F365558

General Info

Members Datasets Scaffolds Average Seq Length
255 201 510 316

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100000014|Ga0068859_10000001441
Length 386
Sequence MVRRSPRPAGVPSAGGRRRIGSPGRQAPRKEPQLSTELSIGPTGSARPRAALTVRAPAKVNLHLGVGPRRADGYHEVITVLQAVSLYDELTVTSLPVKDAGLHAAASDVSDVPGAVAAPDTPAVEVTVEITGEGAATPGGAGAADDVSVVPVDADNLAVRAALLVAEAAGIRGERIHVALTKGIPVAAGMAGGSADAAAALVACDALWGAGLSAETLAQLAARLGSDVPFPLTGGTALGVGRGERLSPVTSVGEYHWVFALADGGLSTPAVYREFDRVDDGRTEPTPADAVLSALTTGDPAVLGAALVNDLQAPAIRLRPALGDVLAAGRAHGALGALVSGSGPTCAFLAGDAEHAARLAEGIQASGLARAVRRATAPATGATVVS

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
39 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
56 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
57 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
58 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
59 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
60 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
65 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
66 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
69 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
75 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
76 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
77 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
78 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
79 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
94 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
95 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2506783011 Frankia datiscae Dg1 Isolate Nodule
143 2508501039 Frankia saprophytica CN3 Isolate Nodule
144 2517572101 Frankia sp. DC12 Isolate Nodule
145 2527291627 Frankia casuarinae Thr Isolate Nodule
146 2527291629 Frankia sp. BMG5.23 Isolate Nodule
147 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
148 2576861822 Frankia sp. CeD Isolate Nodule
149 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
150 2619618881 Frankia sp. ACN1ag Isolate Unclassified
151 2619619003 Frankia sp. CpI1-P Isolate Nodule
152 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
153 2626541554 Frankia sp. AvcI.1 Isolate Nodule
154 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
155 2643221546 Microbacterium sp. Root53 Isolate Unclassified
156 2643221549 Agromyces sp. Root1464 Isolate Unclassified
157 2643221553 Microbacterium sp. Root553 Isolate Unclassified
158 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
159 2643221619 Agromyces sp. Root81 Isolate Unclassified
160 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
161 2643221630 Microbacterium sp. Root322 Isolate Unclassified
162 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
163 2671180195 Frankia sp. CcI49 Isolate Nodule
164 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
165 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
166 2684623036 Frankia sp. CgIM4 Isolate Nodule
167 2687453737 Frankia sp. BMG5.36 Isolate Nodule
168 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
169 2710264753 Frankia sp. KB5 Isolate Nodule
170 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
171 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
172 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
173 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
174 2773857922 Frankia sp. CcI49 Isolate Nodule
175 2773857924 Frankia sp. CgIS1 Isolate Nodule
176 2773857933 Frankia sp. BMG5.30 Isolate Nodule
177 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
178 2808606372 Agromyces sp. 23-23 Isolate Unclassified
179 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
180 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
181 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
182 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
183 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
184 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
185 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
186 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
187 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
188 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
189 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
190 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
191 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
192 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
193 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
194 637000116 Frankia casuarinae CcI3 Isolate Nodule
195 8002775197 Frankia nepalensis CN7 Isolate Nodule
196 8002784119 Frankia sp. AgB1.9 Isolate Nodule
197 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
198 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
199 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
200 8054920844 Frankia tisae Agncl-8 Isolate Nodule
201 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.29
Metatranscriptomes 1.18
Isolates 23.53

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 2.35
Nodule 9.41
Rhizoplane 6.27
Rhizosphere 62.35
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100000014 3300005617 Bacteria 280955
2 Ga0070658_10017928 3300005327 Bacteria 5662
3 Ga0070683_100070773 3300005329 Bacteria 3254
4 Ga0070680_100110721 3300005336 Bacteria 2286
5 Ga0070682_100135394 3300005337 Bacteria 1673
6 Ga0070668_100066862 3300005347 Bacteria 2790
7 Ga0070675_100231802 3300005354 Bacteria 1611
8 Ga0070713_100492589 3300005436 Bacteria 1156
9 Ga0070681_10222956 3300005458 Bacteria 1800
10 Ga0070679_100165969 3300005530 Bacteria 2181
11 Ga0070684_100161581 3300005535 Bacteria 2032
12 Ga0070664_100189336 3300005564 Bacteria 1833
13 Ga0068859_100003541 3300005617 Bacteria 15902
14 Ga0068861_100094659 3300005719 Bacteria 2364
15 Ga0068870_10035874 3300005840 Bacteria 2548
16 Ga0068863_100001496 3300005841 Bacteria 23132
17 Ga0068863_100295115 3300005841 Bacteria 1572
18 Ga0068858_100000689 3300005842 Bacteria 35285
19 Ga0068858_100005736 3300005842 Bacteria 12132
20 Ga0068862_100002847 3300005844 Bacteria 15167
21 Ga0068862_100156063 3300005844 Bacteria 2034
22 Ga0081540_1003366 3300005983 Bacteria 12669
23 Ga0070717_10149607 3300006028 Bacteria 2019
24 Ga0075364_10083322 3300006051 Bacteria 2116
25 Ga0075364_10144840 3300006051 Bacteria 1599
26 Ga0075364_10183606 3300006051 Bacteria 1416
27 Ga0075428_100000146 3300006844 Bacteria 63972
28 Ga0075431_100013729 3300006847 Bacteria 8182
29 Ga0075431_100109319 3300006847 Bacteria 2854
30 Ga0097620_100000014 3300006931 Bacteria 280955
31 Ga0097620_100003541 3300006931 Bacteria 15902
32 Ga0105251_10037219 3300009011 Bacteria 2389
33 Ga0111539_10621602 3300009094 Bacteria 1258
34 Ga0105247_10000020 3300009101 Bacteria 233167
35 Ga0105247_10003945 3300009101 Bacteria 9555
36 Ga0105243_10120769 3300009148 Bacteria 2208
37 Ga0105243_10258200 3300009148 Bacteria 1559
38 Ga0105248_10000076 3300009177 Bacteria 114070
39 Ga0105248_10000488 3300009177 Bacteria 45037
40 Ga0105249_10009442 3300009553 Bacteria 8541
41 Ga0105239_10374037 3300010375 Bacteria 1610
42 Ga0157369_10034251 3300013105 Bacteria 5575
43 Ga0163162_10336640 3300013306 Bacteria 1641
44 Ga0157375_10076534 3300013308 Bacteria 3373
45 Ga0163163_10022580 3300014325 Bacteria 5962
46 Ga0163163_10030379 3300014325 Bacteria 5206
47 Ga0163163_10069565 3300014325 Bacteria 3504
48 Ga0157380_10208495 3300014326 Bacteria 1740
49 Ga0157379_10002107 3300014968 Bacteria 16492
50 Ga0157379_10005279 3300014968 Bacteria 11093
51 Ga0206353_11218005 3300020082 Bacteria 1722
52 Ga0206353_11316805 3300020082 Bacteria 3012
53 Ga0209646_1000224 3300025246 Bacteria 60259
54 Ga0207710_10000011 3300025900 Bacteria 428560
55 Ga0207710_10000019 3300025900 Bacteria 339682
56 Ga0207643_10067702 3300025908 Bacteria 2050
57 Ga0207707_10510246 3300025912 Bacteria 1025
58 Ga0207660_10110526 3300025917 Bacteria 2068
59 Ga0207644_10187244 3300025931 Bacteria 1626
60 Ga0207665_10063268 3300025939 Bacteria 2513
61 Ga0207711_10000604 3300025941 Bacteria 36283
62 Ga0207711_10024656 3300025941 Bacteria 5043
63 Ga0207661_10034026 3300025944 Bacteria 3959
64 Ga0207712_10069910 3300025961 Bacteria 2520
65 Ga0207668_10168320 3300025972 Bacteria 1716
66 Ga0207703_10000013 3300026035 Bacteria 305126
67 Ga0207703_10056047 3300026035 Bacteria 3208
68 Ga0207641_10008636 3300026088 Bacteria 8411
69 Ga0207641_10018860 3300026088 Bacteria 5658
70 Ga0207676_10149795 3300026095 Bacteria 2008
71 Ga0207674_10112967 3300026116 Bacteria 2690
72 Ga0207675_100106371 3300026118 Bacteria 2645
73 Ga0268265_10000015 3300028380 Bacteria 322854
74 Ga0316576_10010964 3300031727 Bacteria 5911
75 Ga0316576_10181952 3300031727 Bacteria 1585
76 Ga0316578_10001378 3300031728 Bacteria 9795
77 Ga0307413_10221731 3300031824 Bacteria 1382
78 Ga0307518_10044907 3300031838 Bacteria 3214
79 Ga0307410_10000845 3300031852 Bacteria 13030
80 Ga0307406_10000172 3300031901 Bacteria 38746
81 Ga0307406_10000624 3300031901 Bacteria 20198
82 Ga0307412_10269015 3300031911 Bacteria 1333
83 Ga0307409_100564541 3300031995 Bacteria 1119
84 Ga0307416_100005764 3300032002 Bacteria 7671
85 Ga0307416_100222794 3300032002 Bacteria 1811
86 Ga0307416_100236566 3300032002 Bacteria 1766
87 Ga0307415_100142954 3300032126 Bacteria 1830
88 Ga0316585_10016685 3300032137 Bacteria 2214
89 Ga0316593_10072084 3300032168 Bacteria 1196
90 Ga0316574_0012961 3300035398 Bacteria 4782
91 Ga0316574_0019756 3300035398 Bacteria 3979
92 Ga0316574_0129038 3300035398 Bacteria 1626
93 Ga0316582_0014958 3300036647 Bacteria 4421
94 Ga0316584_0015922 3300036712 Bacteria 5386
95 Ga0395899_0153185 3300037312 Bacteria 1633
96 Ga0395900_0051653 3300037418 Bacteria 4234
97 Ga0395898_0066713 3300037466 Bacteria 3485
98 Ga0395898_0475599 3300037466 Bacteria 1189
99 Ga0395901_0011323 3300038443 Bacteria 9037
100 Ga0395901_0028948 3300038443 Bacteria 5699
101 Ga0439465_0029153 3300041413 Bacteria 1753
102 Ga0451833_1092040 3300041491 Bacteria 1721
103 Ga0451837_1663350 3300041494 Bacteria 1003
104 Ga0451843_0319031 3300041509 Bacteria 2723
105 Ga0439442_015855 3300042002 Bacteria 1553
106 Ga0439449_0088475 3300042007 Bacteria 1143
107 Ga0466960_0247956 3300044901 Bacteria 988
108 Ga0495627_000580 3300046453 Bacteria 29371
109 Ga0495638_0069765 3300046460 Bacteria 2153
110 Ga0495594_0015598 3300046499 Bacteria 3993
111 Ga0495644_0089570 3300046523 Bacteria 1161
112 Ga0495656_0058124 3300046615 Bacteria 1677
113 Ga0495668_0109748 3300046616 Bacteria 1509
114 Ga0495672_0099882 3300047320 Bacteria 1576
115 Ga0496104_0030045 3300048907 Bacteria 5046
116 Ga0496104_0108064 3300048907 Bacteria 2665
117 Ga0496104_0187909 3300048907 Bacteria 1977
118 Ga0496105_0148186 3300048908 Bacteria 1929
119 Ga0496105_0153701 3300048908 Bacteria 1890
120 Ga0496107_0242934 3300048910 Bacteria 1340
121 Ga0496108_0116270 3300048911 Bacteria 2291
122 Ga0496109_0285104 3300048912 Bacteria 1557
123 Ga0496110_0054061 3300048913 Bacteria 3532
124 Ga0496111_0042121 3300048914 Bacteria 3278
125 Ga0496112_0014535 3300048915 Bacteria 7311
126 Ga0496112_0018173 3300048915 Bacteria 6616
127 Ga0496112_0259911 3300048915 Bacteria 1686
128 Ga0496113_0132387 3300048916 Bacteria 1958
129 Ga0496114_0117983 3300048917 Bacteria 2279
130 Ga0496116_0000134 3300048919 Bacteria 153331
131 Ga0496117_0001847 3300048920 Bacteria 28576
132 Ga0496117_0009198 3300048920 Bacteria 9247
133 Ga0496117_0063733 3300048920 Bacteria 2518
134 Ga0496118_0000431 3300048921 Bacteria 69607
135 Ga0496118_0006195 3300048921 Bacteria 13257
136 Ga0496118_0037138 3300048921 Bacteria 3926
137 Ga0496119_0000714 3300048922 Bacteria 44648
138 Ga0496119_0007050 3300048922 Bacteria 10226
139 Ga0496120_0000132 3300048923 Bacteria 126393
140 Ga0496121_0047397 3300048924 Bacteria 3667
141 Ga0496121_0059997 3300048924 Bacteria 3133
142 Ga0496121_0142348 3300048924 Bacteria 1777
143 Ga0496122_0016503 3300048925 Bacteria 6980
144 Ga0496122_0037494 3300048925 Bacteria 3901
145 Ga0496125_0011355 3300048928 Bacteria 8917
146 Ga0496125_0011542 3300048928 Bacteria 8825
147 Ga0496125_0028697 3300048928 Bacteria 5018
148 Ga0496125_0053909 3300048928 Bacteria 3292
149 Ga0496126_0018596 3300048929 Bacteria 6879
150 Ga0496126_0069293 3300048929 Bacteria 3147
151 Ga0496126_0128942 3300048929 Bacteria 2187
152 Ga0496126_0167334 3300048929 Bacteria 1875
153 Ga0501031_0001784 3300049568 Bacteria 13503
154 Ga0501032_0050601 3300049569 Bacteria 2802
155 Ga0501033_0010935 3300049570 Bacteria 6958
156 Ga0501033_0024838 3300049570 Bacteria 4519
157 Ga0501034_0015373 3300049571 Bacteria 7865
158 Ga0501034_0112059 3300049571 Bacteria 2719
159 Ga0501034_0118737 3300049571 Bacteria 2631
160 Ga0501036_0033339 3300049572 Bacteria 4355
161 Ga0501037_0012492 3300049573 Bacteria 6255
162 Ga0501038_0008358 3300049574 Bacteria 9519
163 Ga0501039_0006462 3300049575 Bacteria 8910
164 Ga0501040_0011409 3300049576 Bacteria 5817
165 Ga0501041_0001798 3300049577 Bacteria 12014
166 Ga0501042_0168491 3300049578 Bacteria 1581
167 Ga0501042_0174831 3300049578 Bacteria 1549
168 Ga0501043_0009071 3300049579 Bacteria 7826
169 Ga0501046_0005793 3300049580 Bacteria 11028
170 Ga0501046_0092150 3300049580 Bacteria 2330
171 Ga0501047_0037382 3300049581 Bacteria 4695
172 Ga0501048_0003193 3300049582 Bacteria 12488
173 Ga0501067_0047746 3300049583 Bacteria 2375
174 Ga0501068_0018863 3300049584 Bacteria 3998
175 Ga0501070_0028209 3300049586 Bacteria 4707
176 Ga0501071_0001497 3300049587 Bacteria 13588
177 Ga0501072_0004826 3300049588 Bacteria 10267
178 Ga0501074_0023206 3300049590 Bacteria 4512
179 Ga0501075_0001813 3300049591 Bacteria 14076
180 Ga0501076_0002216 3300049592 Bacteria 13311
181 Ga0501079_0012048 3300049741 Bacteria 6598
182 Ga0501080_0155797 3300049742 Bacteria 2110
183 Ga0501081_0001537 3300049743 Bacteria 14179
184 Ga0501035_0041063 3300049822 Bacteria 4178
185 Ga0501044_0006440 3300049823 Bacteria 12967
186 Ga0501045_0004655 3300049824 Bacteria 9472
187 Ga0501045_0139086 3300049824 Bacteria 1806
188 nmdc:mga00v17_47270_c1 3300050491 Bacteria 2606
189 nmdc:mga00v17_93943_c1 3300050491 Bacteria 1886
190 nmdc:mga07m45_87441_c1 3300050496 Bacteria 1783
191 nmdc:mga06r32_511749_c1 3300050510 Bacteria 1177
192 nmdc:mga06r32_6728_c1 3300050510 Bacteria 10327
193 Ga0501084_0017309 3300054114 Bacteria 5989
194 Ga0501082_0004705 3300060353 Bacteria 11905
195 Ga0530510_0022980 3300061734 Bacteria 4443
196 2506865288 2506783011 Bacteria 5323186
197 2508672222 2508501039 Bacteria 9978592
198 2517760813 2517572101 Bacteria 6884336
199 2528202712 2527291627 Bacteria 5309833
200 2528212617 2527291629 Bacteria 5267418
201 2546947462 2546825537 Bacteria 5389291
202 2579748490 2576861822 Bacteria 5004595
203 2579852649 2579778521 Bacteria 7624758
204 2619853551 2619618881 Bacteria 7521104
205 2620348668 2619619003 Bacteria 7619552
206 2623586489 2622736626 Bacteria 7181580
207 2626635522 2626541554 Bacteria 7741902
208 2643732232 2643221542 Bacteria 3563959
209 2643752970 2643221546 Bacteria 2910897
210 2643769817 2643221549 Bacteria 4042819
211 2643786647 2643221553 Bacteria 3544260
212 2643852545 2643221567 Bacteria 4163945
213 2644114471 2643221619 Bacteria 4158469
214 2644137069 2643221624 Bacteria 4384879
215 2644171050 2643221630 Bacteria 3601215
216 2644681327 2643221724 Bacteria 3593515
217 2671837362 2671180195 Bacteria 9757215
218 2676198386 2675902999 Bacteria 9438463
219 2686533812 2684623035 Bacteria 8032739
220 2686541420 2684623036 Bacteria 5199090
221 2689961225 2687453737 Bacteria 11203906
222 2689995249 2687453743 Bacteria 8361025
223 2710602441 2710264753 Bacteria 5455564
224 2723641421 2721755702 Bacteria 4373124
225 2730230239 2728369380 Bacteria 3620317
226 2747951699 2747842429 Bacteria 3914386
227 2774842964 2773857921 Bacteria 9435764
228 2774855518 2773857922 Bacteria 9757215
229 2774864054 2773857924 Bacteria 5256821
230 2774901383 2773857933 Bacteria 5818019
231 2808875591 2808606365 Bacteria 4301966
232 2808901365 2808606372 Bacteria 4649509
233 2831940390 2831935698 Bacteria 5963223
234 2833711504 2833709550 Bacteria 4008291
235 2852664422 2852663356 Bacteria 4090475
236 2857722217 2857720070 Bacteria 3189373
237 2857724935 2857723135 Bacteria 4217853
238 2858908755 2858902515 Bacteria 7086037
239 2867509375 2867507094 Bacteria 6506033
240 2895886397 2895880812 Bacteria 11255272
241 2919446938 2919443155 Bacteria 4072969
242 2919447992 2919446982 Bacteria 3994487
243 2928091669 2928090899 Bacteria 3158267
244 2935410844 2935409751 Bacteria 4179611
245 2946044908 2946041624 Bacteria 4191385
246 2946084483 2946080515 Bacteria 4310960
247 2984581578 2984580707 Bacteria 3351387
248 637881285 637000116 Bacteria 5433628
249 8002781994 8002775197 Bacteria 10728764
250 8002792080 8002784119 Bacteria 9788632
251 8003861748 8003856774 Bacteria 7675274
252 8004185773 8004182704 Bacteria 3391155
253 8054915361 8054913762 Bacteria 7713009
254 8054923296 8054920844 Bacteria 7068637
255 8055158807 8055157932 Bacteria 6429399
256 Ga0068859_100000014
257 Ga0070658_10017928
258 Ga0070683_100070773
259 Ga0070680_100110721
260 Ga0070682_100135394
261 Ga0070668_100066862
262 Ga0070675_100231802
263 Ga0070713_100492589
264 Ga0070681_10222956
265 Ga0070679_100165969
266 Ga0070684_100161581
267 Ga0070664_100189336
268 Ga0068859_100003541
269 Ga0068861_100094659
270 Ga0068870_10035874
271 Ga0068863_100001496
272 Ga0068863_100295115
273 Ga0068858_100000689
274 Ga0068858_100005736
275 Ga0068862_100002847
276 Ga0068862_100156063
277 Ga0081540_1003366
278 Ga0070717_10149607
279 Ga0075364_10083322
280 Ga0075364_10144840
281 Ga0075364_10183606
282 Ga0075428_100000146
283 Ga0075431_100013729
284 Ga0075431_100109319
285 Ga0097620_100000014
286 Ga0097620_100003541
287 Ga0105251_10037219
288 Ga0111539_10621602
289 Ga0105247_10000020
290 Ga0105247_10003945
291 Ga0105243_10120769
292 Ga0105243_10258200
293 Ga0105248_10000076
294 Ga0105248_10000488
295 Ga0105249_10009442
296 Ga0105239_10374037
297 Ga0157369_10034251
298 Ga0163162_10336640
299 Ga0157375_10076534
300 Ga0163163_10022580
301 Ga0163163_10030379
302 Ga0163163_10069565
303 Ga0157380_10208495
304 Ga0157379_10002107
305 Ga0157379_10005279
306 Ga0206353_11218005
307 Ga0206353_11316805
308 Ga0209646_1000224
309 Ga0207710_10000011
310 Ga0207710_10000019
311 Ga0207643_10067702
312 Ga0207707_10510246
313 Ga0207660_10110526
314 Ga0207644_10187244
315 Ga0207665_10063268
316 Ga0207711_10000604
317 Ga0207711_10024656
318 Ga0207661_10034026
319 Ga0207712_10069910
320 Ga0207668_10168320
321 Ga0207703_10000013
322 Ga0207703_10056047
323 Ga0207641_10008636
324 Ga0207641_10018860
325 Ga0207676_10149795
326 Ga0207674_10112967
327 Ga0207675_100106371
328 Ga0268265_10000015
329 Ga0316576_10010964
330 Ga0316576_10181952
331 Ga0316578_10001378
332 Ga0307413_10221731
333 Ga0307518_10044907
334 Ga0307410_10000845
335 Ga0307406_10000172
336 Ga0307406_10000624
337 Ga0307412_10269015
338 Ga0307409_100564541
339 Ga0307416_100005764
340 Ga0307416_100222794
341 Ga0307416_100236566
342 Ga0307415_100142954
343 Ga0316585_10016685
344 Ga0316593_10072084
345 Ga0316574_0012961
346 Ga0316574_0019756
347 Ga0316574_0129038
348 Ga0316582_0014958
349 Ga0316584_0015922
350 Ga0395899_0153185
351 Ga0395900_0051653
352 Ga0395898_0066713
353 Ga0395898_0475599
354 Ga0395901_0011323
355 Ga0395901_0028948
356 Ga0439465_0029153
357 Ga0451833_1092040
358 Ga0451837_1663350
359 Ga0451843_0319031
360 Ga0439442_015855
361 Ga0439449_0088475
362 Ga0466960_0247956
363 Ga0495627_000580
364 Ga0495638_0069765
365 Ga0495594_0015598
366 Ga0495644_0089570
367 Ga0495656_0058124
368 Ga0495668_0109748
369 Ga0495672_0099882
370 Ga0496104_0030045
371 Ga0496104_0108064
372 Ga0496104_0187909
373 Ga0496105_0148186
374 Ga0496105_0153701
375 Ga0496107_0242934
376 Ga0496108_0116270
377 Ga0496109_0285104
378 Ga0496110_0054061
379 Ga0496111_0042121
380 Ga0496112_0014535
381 Ga0496112_0018173
382 Ga0496112_0259911
383 Ga0496113_0132387
384 Ga0496114_0117983
385 Ga0496116_0000134
386 Ga0496117_0001847
387 Ga0496117_0009198
388 Ga0496117_0063733
389 Ga0496118_0000431
390 Ga0496118_0006195
391 Ga0496118_0037138
392 Ga0496119_0000714
393 Ga0496119_0007050
394 Ga0496120_0000132
395 Ga0496121_0047397
396 Ga0496121_0059997
397 Ga0496121_0142348
398 Ga0496122_0016503
399 Ga0496122_0037494
400 Ga0496125_0011355
401 Ga0496125_0011542
402 Ga0496125_0028697
403 Ga0496125_0053909
404 Ga0496126_0018596
405 Ga0496126_0069293
406 Ga0496126_0128942
407 Ga0496126_0167334
408 Ga0501031_0001784
409 Ga0501032_0050601
410 Ga0501033_0010935
411 Ga0501033_0024838
412 Ga0501034_0015373
413 Ga0501034_0112059
414 Ga0501034_0118737
415 Ga0501036_0033339
416 Ga0501037_0012492
417 Ga0501038_0008358
418 Ga0501039_0006462
419 Ga0501040_0011409
420 Ga0501041_0001798
421 Ga0501042_0168491
422 Ga0501042_0174831
423 Ga0501043_0009071
424 Ga0501046_0005793
425 Ga0501046_0092150
426 Ga0501047_0037382
427 Ga0501048_0003193
428 Ga0501067_0047746
429 Ga0501068_0018863
430 Ga0501070_0028209
431 Ga0501071_0001497
432 Ga0501072_0004826
433 Ga0501074_0023206
434 Ga0501075_0001813
435 Ga0501076_0002216
436 Ga0501079_0012048
437 Ga0501080_0155797
438 Ga0501081_0001537
439 Ga0501035_0041063
440 Ga0501044_0006440
441 Ga0501045_0004655
442 Ga0501045_0139086
443 nmdc:mga00v17_47270_c1
444 nmdc:mga00v17_93943_c1
445 nmdc:mga07m45_87441_c1
446 nmdc:mga06r32_511749_c1
447 nmdc:mga06r32_6728_c1
448 Ga0501084_0017309
449 Ga0501082_0004705
450 Ga0530510_0022980
451 2506865288
452 2508672222
453 2517760813
454 2528202712
455 2528212617
456 2546947462
457 2579748490
458 2579852649
459 2619853551
460 2620348668
461 2623586489
462 2626635522
463 2643732232
464 2643752970
465 2643769817
466 2643786647
467 2643852545
468 2644114471
469 2644137069
470 2644171050
471 2644681327
472 2671837362
473 2676198386
474 2686533812
475 2686541420
476 2689961225
477 2689995249
478 2710602441
479 2723641421
480 2730230239
481 2747951699
482 2774842964
483 2774855518
484 2774864054
485 2774901383
486 2808875591
487 2808901365
488 2831940390
489 2833711504
490 2852664422
491 2857722217
492 2857724935
493 2858908755
494 2867509375
495 2895886397
496 2919446938
497 2919447992
498 2928091669
499 2935410844
500 2946044908
501 2946084483
502 2984581578
503 637881285
504 8002781994
505 8002792080
506 8003861748
507 8004185773
508 8054915361
509 8054923296
510 8055158807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

156

235

0.93

PF08544

GHMP_kinases_C

GHMP kinases C terminal

291

368

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.9634 17 298
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.9492 18 298
3pyf-assembly1.cif.gz_A mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp 0.9278 19 298
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.9097 17 298
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.8932 18 298
ID Description Score Start End Superfamily
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9729 18 176 3.30.230.10
4emdA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;GHMP kinase, C-terminal domain 0.9248 181 296 3.30.70.890
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9218 18 176 3.30.230.10
af_Q8S2G0_72_245_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9123 13 174 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9028 19 173 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A7Y5P5W9-F1-model_v4 deleted 0.9735 18 176
AF-A0A7C5ACQ6-F1-model_v4 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) 0.9568 18 173 GO:0005524
GO:0016114
GO:0050515
AF-A0A7Y5P5W9-F1-model_v4 deleted 0.9558 18 176
AF-X8EZG6-F1-model_v4 deleted 0.95 14 255
AF-A0A4Q7YB47-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9495 17 298 GO:0005524
GO:0016114
GO:0019288
GO:0050515

Map