F365620

General Info

Members Datasets Scaffolds Average Seq Length
255 177 510 136

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100066404|Ga0075435_1000664042
Length 149
Sequence VKLGPEHGGVPLAYLIGAVLAFGVGGMATLVCLDRDRAFYPTVLIVIASYYALFAVMGGSDHALGVETAVIAVFLAASIVGFKYSLWLVVAALAAHGVFDAVHGRLIANPGVPAWWPPFCLAYDVVAAGYLAYLLLRRKVGAPKVTTHL

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
120 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
162 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 6.27
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 28.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100066404 3300007076 Bacteria 2935
2 rootL2_10106605 3300003322 Bacteria 4358
3 Ga0065707_10002261 3300005295 Bacteria 4799
4 Ga0065707_10384180 3300005295 Unclassified 873
5 Ga0070658_11177183 3300005327 Bacteria 666
6 Ga0070683_100597284 3300005329 Bacteria 1056
7 Ga0070690_100113431 3300005330 Bacteria 1811
8 Ga0070670_100016155 3300005331 Bacteria 6407
9 Ga0070677_10372440 3300005333 Bacteria 745
10 Ga0070682_100000003 3300005337 Bacteria 469319
11 Ga0068868_100284645 3300005338 Bacteria 1400
12 Ga0070660_100000005 3300005339 Bacteria 169758
13 Ga0070689_100001489 3300005340 Bacteria 14946
14 Ga0070689_100336426 3300005340 Bacteria 1264
15 Ga0070689_101240714 3300005340 Unclassified 670
16 Ga0070687_100124598 3300005343 Bacteria 1479
17 Ga0070687_100272209 3300005343 Bacteria 1062
18 Ga0070687_100424075 3300005343 Bacteria 878
19 Ga0070692_10478162 3300005345 Bacteria 803
20 Ga0070675_100379529 3300005354 Bacteria 1258
21 Ga0070671_100456085 3300005355 Bacteria 1097
22 Ga0070674_100486267 3300005356 Unclassified 1025
23 Ga0070673_100116230 3300005364 Bacteria 2225
24 Ga0070673_100157860 3300005364 Bacteria 1927
25 Ga0070673_100214857 3300005364 Bacteria 1662
26 Ga0070673_100269914 3300005364 Bacteria 1489
27 Ga0070673_100824752 3300005364 Bacteria 857
28 Ga0070688_101627249 3300005365 Bacteria 528
29 Ga0070659_100395614 3300005366 Bacteria 1166
30 Ga0070667_100506154 3300005367 Bacteria 1107
31 Ga0070667_100914725 3300005367 Bacteria 817
32 Ga0070703_10000187 3300005406 Bacteria 30058
33 Ga0070701_10002559 3300005438 Bacteria 7040
34 Ga0070711_100168404 3300005439 Bacteria 1668
35 Ga0070711_101740322 3300005439 Unclassified 546
36 Ga0070705_100297284 3300005440 Bacteria 1155
37 Ga0070705_100402204 3300005440 Unclassified 1014
38 Ga0070694_100011925 3300005444 Bacteria 5393
39 Ga0070708_100118960 3300005445 Bacteria 2435
40 Ga0070708_100284367 3300005445 Unclassified 1557
41 Ga0070678_100646312 3300005456 Bacteria 948
42 Ga0068867_100327588 3300005459 Unclassified 1271
43 Ga0068867_101091953 3300005459 Bacteria 728
44 Ga0070706_100001623 3300005467 Bacteria 23456
45 Ga0070698_101385641 3300005471 Unclassified 654
46 Ga0070699_101575570 3300005518 Unclassified 602
47 Ga0070679_101162106 3300005530 Bacteria 717
48 Ga0070684_100632046 3300005535 Bacteria 996
49 Ga0070672_100043184 3300005543 Bacteria 3475
50 Ga0070672_101058177 3300005543 Unclassified 720
51 Ga0070686_100001911 3300005544 Bacteria 11597
52 Ga0070695_100215686 3300005545 Unclassified 1380
53 Ga0070693_100045643 3300005547 Bacteria 2485
54 Ga0068855_100159020 3300005563 Bacteria 2565
55 Ga0070664_100501333 3300005564 Bacteria 1119
56 Ga0068856_100113384 3300005614 Bacteria 2709
57 Ga0068856_100172147 3300005614 Bacteria 2177
58 Ga0068852_100619187 3300005616 Unclassified 1088
59 Ga0068864_100309587 3300005618 Bacteria 1480
60 Ga0068858_100006238 3300005842 Bacteria 11617
61 Ga0068860_100415474 3300005843 Bacteria 1333
62 Ga0070712_100344975 3300006175 Bacteria 1217
63 Ga0075428_101467493 3300006844 Bacteria 715
64 Ga0075430_100000914 3300006846 Bacteria 23180
65 Ga0075431_100866183 3300006847 Unclassified 874
66 Ga0075431_101799771 3300006847 Unclassified 569
67 Ga0075433_10001586 3300006852 Bacteria 16840
68 Ga0075433_10943854 3300006852 Unclassified 752
69 Ga0075434_100063730 3300006871 Bacteria 3669
70 Ga0075434_100093822 3300006871 Bacteria 3005
71 Ga0075434_100344174 3300006871 Bacteria 1512
72 Ga0075434_101226688 3300006871 Unclassified 762
73 Ga0075429_101722432 3300006880 Bacteria 544
74 Ga0075436_100008789 3300006914 Bacteria 6907
75 Ga0097620_101439919 3300006931 Unclassified 760
76 Ga0075435_100287824 3300007076 Bacteria 1403
77 Ga0075435_100493955 3300007076 Bacteria 1058
78 Ga0075435_101633892 3300007076 Bacteria 565
79 Ga0105240_10110988 3300009093 Bacteria 3318
80 Ga0105240_10559768 3300009093 Unclassified 1264
81 Ga0111539_10092385 3300009094 Bacteria 3556
82 Ga0111539_10289277 3300009094 Bacteria 1907
83 Ga0105245_10000506 3300009098 Bacteria 35764
84 Ga0114129_10364630 3300009147 Bacteria 1911
85 Ga0114129_10677892 3300009147 Bacteria 1327
86 Ga0114129_13271017 3300009147 Unclassified 525
87 Ga0105238_11271396 3300009551 Bacteria 761
88 Ga0105249_10755636 3300009553 Bacteria 1034
89 Ga0099796_10001030 3300010159 Bacteria 5285
90 Ga0105239_10358294 3300010375 Bacteria 1647
91 Ga0105239_11491334 3300010375 Unclassified 781
92 Ga0157378_10069696 3300013297 Bacteria 3155
93 Ga0157378_10676192 3300013297 Unclassified 1050
94 Ga0157372_10131714 3300013307 Bacteria 2877
95 Ga0157372_12760111 3300013307 Unclassified 563
96 Ga0157375_10502504 3300013308 Bacteria 1376
97 Ga0157380_12100051 3300014326 Unclassified 628
98 Ga0207653_10000013 3300025885 Bacteria 159236
99 Ga0207645_10522357 3300025907 Bacteria 804
100 Ga0207643_10813218 3300025908 Bacteria 606
101 Ga0207705_11039128 3300025909 Unclassified 632
102 Ga0207684_10000037 3300025910 Bacteria 284224
103 Ga0207684_10436124 3300025910 Bacteria 1125
104 Ga0207695_10068754 3300025913 Bacteria 3628
105 Ga0207662_10217092 3300025918 Bacteria 1244
106 Ga0207662_10307064 3300025918 Bacteria 1056
107 Ga0207681_10531392 3300025923 Bacteria 966
108 Ga0207694_10808931 3300025924 Bacteria 792
109 Ga0207687_10000914 3300025927 Bacteria 20106
110 Ga0207644_11049556 3300025931 Unclassified 684
111 Ga0207690_10444941 3300025932 Unclassified 1041
112 Ga0207670_10000984 3300025936 Bacteria 15057
113 Ga0207670_11143908 3300025936 Unclassified 658
114 Ga0207670_11943745 3300025936 Unclassified 500
115 Ga0207669_10790938 3300025937 Bacteria 786
116 Ga0207691_10006965 3300025940 Bacteria 10906
117 Ga0207661_10811670 3300025944 Bacteria 861
118 Ga0207679_10221835 3300025945 Bacteria 1591
119 Ga0207667_10972995 3300025949 Unclassified 837
120 Ga0207651_10052630 3300025960 Bacteria 2777
121 Ga0207651_10080020 3300025960 Bacteria 2350
122 Ga0207651_10376482 3300025960 Bacteria 1202
123 Ga0207651_10417684 3300025960 Bacteria 1144
124 Ga0207651_10760680 3300025960 Bacteria 857
125 Ga0207712_10400465 3300025961 Bacteria 1153
126 Ga0207712_11887000 3300025961 Bacteria 535
127 Ga0207658_10425194 3300025986 Bacteria 1172
128 Ga0207677_10221774 3300026023 Bacteria 1517
129 Ga0207703_10002505 3300026035 Bacteria 15892
130 Ga0207678_10031594 3300026067 Bacteria 4619
131 Ga0207708_10211592 3300026075 Bacteria 1550
132 Ga0207702_10126090 3300026078 Bacteria 2299
133 Ga0207648_10192218 3300026089 Unclassified 1809
134 Ga0207648_11239175 3300026089 Unclassified 701
135 Ga0207676_10069134 3300026095 Bacteria 2827
136 Ga0207675_100932394 3300026118 Bacteria 885
137 Ga0207698_11401003 3300026142 Unclassified 714
138 Ga0209973_1077971 3300027252 Unclassified 524
139 Ga0207428_11119562 3300027907 Bacteria 550
140 Ga0268266_10000904 3300028379 Bacteria 38294
141 Ga0268264_10382416 3300028381 Bacteria 1348
142 Ga0307408_100001958 3300031548 Bacteria 14895
143 Ga0307408_100350690 3300031548 Bacteria 1252
144 Ga0307405_10020127 3300031731 Bacteria 3723
145 Ga0307413_10011445 3300031824 Bacteria 4364
146 Ga0307413_10528509 3300031824 Bacteria 953
147 Ga0307410_10021473 3300031852 Bacteria 3972
148 Ga0307410_11465323 3300031852 Unclassified 600
149 Ga0307406_10005049 3300031901 Bacteria 7196
150 Ga0307406_10026792 3300031901 Bacteria 3466
151 Ga0307406_10175438 3300031901 Bacteria 1555
152 Ga0307407_10017209 3300031903 Bacteria 3620
153 Ga0307407_10053722 3300031903 Bacteria 2319
154 Ga0307412_10446433 3300031911 Bacteria 1064
155 Ga0307409_100047897 3300031995 Bacteria 3248
156 Ga0307409_100065925 3300031995 Bacteria 2852
157 Ga0307416_100159932 3300032002 Bacteria 2080
158 Ga0307416_100290419 3300032002 Unclassified 1618
159 Ga0307416_101723721 3300032002 Unclassified 731
160 Ga0307414_10008304 3300032004 Bacteria 5881
161 Ga0307414_10425232 3300032004 Bacteria 1159
162 Ga0307414_10471255 3300032004 Bacteria 1105
163 Ga0307411_10041885 3300032005 Bacteria 2918
164 Ga0307411_10050504 3300032005 Bacteria 2709
165 Ga0307415_100036627 3300032126 Bacteria 3216
166 Ga0307415_100178450 3300032126 Bacteria 1664
167 Ga0307415_100321471 3300032126 Unclassified 1290
168 Ga0373959_0219869 3300034820 Unclassified 509
169 Ga0373956_0097337 3300035119 Unclassified 1362
170 Ga0373943_0486276 3300035170 Unclassified 720
171 Ga0373955_0007603 3300035172 Unclassified 4991
172 Ga0373937_0706800 3300036401 Unclassified 955
173 Ga0373937_0815138 3300036401 Unclassified 881
174 Ga0373937_1618079 3300036401 Unclassified 595
175 Ga0373925_0050756 3300037068 Bacteria 3095
176 Ga0451789_0992349 3300041443 Bacteria 516
177 Ga0451797_1035952 3300041453 Bacteria 756
178 Ga0451853_1736830 3300041512 Bacteria 890
179 Ga0451853_3951846 3300041512 Unclassified 921
180 Ga0439445_0157366 3300042004 Bacteria 663
181 Ga0439446_0048877 3300042156 Bacteria 1260
182 Ga0439444_0193804 3300042437 Unclassified 510
183 Ga0439460_0117023 3300042461 Unclassified 869
184 Ga0450893_0022959 3300042532 Bacteria 1083
185 Ga0453684_0063357 3300044712 Bacteria 4730
186 Ga0453684_1879391 3300044712 Bacteria 606
187 Ga0495603_0154451 3300046455 Bacteria 1332
188 Ga0495629_0000092 3300046459 Bacteria 78242
189 Ga0495580_0705842 3300046472 Unclassified 660
190 Ga0495582_0027801 3300046473 Unclassified 3102
191 Ga0495630_0241815 3300046517 Unclassified 1379
192 Ga0495586_0263040 3300046535 Unclassified 985
193 Ga0495598_0327500 3300046537 Unclassified 585
194 Ga0495635_0070827 3300046663 Bacteria 2390
195 Ga0495657_0253581 3300046675 Unclassified 1059
196 Ga0495658_0900315 3300046683 Unclassified 566
197 Ga0495624_0224678 3300046690 Bacteria 1138
198 Ga0495636_0588032 3300047318 Unclassified 543
199 Ga0495676_0015804 3300047321 Bacteria 6709
200 Ga0495680_0326853 3300047322 Unclassified 1072
201 Ga0495675_0438070 3300047444 Bacteria 757
202 Ga0496101_0538402 3300048904 Unclassified 923
203 Ga0496102_1281889 3300048905 Unclassified 652
204 Ga0496102_1538528 3300048905 Bacteria 584
205 Ga0496104_1112294 3300048907 Unclassified 694
206 Ga0496104_1220644 3300048907 Bacteria 655
207 Ga0496106_0295778 3300048909 Bacteria 1298
208 Ga0496108_0164861 3300048911 Unclassified 1916
209 Ga0496109_0533242 3300048912 Bacteria 1108
210 Ga0496109_0585898 3300048912 Unclassified 1051
211 Ga0496110_0173350 3300048913 Bacteria 1957
212 Ga0496110_0269351 3300048913 Bacteria 1551
213 Ga0496111_0054681 3300048914 Bacteria 2886
214 Ga0496112_0664127 3300048915 Bacteria 971
215 Ga0496113_0295897 3300048916 Unclassified 1296
216 Ga0501039_0881828 3300049575 Bacteria 697
217 Ga0501040_0107029 3300049576 Bacteria 1954
218 Ga0501041_0054553 3300049577 Bacteria 2438
219 Ga0501042_0009021 3300049578 Bacteria 6628
220 Ga0501046_1114679 3300049580 Unclassified 545
221 Ga0501048_0007850 3300049582 Bacteria 8086
222 Ga0501048_0811811 3300049582 Unclassified 672
223 Ga0501071_0184722 3300049587 Bacteria 1563
224 Ga0501072_0185870 3300049588 Bacteria 1658
225 Ga0501074_1228200 3300049590 Bacteria 525
226 Ga0501257_032419 3300049686 Bacteria 1264
227 Ga0501257_076699 3300049686 Bacteria 858
228 Ga0501079_0148793 3300049741 Bacteria 1825
229 Ga0501080_0483310 3300049742 Bacteria 1108
230 Ga0501080_0632837 3300049742 Bacteria 948
231 Ga0501081_0520480 3300049743 Bacteria 887
232 Ga0501044_0011929 3300049823 Bacteria 9418
233 Ga0501045_0238419 3300049824 Unclassified 1354
234 nmdc:mga0qj67_46597_c1 3300050509 Bacteria 3423
235 nmdc:mga08y16_1125512_c1 3300050511 Bacteria 759
236 nmdc:mga08y16_1887458_c1 3300050511 Bacteria 549
237 nmdc:mga08y16_713478_c1 3300050511 Bacteria 1001
238 nmdc:mga0n895_1326313_c1 3300050512 Unclassified 690
239 nmdc:mga0n895_14156_c1 3300050512 Bacteria 7234
240 nmdc:mga0n895_213125_c1 3300050512 Unclassified 1961
241 nmdc:mga0n895_265281_c1 3300050512 Bacteria 1742
242 nmdc:mga0n895_378285_c1 3300050512 Bacteria 1433
243 nmdc:mga0n895_386545_c1 3300050512 Bacteria 1416
244 nmdc:mga0rr50_272353_c1 3300050513 Unclassified 1411
245 nmdc:mga0rr50_7487_c1 3300050513 Bacteria 6738
246 nmdc:mga0rr50_760964_c1 3300050513 Bacteria 827
247 nmdc:mga08x19_560616_c1 3300050514 Unclassified 809
248 nmdc:mga0a205_1409893_c1 3300050515 Unclassified 544
249 nmdc:mga0a205_16778_c1 3300050515 Bacteria 6858
250 nmdc:mga0a205_902978_c1 3300050515 Unclassified 730
251 Ga0495601_0469836 3300053077 Bacteria 813
252 Ga0500566_0044627 3300053094 Bacteria 2553
253 Ga0501084_0158836 3300054114 Bacteria 1907
254 Ga0501084_0636265 3300054114 Unclassified 901
255 Ga0530510_0062450 3300061734 Bacteria 2697
256 Ga0075435_100066404
257 rootL2_10106605
258 Ga0065707_10002261
259 Ga0065707_10384180
260 Ga0070658_11177183
261 Ga0070683_100597284
262 Ga0070690_100113431
263 Ga0070670_100016155
264 Ga0070677_10372440
265 Ga0070682_100000003
266 Ga0068868_100284645
267 Ga0070660_100000005
268 Ga0070689_100001489
269 Ga0070689_100336426
270 Ga0070689_101240714
271 Ga0070687_100124598
272 Ga0070687_100272209
273 Ga0070687_100424075
274 Ga0070692_10478162
275 Ga0070675_100379529
276 Ga0070671_100456085
277 Ga0070674_100486267
278 Ga0070673_100116230
279 Ga0070673_100157860
280 Ga0070673_100214857
281 Ga0070673_100269914
282 Ga0070673_100824752
283 Ga0070688_101627249
284 Ga0070659_100395614
285 Ga0070667_100506154
286 Ga0070667_100914725
287 Ga0070703_10000187
288 Ga0070701_10002559
289 Ga0070711_100168404
290 Ga0070711_101740322
291 Ga0070705_100297284
292 Ga0070705_100402204
293 Ga0070694_100011925
294 Ga0070708_100118960
295 Ga0070708_100284367
296 Ga0070678_100646312
297 Ga0068867_100327588
298 Ga0068867_101091953
299 Ga0070706_100001623
300 Ga0070698_101385641
301 Ga0070699_101575570
302 Ga0070679_101162106
303 Ga0070684_100632046
304 Ga0070672_100043184
305 Ga0070672_101058177
306 Ga0070686_100001911
307 Ga0070695_100215686
308 Ga0070693_100045643
309 Ga0068855_100159020
310 Ga0070664_100501333
311 Ga0068856_100113384
312 Ga0068856_100172147
313 Ga0068852_100619187
314 Ga0068864_100309587
315 Ga0068858_100006238
316 Ga0068860_100415474
317 Ga0070712_100344975
318 Ga0075428_101467493
319 Ga0075430_100000914
320 Ga0075431_100866183
321 Ga0075431_101799771
322 Ga0075433_10001586
323 Ga0075433_10943854
324 Ga0075434_100063730
325 Ga0075434_100093822
326 Ga0075434_100344174
327 Ga0075434_101226688
328 Ga0075429_101722432
329 Ga0075436_100008789
330 Ga0097620_101439919
331 Ga0075435_100287824
332 Ga0075435_100493955
333 Ga0075435_101633892
334 Ga0105240_10110988
335 Ga0105240_10559768
336 Ga0111539_10092385
337 Ga0111539_10289277
338 Ga0105245_10000506
339 Ga0114129_10364630
340 Ga0114129_10677892
341 Ga0114129_13271017
342 Ga0105238_11271396
343 Ga0105249_10755636
344 Ga0099796_10001030
345 Ga0105239_10358294
346 Ga0105239_11491334
347 Ga0157378_10069696
348 Ga0157378_10676192
349 Ga0157372_10131714
350 Ga0157372_12760111
351 Ga0157375_10502504
352 Ga0157380_12100051
353 Ga0207653_10000013
354 Ga0207645_10522357
355 Ga0207643_10813218
356 Ga0207705_11039128
357 Ga0207684_10000037
358 Ga0207684_10436124
359 Ga0207695_10068754
360 Ga0207662_10217092
361 Ga0207662_10307064
362 Ga0207681_10531392
363 Ga0207694_10808931
364 Ga0207687_10000914
365 Ga0207644_11049556
366 Ga0207690_10444941
367 Ga0207670_10000984
368 Ga0207670_11143908
369 Ga0207670_11943745
370 Ga0207669_10790938
371 Ga0207691_10006965
372 Ga0207661_10811670
373 Ga0207679_10221835
374 Ga0207667_10972995
375 Ga0207651_10052630
376 Ga0207651_10080020
377 Ga0207651_10376482
378 Ga0207651_10417684
379 Ga0207651_10760680
380 Ga0207712_10400465
381 Ga0207712_11887000
382 Ga0207658_10425194
383 Ga0207677_10221774
384 Ga0207703_10002505
385 Ga0207678_10031594
386 Ga0207708_10211592
387 Ga0207702_10126090
388 Ga0207648_10192218
389 Ga0207648_11239175
390 Ga0207676_10069134
391 Ga0207675_100932394
392 Ga0207698_11401003
393 Ga0209973_1077971
394 Ga0207428_11119562
395 Ga0268266_10000904
396 Ga0268264_10382416
397 Ga0307408_100001958
398 Ga0307408_100350690
399 Ga0307405_10020127
400 Ga0307413_10011445
401 Ga0307413_10528509
402 Ga0307410_10021473
403 Ga0307410_11465323
404 Ga0307406_10005049
405 Ga0307406_10026792
406 Ga0307406_10175438
407 Ga0307407_10017209
408 Ga0307407_10053722
409 Ga0307412_10446433
410 Ga0307409_100047897
411 Ga0307409_100065925
412 Ga0307416_100159932
413 Ga0307416_100290419
414 Ga0307416_101723721
415 Ga0307414_10008304
416 Ga0307414_10425232
417 Ga0307414_10471255
418 Ga0307411_10041885
419 Ga0307411_10050504
420 Ga0307415_100036627
421 Ga0307415_100178450
422 Ga0307415_100321471
423 Ga0373959_0219869
424 Ga0373956_0097337
425 Ga0373943_0486276
426 Ga0373955_0007603
427 Ga0373937_0706800
428 Ga0373937_0815138
429 Ga0373937_1618079
430 Ga0373925_0050756
431 Ga0451789_0992349
432 Ga0451797_1035952
433 Ga0451853_1736830
434 Ga0451853_3951846
435 Ga0439445_0157366
436 Ga0439446_0048877
437 Ga0439444_0193804
438 Ga0439460_0117023
439 Ga0450893_0022959
440 Ga0453684_0063357
441 Ga0453684_1879391
442 Ga0495603_0154451
443 Ga0495629_0000092
444 Ga0495580_0705842
445 Ga0495582_0027801
446 Ga0495630_0241815
447 Ga0495586_0263040
448 Ga0495598_0327500
449 Ga0495635_0070827
450 Ga0495657_0253581
451 Ga0495658_0900315
452 Ga0495624_0224678
453 Ga0495636_0588032
454 Ga0495676_0015804
455 Ga0495680_0326853
456 Ga0495675_0438070
457 Ga0496101_0538402
458 Ga0496102_1281889
459 Ga0496102_1538528
460 Ga0496104_1112294
461 Ga0496104_1220644
462 Ga0496106_0295778
463 Ga0496108_0164861
464 Ga0496109_0533242
465 Ga0496109_0585898
466 Ga0496110_0173350
467 Ga0496110_0269351
468 Ga0496111_0054681
469 Ga0496112_0664127
470 Ga0496113_0295897
471 Ga0501039_0881828
472 Ga0501040_0107029
473 Ga0501041_0054553
474 Ga0501042_0009021
475 Ga0501046_1114679
476 Ga0501048_0007850
477 Ga0501048_0811811
478 Ga0501071_0184722
479 Ga0501072_0185870
480 Ga0501074_1228200
481 Ga0501257_032419
482 Ga0501257_076699
483 Ga0501079_0148793
484 Ga0501080_0483310
485 Ga0501080_0632837
486 Ga0501081_0520480
487 Ga0501044_0011929
488 Ga0501045_0238419
489 nmdc:mga0qj67_46597_c1
490 nmdc:mga08y16_1125512_c1
491 nmdc:mga08y16_1887458_c1
492 nmdc:mga08y16_713478_c1
493 nmdc:mga0n895_1326313_c1
494 nmdc:mga0n895_14156_c1
495 nmdc:mga0n895_213125_c1
496 nmdc:mga0n895_265281_c1
497 nmdc:mga0n895_378285_c1
498 nmdc:mga0n895_386545_c1
499 nmdc:mga0rr50_272353_c1
500 nmdc:mga0rr50_7487_c1
501 nmdc:mga0rr50_760964_c1
502 nmdc:mga08x19_560616_c1
503 nmdc:mga0a205_1409893_c1
504 nmdc:mga0a205_16778_c1
505 nmdc:mga0a205_902978_c1
506 Ga0495601_0469836
507 Ga0500566_0044627
508 Ga0501084_0158836
509 Ga0501084_0636265
510 Ga0530510_0062450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6l-assembly1.cif.gz_J subtomogram average of the human sec61-trap-osta-translocon 0.75 75 128
6s7o-assembly1.cif.gz_H cryo-em structure of human oligosaccharyltransferase complex ost-a 0.7071 75 127
7m5t-assembly1.cif.gz_A solution nmr structure of de novo designed protein 0515 0.6165 28 119
7m5t-assembly1.cif.gz_A solution nmr structure of de novo designed protein 0515 0.5749 28 119
4o5m-assembly1.cif.gz_A x-ray crystal structure of isovaleryl-coa dehydrogenase from brucella suis 0.498 31 133
ID Description Score Start End Superfamily
af_Q54CS1_1_135_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.7406 2 120 1.20.1250.20
af_Q54CS1_1_135_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6674 2 120 1.20.1250.20
af_C7G056_1_101_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6643 31 120 1.10.10.1740
af_O17257_1_136_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6284 23 120 1.20.140.150
af_Q2FZY1_1_104_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.6225 28 126 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A2V7YA01-F1-model_v4 Uncharacterized protein 0.99 1 128 GO:0016020
AF-A0A534GS70-F1-model_v4 Permease 0.9895 1 125 GO:0016020
AF-W0RG24-F1-model_v4 YhhN family protein 0.9855 1 133 GO:0016020
AF-A0A1Q7QKR5-F1-model_v4 Uncharacterized protein 0.9843 1 115 GO:0016020
AF-A0A4V3CSU7-F1-model_v4 Uncharacterized protein 0.9835 1 133 GO:0016020

Map