827 Ga0307406_102848271 342
22 3300032005 Ga0307411_10142931 Ga0307411_101429312 342
23 3300042139 Ga0450904_000258 Ga0450904_000258_2999_4060 343
24 3300009148 Ga0105243_10011176 Ga0105243_100111765 344
25 3300025728 Ga0207655_1038180 Ga0207655_10381802 344
26 3300046460 Ga0495638_0000305 Ga0495638_0000305_51178_52230 344
27 3300046506 Ga0495583_0000710 Ga0495583_0000710_27838_28890 344
28 3300046519 Ga0495632_0002377 Ga0495632_0002377_4536_5588 344
29 3300046524 Ga0495648_0000235 Ga0495648_0000235_11240_12292 344
30 3300046528 Ga0495642_0023947 Ga0495642_0023947_1306_2361 344
31 3300046692 Ga0495671_0000020 Ga0495671_0000020_256107_257159 344
32 3300047445 Ga0495677_0014893 Ga0495677_0014893_385_1440 344
33 3300047469 Ga0495673_0000316 Ga0495673_0000316_11148_12200 344
34 3300048907 Ga0496104_0444931 Ga0496104_0444931_107_1162 344
35 3300048908 Ga0496105_0119960 Ga0496105_0119960_677_1732 344
36 3300050511 nmdc:mga08y16_382997_c1 nmdc:mga08y16_382997_c1_29_1153 344
37 3300003322 rootL2_10070531 rootL2_100705316 345
38 3300005339 Ga0070660_100013161 Ga0070660_1000131613 345
39 3300005339 Ga0070660_100063787 Ga0070660_1000637873 345
40 3300005366 Ga0070659_100063112 Ga0070659_1000631123 345
41 3300005563 Ga0068855_100065376 Ga0068855_1000653763 345
42 3300005564 Ga0070664_100304058 Ga0070664_1003040582 345
43 3300005616 Ga0068852_100264228 Ga0068852_1002642282 345
44 3300010375 Ga0105239_10581784 Ga0105239_105817842 345
45 3300025911 Ga0207654_10032118 Ga0207654_100321183 345
46 3300025919 Ga0207657_10065850 Ga0207657_100658503 345
47 3300025919 Ga0207657_10109849 Ga0207657_101098492 345
48 3300025932 Ga0207690_10158942 Ga0207690_101589422 345
49 3300025933 Ga0207706_10065258 Ga0207706_100652582 345
50 3300037312 Ga0395899_0009673 Ga0395899_0009673_1235_2293 345
51 3300037312 Ga0395899_0111678 Ga0395899_0111678_55_1113 345
52 3300037418 Ga0395900_0028326 Ga0395900_0028326_1385_2443 345
53 3300037418 Ga0395900_0119214 Ga0395900_0119214_1596_2654 345
54 3300037466 Ga0395898_0040251 Ga0395898_0040251_2330_3388 345
55 3300037471 Ga0395905_0228677 Ga0395905_0228677_584_1642 345
56 3300038443 Ga0395901_0005719 Ga0395901_0005719_1235_2293 345
57 3300042005 Ga0439448_0001293 Ga0439448_0001293_2578_3636 345
58 3300042008 Ga0439450_010534 Ga0439450_010534_387_1445 345
59 3300042012 Ga0439455_0002515 Ga0439455_0002515_402_1460 345
60 3300042532 Ga0450893_0012793 Ga0450893_0012793_147_1205 345
61 3300044658 Ga0466972_0009564 Ga0466972_0009564_2616_3674 345
62 3300044683 Ga0466965_0007237 Ga0466965_0007237_2090_3148 345
63 3300044683 Ga0466965_0015756 Ga0466965_0015756_182_1240 345
64 3300044684 Ga0466966_0097487 Ga0466966_0097487_386_1444 345
65 3300044706 Ga0466964_0025245 Ga0466964_0025245_1251_2309 345
66 3300044735 Ga0466968_0004950 Ga0466968_0004950_1896_2954 345
67 3300044842 Ga0466957_0000104 Ga0466957_0000104_1318_2376 345
68 3300044842 Ga0466957_0049729 Ga0466957_0049729_98_1156 345
69 3300045049 Ga0466959_0104131 Ga0466959_0104131_881_1939 345
70 3300046474 Ga0495605_0000065 Ga0495605_0000065_32706_33764 345
71 3300046501 Ga0495607_0060402 Ga0495607_0060402_1033_2091 345
72 3300046522 Ga0495643_0018663 Ga0495643_0018663_1934_2992 345
73 3300046524 Ga0495648_0027847 Ga0495648_0027847_1171_2229 345
74 3300046665 Ga0495661_0000715 Ga0495661_0000715_25809_26867 345
75 3300046794 Ga0495589_0000100 Ga0495589_0000100_59026_60084 345
76 3300046810 Ga0495660_0000027 Ga0495660_0000027_186934_187992 345
77 3300046810 Ga0495660_0036568 Ga0495660_0036568_660_1718 345
78 3300047320 Ga0495672_0002802 Ga0495672_0002802_13051_14109 345
79 3300047323 Ga0495683_0034750 Ga0495683_0034750_1329_2387 345
80 3300047443 Ga0495687_017468 Ga0495687_017468_2257_3315 345
81 3300047445 Ga0495677_0033631 Ga0495677_0033631_362_1420 345
82 3300048091 Ga0495626_0000222 Ga0495626_0000222_31611_32669 345
83 3300048905 Ga0496102_0036549 Ga0496102_0036549_537_1661 345
84 3300048912 Ga0496109_0354080 Ga0496109_0354080_51_1109 345
85 3300048920 Ga0496117_0000044 Ga0496117_0000044_223703_224827 345
86 3300048921 Ga0496118_0000019 Ga0496118_0000019_21157_22281 345
87 3300048925 Ga0496122_0020696 Ga0496122_0020696_2627_3685 345
88 3300048927 Ga0496124_0038009 Ga0496124_0038009_538_1662 345
89 3300048929 Ga0496126_0021106 Ga0496126_0021106_1248_2372 345
90 3300059651 Ga0587105_001997 Ga0587105_001997_44_1099 345
91 iso_pu_bacteria 2643221556 2643801499 345
92 iso_pu_bacteria 2643221684 2644471439 345
93 iso_pu_bacteria 8047673197 8047677197 345
94 3300009176 Ga0105242_10007911 Ga0105242_100079113 346
95 3300013306 Ga0163162_10157089 Ga0163162_101570892 346
96 3300014969 Ga0157376_10018876 Ga0157376_100188762 346
97 3300031911 Ga0307412_10015457 Ga0307412_100154573 346
98 3300028573 Ga0265334_10011122 Ga0265334_100111222 347
99 3300028577 Ga0265318_10000047 Ga0265318_10000047104 347
100 3300031240 Ga0265320_10007681 Ga0265320_100076812 347
101 3300031595 Ga0265313_10034372 Ga0265313_100343721 347
102 3300031711 Ga0265314_10000872 Ga0265314_1000087222 347
103 3300028794 Ga0307515_10168245 Ga0307515_101682452 348
104 3300005293 Ga0065715_10021453 Ga0065715_100214533 349
105 3300009147 Ga0114129_10287068 Ga0114129_102870682 349
106 iso_pu_bacteria 2995463766 2995464311 349
107 3300006914 Ga0075436_100024103 Ga0075436_1000241034 350
108 3300028800 Ga0265338_10059038 Ga0265338_100590382 350
109 3300046683 Ga0495658_0154650 Ga0495658_0154650_35_1171 350
110 3300053139 Ga0500568_0033379 Ga0500568_0033379_856_1944 350
111 3300053146 Ga0500588_0012122 Ga0500588_0012122_499_1587 350
112 3300053156 Ga0500622_0012004 Ga0500622_0012004_2300_3388 350
113 3300005614 Ga0068856_100000551 Ga0068856_1000005519 351
114 3300014326 Ga0157380_10053635 Ga0157380_100536352 351
115 3300026078 Ga0207702_10000964 Ga0207702_1000096417 351
116 3300045051 Ga0451576_0001309 Ga0451576_0001309_4163_5263 351
117 3300005456 Ga0070678_100082989 Ga0070678_1000829892 352
118 3300005614 Ga0068856_100000838 Ga0068856_10000083823 352
119 3300013105 Ga0157369_10030560 Ga0157369_100305604 352
120 3300013296 Ga0157374_10014479 Ga0157374_100144796 352
121 3300013307 Ga0157372_10086739 Ga0157372_100867392 352
122 3300025945 Ga0207679_10299785 Ga0207679_102997852 352
123 3300025949 Ga0207667_10118285 Ga0207667_101182852 352
124 3300026078 Ga0207702_10032946 Ga0207702_100329462 352
125 3300026121 Ga0207683_10112170 Ga0207683_101121702 352
126 3300048915 Ga0496112_0022457 Ga0496112_0022457_2738_3805 352
127 iso_pu_bacteria 2954767861 2954770700 352
128 3300027907 Ga0207428_10171487 Ga0207428_101714872 353
129 3300050511 nmdc:mga08y16_421961_c1 nmdc:mga08y16_421961_c1_17_1150 353
130 3300045836 Ga0466958_0032623 Ga0466958_0032623_1712_2830 355
131 3300045976 Ga0466967_0150808 Ga0466967_0150808_1025_2143 355
132 iso_pu_bacteria 2883068021 2883072149 355
133 3300009092 Ga0105250_10061748 Ga0105250_100617481 356
134 3300009101 Ga0105247_10000173 Ga0105247_1000017324 356
135 3300009553 Ga0105249_10025127 Ga0105249_100251273 356
136 3300013306 Ga0163162_10148371 Ga0163162_101483712 356
137 3300014325 Ga0163163_10030302 Ga0163163_100303022 356
138 3300014968 Ga0157379_10034747 Ga0157379_100347475 356
139 3300048909 Ga0496106_0169862 Ga0496106_0169862_398_1528 356
140 3300048910 Ga0496107_0275217 Ga0496107_0275217_85_1215 356
141 3300048912 Ga0496109_0413683 Ga0496109_0413683_97_1227 356
142 3300048924 Ga0496121_0001385 Ga0496121_0001385_37765_38895 356
143 3300048928 Ga0496125_0022813 Ga0496125_0022813_3186_4316 356
144 3300005471 Ga0070698_100010458 Ga0070698_1000104582 357
145 3300005337 Ga0070682_100029594 Ga0070682_1000295942 358
146 3300005353 Ga0070669_100053085 Ga0070669_1000530851 358
147 3300005364 Ga0070673_100071518 Ga0070673_1000715182 358
148 3300005618 Ga0068864_100058459 Ga0068864_1000584592 358
149 3300005841 Ga0068863_100120009 Ga0068863_1001200092 358
150 3300009176 Ga0105242_10181216 Ga0105242_101812161 358
151 3300014326 Ga0157380_10125597 Ga0157380_101255972 358
152 3300025923 Ga0207681_10113660 Ga0207681_101136602 358
153 3300025934 Ga0207686_10000978 Ga0207686_100009785 358
154 3300025936 Ga0207670_10026808 Ga0207670_100268082 358
155 3300025960 Ga0207651_10094457 Ga0207651_100944571 358
156 3300025961 Ga0207712_10045330 Ga0207712_100453302 358
157 3300026023 Ga0207677_10159525 Ga0207677_101595252 358
158 3300026095 Ga0207676_10035930 Ga0207676_100359302 358
159 3300028800 Ga0265338_10002891 Ga0265338_1000289111 358
160 iso_pu_bacteria 2896085136 2896088692 358
161 3300009094 Ga0111539_10363409 Ga0111539_103634092 359
162 3300025940 Ga0207691_10086712 Ga0207691_100867122 359
163 3300041997 Ga0439431_0005102 Ga0439431_0005102_303_1433 359
164 3300049571 Ga0501034_0193160 Ga0501034_0193160_722_1852 359
165 3300026118 Ga0207675_100191801 Ga0207675_1001918012 360
166 3300005458 Ga0070681_10001905 Ga0070681_1000190510 361
167 3300005530 Ga0070679_100030446 Ga0070679_1000304462 361
168 3300025912 Ga0207707_10005427 Ga0207707_100054274 361
169 3300025921 Ga0207652_10030835 Ga0207652_100308352 361
170 3300028577 Ga0265318_10000072 Ga0265318_1000007249 363
171 3300009093 Ga0105240_10014185 Ga0105240_100141852 364
172 3300009101 Ga0105247_10021775 Ga0105247_100217753 365
173 3300013105 Ga0157369_10019573 Ga0157369_100195732 365
174 3300025900 Ga0207710_10103306 Ga0207710_101033061 365
175 3300025920 Ga0207649_10039785 Ga0207649_100397853 365
176 3300031090 Ga0265760_10008234 Ga0265760_100082342 365
177 3300005329 Ga0070683_100043926 Ga0070683_1000439263 366
178 3300005539 Ga0068853_100039546 Ga0068853_1000395463 366
179 3300005563 Ga0068855_100000047 Ga0068855_10000004725 366
180 3300005563 Ga0068855_100280948 Ga0068855_1002809481 366
181 3300005616 Ga0068852_100003811 Ga0068852_1000038116 366
182 3300009093 Ga0105240_10000647 Ga0105240_100006477 366
183 3300010375 Ga0105239_10001683 Ga0105239_100016837 366
184 3300010375 Ga0105239_10014732 Ga0105239_100147325 366
185 3300025913 Ga0207695_10000003 Ga0207695_10000003720 366
186 3300025924 Ga0207694_10000011 Ga0207694_10000011103 366
187 3300025949 Ga0207667_10000050 Ga0207667_10000050104 366
188 3300025949 Ga0207667_10340299 Ga0207667_103402992 366
189 3300026142 Ga0207698_10003695 Ga0207698_100036952 366
190 3300046529 Ga0495652_0039472 Ga0495652_0039472_2137_3276 367
191 3300046543 Ga0495645_0194434 Ga0495645_0194434_47_1186 367
192 3300005355 Ga0070671_100002260 Ga0070671_1000022601 368
193 3300005617 Ga0068859_100000050 Ga0068859_100000050100 368
194 3300005719 Ga0068861_100080337 Ga0068861_1000803372 368
195 3300005841 Ga0068863_100018629 Ga0068863_1000186291 368
196 3300005842 Ga0068858_100008500 Ga0068858_10000850010 368
197 3300006931 Ga0097620_100000050 Ga0097620_100000050100 368
198 3300025900 Ga0207710_10000187 Ga0207710_100001874 368
199 3300025931 Ga0207644_10009174 Ga0207644_100091743 368
200 3300025941 Ga0207711_10043420 Ga0207711_100434202 368
201 3300025986 Ga0207658_10004435 Ga0207658_100044353 368
202 3300026035 Ga0207703_10002799 Ga0207703_100027996 368
203 3300026088 Ga0207641_10003004 Ga0207641_100030046 368
204 3300031595 Ga0265313_10031952 Ga0265313_100319522 368
205 3300046543 Ga0495645_0005405 Ga0495645_0005405_2900_4039 368
206 3300047444 Ga0495675_0006253 Ga0495675_0006253_3494_4633 368
207 3300005458 Ga0070681_10351520 Ga0070681_103515202 369
208 3300009147 Ga0114129_10111562 Ga0114129_101115622 369
209 3300050507 nmdc:mga05p37_38118_c1 nmdc:mga05p37_38118_c1_2221_3405 369
210 3300005436 Ga0070713_100224383 Ga0070713_1002243832 370
211 3300005844 Ga0068862_100005969 Ga0068862_1000059692 370
212 3300009551 Ga0105238_10169853 Ga0105238_101698532 370
213 3300025913 Ga0207695_10016976 Ga0207695_100169764 370
214 3300028379 Ga0268266_10007902 Ga0268266_100079023 370
215 3300048922 Ga0496119_0014877 Ga0496119_0014877_2834_3958 370
216 3300048923 Ga0496120_0014178 Ga0496120_0014178_3427_4551 370
217 3300048928 Ga0496125_0020908 Ga0496125_0020908_3956_5080 370
218 3300031507 Ga0307509_10000002 Ga0307509_10000002489 371
219 3300005327 Ga0070658_10076358 Ga0070658_100763582 372
220 3300005548 Ga0070665_100093902 Ga0070665_1000939022 372
221 3300009551 Ga0105238_10072004 Ga0105238_100720042 372
222 3300013105 Ga0157369_10076474 Ga0157369_100764742 372
223 3300013307 Ga0157372_10110407 Ga0157372_101104072 372
224 3300028379 Ga0268266_10069236 Ga0268266_100692363 372
225 3300030521 Ga0307511_10000112 Ga0307511_1000011252 372
226 3300033180 Ga0307510_10002115 Ga0307510_100021159 372
227 3300053178 Ga0500637_0001621 Ga0500637_0001621_3148_4323 372
228 3300003320 rootH2_10127356 rootH2_101273564 373
229 3300005548 Ga0070665_100150518 Ga0070665_1001505182 373
230 3300005563 Ga0068855_100218510 Ga0068855_1002185102 373
231 3300005617 Ga0068859_100054016 Ga0068859_1000540162 373
232 3300005841 Ga0068863_100017074 Ga0068863_1000170742 373
233 3300005842 Ga0068858_100008788 Ga0068858_1000087884 373
234 3300005843 Ga0068860_100001030 Ga0068860_10000103011 373
235 3300006931 Ga0097620_100054016 Ga0097620_1000540162 373
236 3300009093 Ga0105240_10095008 Ga0105240_100950083 373
237 3300009101 Ga0105247_10011040 Ga0105247_100110403 373
238 3300009177 Ga0105248_10080629 Ga0105248_100806292 373
239 3300009551 Ga0105238_10253628 Ga0105238_102536282 373
240 3300009553 Ga0105249_10168550 Ga0105249_101685502 373
241 3300025900 Ga0207710_10007504 Ga0207710_100075043 373
242 3300025913 Ga0207695_10250459 Ga0207695_102504592 373
243 3300025924 Ga0207694_10082604 Ga0207694_100826042 373
244 3300025924 Ga0207694_10275092 Ga0207694_102750921 373
245 3300025941 Ga0207711_10234192 Ga0207711_102341921 373
246 3300026035 Ga0207703_10000380 Ga0207703_1000038037 373
247 3300026067 Ga0207678_10046000 Ga0207678_100460002 373
248 3300026088 Ga0207641_10002173 Ga0207641_1000217310 373
249 3300026088 Ga0207641_10110464 Ga0207641_101104641 373
250 3300028381 Ga0268264_10000145 Ga0268264_1000014527 373
251 3300033180 Ga0307510_10000007 Ga0307510_1000000723 373
252 3300048922 Ga0496119_0000655 Ga0496119_0000655_18816_19949 373
253 3300048923 Ga0496120_0000381 Ga0496120_0000381_68450_69583 373
254 3300048928 Ga0496125_0000606 Ga0496125_0000606_26921_28066 373
255 3300048929 Ga0496126_0198504 Ga0496126_0198504_90_1235 373

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

58

388

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9456 22 372
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.9402 22 372
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.9388 21 371
3imh-assembly1.cif.gz_A crystal structure of galactose 1-epimerase from lactobacillus acidophilus ncfm 0.9303 22 373
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.928 21 371
ID Description Score Start End Superfamily
af_Q66HG4_1_342_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9503 22 372 2.70.98.10
af_Q66HG4_1_342_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9449 22 372 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9401 39 371 2.70.98.10
4rnlC00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9381 20 371 2.70.98.10
af_P0A9C3_9_344_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9337 39 370 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A354HW97-F1-model_v4 Galactose-1-epimerase 0.9868 212 317 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A3D0M1M4-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase) (Type-1 mutarotase) 0.9799 23 307 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A6B3IPK7-F1-model_v4 Galactose-1-epimerase 0.979 54 208 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499
AF-A0A4U9KM16-F1-model_v4 deleted 0.9744 60 282
AF-A0A0P0L4Z5-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase) (Type-1 mutarotase) 0.973 72 373 GO:0004034
GO:0005737
GO:0006006
GO:0030246
GO:0033499

Feature Viewer

pLDDT pTM Quality
90.32 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map