F365489

General Info

Members Datasets Scaffolds Average Seq Length
255 153 510 203

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10279053|Ga0070710_102790532
Length 222
Sequence MSNMKRDIVTSAIGIVVLTLLLGILFPLLVTGISQVAFPGNANGQRVDANGRLVGSKIIGQQFATQVVKNGKPVVDKDGNPVTKPDPRYFQSRPSPTVPPYNAGASTFSNLGPNDVATEQSIAGYLKAYLALEKPYDPSLTVSKVPVDAVNTTGSGVDPDISVANADIQAHRIAAVRHLPMPQVMTLISDNTLGRGLGFSGEPGVDVLDLNLALDKLTGANR

Samples

Sample ID Description Type Environment
1 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
66 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
95 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
114 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
132 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 14.9
Rhizosphere 71.76
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070710_10279053 3300005437 Bacteria 1083
2 Ga0070690_100308584 3300005330 Bacteria 1137
3 Ga0070666_10057850 3300005335 Bacteria 2621
4 Ga0070689_100471138 3300005340 Bacteria 1071
5 Ga0070668_100024689 3300005347 Bacteria 4555
6 Ga0070668_100405238 3300005347 Bacteria 1165
7 Ga0070674_100000002 3300005356 Bacteria 271088
8 Ga0070674_101054080 3300005356 Bacteria 716
9 Ga0070667_100001291 3300005367 Bacteria 22638
10 Ga0070709_10546848 3300005434 Bacteria 885
11 Ga0070714_100079324 3300005435 Bacteria 2854
12 Ga0070714_100275343 3300005435 Bacteria 1562
13 Ga0070714_100474587 3300005435 Bacteria 1190
14 Ga0070713_100830405 3300005436 Bacteria 887
15 Ga0070710_10036886 3300005437 Bacteria 2675
16 Ga0070710_10395448 3300005437 Bacteria 925
17 Ga0070711_100054714 3300005439 Bacteria 2754
18 Ga0070711_100079227 3300005439 Bacteria 2336
19 Ga0070711_100085011 3300005439 Bacteria 2265
20 Ga0070681_10126551 3300005458 Bacteria 2487
21 Ga0070707_100970934 3300005468 Bacteria 815
22 Ga0070679_100064892 3300005530 Bacteria 3640
23 Ga0068856_100383004 3300005614 Bacteria 1426
24 Ga0068856_100580731 3300005614 Bacteria 1142
25 Ga0068866_10000206 3300005718 Bacteria 27716
26 Ga0068858_100033608 3300005842 Bacteria 4757
27 Ga0068860_100102176 3300005843 Bacteria 2735
28 Ga0068862_100001084 3300005844 Bacteria 25961
29 Ga0081455_10003977 3300005937 Bacteria 16770
30 Ga0081455_10007601 3300005937 Bacteria 11393
31 Ga0081540_1002925 3300005983 Bacteria 13749
32 Ga0081539_10017992 3300005985 Bacteria 4929
33 Ga0070717_10020585 3300006028 Bacteria 5191
34 Ga0070717_10049081 3300006028 Bacteria 3464
35 Ga0070717_10244822 3300006028 Bacteria 1582
36 Ga0070715_10065413 3300006163 Bacteria 1609
37 Ga0070715_10135569 3300006163 Bacteria 1190
38 Ga0070716_100062140 3300006173 Bacteria 2164
39 Ga0070712_100031585 3300006175 Bacteria 3569
40 Ga0070712_100036571 3300006175 Bacteria 3342
41 Ga0070712_100061945 3300006175 Bacteria 2644
42 Ga0070712_100453041 3300006175 Bacteria 1069
43 Ga0097621_100661748 3300006237 Unclassified 959
44 Ga0075431_100003346 3300006847 Bacteria 15538
45 Ga0075433_10192715 3300006852 Bacteria 1813
46 Ga0075434_100001312 3300006871 Bacteria 20750
47 Ga0075434_101251057 3300006871 Bacteria 754
48 Ga0075436_100675629 3300006914 Bacteria 764
49 Ga0111539_10030107 3300009094 Bacteria 6601
50 Ga0111539_10058462 3300009094 Bacteria 4575
51 Ga0111539_10316298 3300009094 Bacteria 1817
52 Ga0105245_10007881 3300009098 Bacteria 9316
53 Ga0105245_10568920 3300009098 Bacteria 1157
54 Ga0114129_10081698 3300009147 Bacteria 4492
55 Ga0105243_10265661 3300009148 Bacteria 1538
56 Ga0105243_10899639 3300009148 Bacteria 880
57 Ga0105242_10039881 3300009176 Bacteria 3782
58 Ga0105242_10250436 3300009176 Bacteria 1596
59 Ga0105249_10000074 3300009553 Bacteria 145235
60 Ga0105249_10583622 3300009553 Bacteria 1171
61 Ga0105239_10556272 3300010375 Bacteria 1307
62 Ga0105239_11338346 3300010375 Bacteria 826
63 Ga0105246_10135420 3300011119 Bacteria 1845
64 Ga0157375_10115778 3300013308 Bacteria 2784
65 Ga0157376_10129251 3300014969 Bacteria 2251
66 Ga0213874_10035423 3300021377 Bacteria 1466
67 Ga0213875_10015263 3300021388 Bacteria 3739
68 Ga0213875_10021260 3300021388 Bacteria 3109
69 Ga0213875_10029455 3300021388 Bacteria 2604
70 Ga0207642_10000473 3300025899 Bacteria 12319
71 Ga0207680_10075201 3300025903 Bacteria 2106
72 Ga0207685_10048059 3300025905 Bacteria 1632
73 Ga0207685_10060874 3300025905 Bacteria 1495
74 Ga0207699_10044894 3300025906 Bacteria 2575
75 Ga0207707_10141977 3300025912 Bacteria 2099
76 Ga0207693_10010548 3300025915 Bacteria 7498
77 Ga0207693_10014164 3300025915 Bacteria 6422
78 Ga0207693_10046617 3300025915 Bacteria 3405
79 Ga0207693_10055979 3300025915 Bacteria 3092
80 Ga0207663_10032779 3300025916 Bacteria 3087
81 Ga0207663_10106488 3300025916 Bacteria 1895
82 Ga0207652_10002532 3300025921 Bacteria 15343
83 Ga0207700_10153790 3300025928 Bacteria 1904
84 Ga0207664_10034419 3300025929 Bacteria 3902
85 Ga0207664_10049134 3300025929 Bacteria 3320
86 Ga0207664_10193128 3300025929 Bacteria 1753
87 Ga0207664_10369963 3300025929 Bacteria 1271
88 Ga0207686_10019586 3300025934 Bacteria 3852
89 Ga0207709_10180726 3300025935 Bacteria 1489
90 Ga0207709_10199348 3300025935 Bacteria 1428
91 Ga0207670_10371824 3300025936 Bacteria 1136
92 Ga0207669_10000003 3300025937 Bacteria 252239
93 Ga0207665_10030367 3300025939 Bacteria 3570
94 Ga0207712_10007569 3300025961 Bacteria 6862
95 Ga0207668_10012136 3300025972 Bacteria 5265
96 Ga0207658_10004218 3300025986 Bacteria 10010
97 Ga0207702_10729127 3300026078 Bacteria 978
98 Ga0207428_10122719 3300027907 Bacteria 1991
99 Ga0268265_10005242 3300028380 Bacteria 8869
100 Ga0373924_0210272 3300035410 Bacteria 859
101 Ga0373935_0396733 3300035692 Bacteria 990
102 Ga0373937_0033790 3300036401 Bacteria 4648
103 Ga0395900_0025800 3300037418 Bacteria 6015
104 Ga0395905_0443627 3300037471 Bacteria 1195
105 Ga0436364_0156576 3300037853 Bacteria 27121
106 Ga0436364_0163739 3300037853 Bacteria 4417
107 Ga0436364_0442118 3300037853 Bacteria 1566
108 Ga0436364_0488398 3300037853 Bacteria 13678
109 Ga0436364_0751902 3300037853 Bacteria 3245
110 Ga0436364_0832221 3300037853 Bacteria 4450
111 Ga0436364_1172377 3300037853 Bacteria 1849
112 Ga0395901_0006764 3300038443 Bacteria 11581
113 Ga0436365_0142551 3300039437 Bacteria 55439
114 Ga0436365_0209888 3300039437 Bacteria 1786
115 Ga0436365_0900707 3300039437 Bacteria 10377
116 Ga0436365_1545102 3300039437 Bacteria 2557
117 Ga0436365_1847892 3300039437 Bacteria 7831
118 Ga0436360_0110832 3300039438 Bacteria 11423
119 Ga0436363_0770936 3300039450 Bacteria 1854
120 Ga0436363_1292825 3300039450 Bacteria 3013
121 Ga0436362_0491641 3300039453 Bacteria 2052
122 Ga0466969_0005851 3300044656 Bacteria 6537
123 Ga0466966_0092711 3300044684 Bacteria 1874
124 Ga0466963_0315028 3300044694 Bacteria 1101
125 Ga0466963_0639643 3300044694 Bacteria 751
126 Ga0466971_0020985 3300044719 Bacteria 2904
127 Ga0466970_0033885 3300044765 Bacteria 2701
128 Ga0466970_0036059 3300044765 Bacteria 2619
129 Ga0466957_0111937 3300044842 Bacteria 1732
130 Ga0466957_0225330 3300044842 Bacteria 1239
131 Ga0466957_0231615 3300044842 Bacteria 1223
132 Ga0466957_0317977 3300044842 Bacteria 1050
133 Ga0466959_0002158 3300045049 Bacteria 12497
134 Ga0466959_0113181 3300045049 Bacteria 1935
135 Ga0466958_0006897 3300045836 Bacteria 6210
136 Ga0466958_0158808 3300045836 Bacteria 1428
137 Ga0466958_0666385 3300045836 Bacteria 677
138 Ga0466967_0243141 3300045976 Bacteria 1717
139 Ga0466967_0290306 3300045976 Bacteria 1571
140 Ga0466967_0482352 3300045976 Bacteria 1215
141 Ga0495592_0042866 3300046454 Bacteria 3388
142 Ga0495629_0003687 3300046459 Bacteria 11581
143 Ga0495651_0000497 3300046462 Bacteria 30480
144 Ga0495651_0011283 3300046462 Bacteria 6869
145 Ga0495653_0231523 3300046463 Bacteria 1236
146 Ga0495582_0480552 3300046473 Unclassified 718
147 Ga0495662_0339303 3300046476 Bacteria 739
148 Ga0495664_0129332 3300046477 Bacteria 1529
149 Ga0495664_0287087 3300046477 Bacteria 994
150 Ga0495608_0000564 3300046511 Bacteria 25451
151 Ga0495608_0145827 3300046511 Bacteria 1510
152 Ga0495618_0004835 3300046514 Bacteria 8230
153 Ga0495628_0132849 3300046516 Bacteria 1903
154 Ga0495652_0169713 3300046529 Bacteria 1685
155 Ga0495640_0017367 3300046533 Bacteria 5365
156 Ga0495640_0024535 3300046533 Bacteria 4386
157 Ga0495586_0093053 3300046535 Bacteria 1667
158 Ga0495587_0043258 3300046536 Bacteria 2682
159 Ga0495587_0079701 3300046536 Bacteria 1898
160 Ga0495667_0003786 3300046559 Bacteria 10157
161 Ga0495634_0191838 3300046642 Bacteria 1274
162 Ga0495635_0013691 3300046663 Bacteria 5675
163 Ga0495657_0011366 3300046675 Bacteria 6660
164 Ga0495657_0034891 3300046675 Bacteria 3491
165 Ga0495623_0157749 3300046679 Bacteria 1336
166 Ga0495646_0004891 3300046680 Bacteria 8465
167 Ga0495658_0078560 3300046683 Bacteria 1932
168 Ga0495613_0002212 3300046689 Bacteria 14729
169 Ga0495613_0089371 3300046689 Bacteria 2232
170 Ga0495613_0504308 3300046689 Bacteria 814
171 Ga0495581_0284801 3300047315 Unclassified 966
172 Ga0495604_0010934 3300047317 Bacteria 7205
173 Ga0495674_0016140 3300047319 Bacteria 6970
174 Ga0495674_0090401 3300047319 Bacteria 2616
175 Ga0495672_0091548 3300047320 Bacteria 1669
176 Ga0495680_0056685 3300047322 Bacteria 3032
177 Ga0495680_0165665 3300047322 Bacteria 1603
178 Ga0495675_0132283 3300047444 Bacteria 1550
179 Ga0495593_0233225 3300047673 Bacteria 923
180 Ga0495602_0018171 3300048088 Bacteria 7032
181 Ga0495602_0563158 3300048088 Bacteria 788
182 Ga0496100_0068930 3300048903 Bacteria 2354
183 Ga0496100_0144096 3300048903 Bacteria 1692
184 Ga0496100_1213008 3300048903 Bacteria 595
185 Ga0496101_0080029 3300048904 Bacteria 2413
186 Ga0496101_0189694 3300048904 Bacteria 1586
187 Ga0496102_0136394 3300048905 Bacteria 2299
188 Ga0496102_0172484 3300048905 Bacteria 2036
189 Ga0496102_1105376 3300048905 Bacteria 712
190 Ga0496103_0057371 3300048906 Bacteria 2418
191 Ga0496103_0080621 3300048906 Bacteria 2046
192 Ga0496104_0013435 3300048907 Bacteria 7378
193 Ga0496104_0020732 3300048907 Bacteria 6028
194 Ga0496104_0039640 3300048907 Bacteria 4411
195 Ga0496104_0048915 3300048907 Bacteria 3987
196 Ga0496104_0051205 3300048907 Bacteria 3897
197 Ga0496105_0002286 3300048908 Bacteria 13892
198 Ga0496105_0020919 3300048908 Bacteria 5291
199 Ga0496105_0461434 3300048908 Bacteria 1001
200 Ga0496105_0671838 3300048908 Bacteria 797
201 Ga0496106_0000286 3300048909 Bacteria 35738
202 Ga0496106_0004465 3300048909 Bacteria 10373
203 Ga0496107_0028400 3300048910 Bacteria 3975
204 Ga0496107_0028489 3300048910 Bacteria 3969
205 Ga0496108_0178426 3300048911 Bacteria 1839
206 Ga0496109_0069474 3300048912 Bacteria 3230
207 Ga0496109_0363183 3300048912 Bacteria 1368
208 Ga0496110_0012407 3300048913 Bacteria 7006
209 Ga0496110_0227388 3300048913 Bacteria 1696
210 Ga0496110_0261906 3300048913 Bacteria 1574
211 Ga0496111_0055436 3300048914 Bacteria 2866
212 Ga0496111_0069202 3300048914 Bacteria 2566
213 Ga0496112_0003997 3300048915 Bacteria 12361
214 Ga0496112_0059470 3300048915 Bacteria 3766
215 Ga0496113_0054026 3300048916 Bacteria 3005
216 Ga0496113_0568106 3300048916 Bacteria 909
217 Ga0496114_0000811 3300048917 Bacteria 23428
218 Ga0496114_0178658 3300048917 Bacteria 1853
219 Ga0496115_0024916 3300048918 Bacteria 4653
220 Ga0496116_0000598 3300048919 Bacteria 47884
221 Ga0496117_0003161 3300048920 Bacteria 19587
222 Ga0496118_0009857 3300048921 Bacteria 9556
223 Ga0496118_0074717 3300048921 Bacteria 2421
224 Ga0496118_0250994 3300048921 Bacteria 1005
225 Ga0496119_0000489 3300048922 Bacteria 54129
226 Ga0496119_0004750 3300048922 Bacteria 13350
227 Ga0496119_0005849 3300048922 Bacteria 11614
228 Ga0496119_0045282 3300048922 Bacteria 2760
229 Ga0496120_0004628 3300048923 Bacteria 11399
230 Ga0496121_0074027 3300048924 Bacteria 2726
231 Ga0496121_0169130 3300048924 Bacteria 1590
232 Ga0496125_0014283 3300048928 Bacteria 7740
233 Ga0496125_0044228 3300048928 Bacteria 3769
234 Ga0496126_0020299 3300048929 Bacteria 6519
235 Ga0501047_0074200 3300049581 Bacteria 3275
236 Ga0501074_0024592 3300049590 Bacteria 4377
237 Ga0501083_0043009 3300049744 Bacteria 3061
238 Ga0501044_0220551 3300049823 Bacteria 1847
239 nmdc:mga0yw44_520361_c1 3300050492 Bacteria 807
240 nmdc:mga05p37_204369_c1 3300050507 Bacteria 2390
241 nmdc:mga06r32_3479_c1 3300050510 Bacteria 14061
242 nmdc:mga08y16_162887_c1 3300050511 Bacteria 2317
243 nmdc:mga08y16_167759_c1 3300050511 Bacteria 2281
244 nmdc:mga08y16_22628_c1 3300050511 Bacteria 6635
245 nmdc:mga08y16_38251_c1 3300050511 Bacteria 5039
246 nmdc:mga0n895_1855_c1 3300050512 Bacteria 16124
247 nmdc:mga0n895_667268_c1 3300050512 Bacteria 1037
248 nmdc:mga0a205_166340_c1 3300050515 Bacteria 1250
249 nmdc:mga0a205_261002_c1 3300050515 Bacteria 1610
250 Ga0495601_0002185 3300053077 Bacteria 11008
251 Ga0495612_0111012 3300053078 Bacteria 1174
252 Ga0495619_0117391 3300053085 Bacteria 1822
253 Ga0501082_0132459 3300060353 Bacteria 2163
254 Ga0466962_0009351 3300061719 Bacteria 4696
255 Ga0466962_0124563 3300061719 Bacteria 1244
256 Ga0070710_10279053
257 Ga0070690_100308584
258 Ga0070666_10057850
259 Ga0070689_100471138
260 Ga0070668_100024689
261 Ga0070668_100405238
262 Ga0070674_100000002
263 Ga0070674_101054080
264 Ga0070667_100001291
265 Ga0070709_10546848
266 Ga0070714_100079324
267 Ga0070714_100275343
268 Ga0070714_100474587
269 Ga0070713_100830405
270 Ga0070710_10036886
271 Ga0070710_10395448
272 Ga0070711_100054714
273 Ga0070711_100079227
274 Ga0070711_100085011
275 Ga0070681_10126551
276 Ga0070707_100970934
277 Ga0070679_100064892
278 Ga0068856_100383004
279 Ga0068856_100580731
280 Ga0068866_10000206
281 Ga0068858_100033608
282 Ga0068860_100102176
283 Ga0068862_100001084
284 Ga0081455_10003977
285 Ga0081455_10007601
286 Ga0081540_1002925
287 Ga0081539_10017992
288 Ga0070717_10020585
289 Ga0070717_10049081
290 Ga0070717_10244822
291 Ga0070715_10065413
292 Ga0070715_10135569
293 Ga0070716_100062140
294 Ga0070712_100031585
295 Ga0070712_100036571
296 Ga0070712_100061945
297 Ga0070712_100453041
298 Ga0097621_100661748
299 Ga0075431_100003346
300 Ga0075433_10192715
301 Ga0075434_100001312
302 Ga0075434_101251057
303 Ga0075436_100675629
304 Ga0111539_10030107
305 Ga0111539_10058462
306 Ga0111539_10316298
307 Ga0105245_10007881
308 Ga0105245_10568920
309 Ga0114129_10081698
310 Ga0105243_10265661
311 Ga0105243_10899639
312 Ga0105242_10039881
313 Ga0105242_10250436
314 Ga0105249_10000074
315 Ga0105249_10583622
316 Ga0105239_10556272
317 Ga0105239_11338346
318 Ga0105246_10135420
319 Ga0157375_10115778
320 Ga0157376_10129251
321 Ga0213874_10035423
322 Ga0213875_10015263
323 Ga0213875_10021260
324 Ga0213875_10029455
325 Ga0207642_10000473
326 Ga0207680_10075201
327 Ga0207685_10048059
328 Ga0207685_10060874
329 Ga0207699_10044894
330 Ga0207707_10141977
331 Ga0207693_10010548
332 Ga0207693_10014164
333 Ga0207693_10046617
334 Ga0207693_10055979
335 Ga0207663_10032779
336 Ga0207663_10106488
337 Ga0207652_10002532
338 Ga0207700_10153790
339 Ga0207664_10034419
340 Ga0207664_10049134
341 Ga0207664_10193128
342 Ga0207664_10369963
343 Ga0207686_10019586
344 Ga0207709_10180726
345 Ga0207709_10199348
346 Ga0207670_10371824
347 Ga0207669_10000003
348 Ga0207665_10030367
349 Ga0207712_10007569
350 Ga0207668_10012136
351 Ga0207658_10004218
352 Ga0207702_10729127
353 Ga0207428_10122719
354 Ga0268265_10005242
355 Ga0373924_0210272
356 Ga0373935_0396733
357 Ga0373937_0033790
358 Ga0395900_0025800
359 Ga0395905_0443627
360 Ga0436364_0156576
361 Ga0436364_0163739
362 Ga0436364_0442118
363 Ga0436364_0488398
364 Ga0436364_0751902
365 Ga0436364_0832221
366 Ga0436364_1172377
367 Ga0395901_0006764
368 Ga0436365_0142551
369 Ga0436365_0209888
370 Ga0436365_0900707
371 Ga0436365_1545102
372 Ga0436365_1847892
373 Ga0436360_0110832
374 Ga0436363_0770936
375 Ga0436363_1292825
376 Ga0436362_0491641
377 Ga0466969_0005851
378 Ga0466966_0092711
379 Ga0466963_0315028
380 Ga0466963_0639643
381 Ga0466971_0020985
382 Ga0466970_0033885
383 Ga0466970_0036059
384 Ga0466957_0111937
385 Ga0466957_0225330
386 Ga0466957_0231615
387 Ga0466957_0317977
388 Ga0466959_0002158
389 Ga0466959_0113181
390 Ga0466958_0006897
391 Ga0466958_0158808
392 Ga0466958_0666385
393 Ga0466967_0243141
394 Ga0466967_0290306
395 Ga0466967_0482352
396 Ga0495592_0042866
397 Ga0495629_0003687
398 Ga0495651_0000497
399 Ga0495651_0011283
400 Ga0495653_0231523
401 Ga0495582_0480552
402 Ga0495662_0339303
403 Ga0495664_0129332
404 Ga0495664_0287087
405 Ga0495608_0000564
406 Ga0495608_0145827
407 Ga0495618_0004835
408 Ga0495628_0132849
409 Ga0495652_0169713
410 Ga0495640_0017367
411 Ga0495640_0024535
412 Ga0495586_0093053
413 Ga0495587_0043258
414 Ga0495587_0079701
415 Ga0495667_0003786
416 Ga0495634_0191838
417 Ga0495635_0013691
418 Ga0495657_0011366
419 Ga0495657_0034891
420 Ga0495623_0157749
421 Ga0495646_0004891
422 Ga0495658_0078560
423 Ga0495613_0002212
424 Ga0495613_0089371
425 Ga0495613_0504308
426 Ga0495581_0284801
427 Ga0495604_0010934
428 Ga0495674_0016140
429 Ga0495674_0090401
430 Ga0495672_0091548
431 Ga0495680_0056685
432 Ga0495680_0165665
433 Ga0495675_0132283
434 Ga0495593_0233225
435 Ga0495602_0018171
436 Ga0495602_0563158
437 Ga0496100_0068930
438 Ga0496100_0144096
439 Ga0496100_1213008
440 Ga0496101_0080029
441 Ga0496101_0189694
442 Ga0496102_0136394
443 Ga0496102_0172484
444 Ga0496102_1105376
445 Ga0496103_0057371
446 Ga0496103_0080621
447 Ga0496104_0013435
448 Ga0496104_0020732
449 Ga0496104_0039640
450 Ga0496104_0048915
451 Ga0496104_0051205
452 Ga0496105_0002286
453 Ga0496105_0020919
454 Ga0496105_0461434
455 Ga0496105_0671838
456 Ga0496106_0000286
457 Ga0496106_0004465
458 Ga0496107_0028400
459 Ga0496107_0028489
460 Ga0496108_0178426
461 Ga0496109_0069474
462 Ga0496109_0363183
463 Ga0496110_0012407
464 Ga0496110_0227388
465 Ga0496110_0261906
466 Ga0496111_0055436
467 Ga0496111_0069202
468 Ga0496112_0003997
469 Ga0496112_0059470
470 Ga0496113_0054026
471 Ga0496113_0568106
472 Ga0496114_0000811
473 Ga0496114_0178658
474 Ga0496115_0024916
475 Ga0496116_0000598
476 Ga0496117_0003161
477 Ga0496118_0009857
478 Ga0496118_0074717
479 Ga0496118_0250994
480 Ga0496119_0000489
481 Ga0496119_0004750
482 Ga0496119_0005849
483 Ga0496119_0045282
484 Ga0496120_0004628
485 Ga0496121_0074027
486 Ga0496121_0169130
487 Ga0496125_0014283
488 Ga0496125_0044228
489 Ga0496126_0020299
490 Ga0501047_0074200
491 Ga0501074_0024592
492 Ga0501083_0043009
493 Ga0501044_0220551
494 nmdc:mga0yw44_520361_c1
495 nmdc:mga05p37_204369_c1
496 nmdc:mga06r32_3479_c1
497 nmdc:mga08y16_162887_c1
498 nmdc:mga08y16_167759_c1
499 nmdc:mga08y16_22628_c1
500 nmdc:mga08y16_38251_c1
501 nmdc:mga0n895_1855_c1
502 nmdc:mga0n895_667268_c1
503 nmdc:mga0a205_166340_c1
504 nmdc:mga0a205_261002_c1
505 Ga0495601_0002185
506 Ga0495612_0111012
507 Ga0495619_0117391
508 Ga0501082_0132459
509 Ga0466962_0009351
510 Ga0466962_0124563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

8

216

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7785 7 208
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7668 1 208
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7555 1 208
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7485 7 208
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.5366 150 205
ID Description Score Start End Superfamily
af_P18961_112_329_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6393 172 198 3.40.30.10
af_Q2M2S1_263_336_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.6088 151 207 1.10.8.60
5i41B00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.5051 161 208 1.10.1660.10
af_Q2M2S1_263_336_1.10.8.60 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.5031 151 207 1.10.8.60
4oo1I01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.4552 43 78 2.40.50.880
ID Description Score Start End GO Terms
AF-A0A2S9FLH2-F1-model_v4 Potassium-transporting ATPase subunit C 0.9257 135 208 GO:0005524
GO:0005886
GO:0008556
AF-A0A3Q9K6A7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9247 96 208 GO:0005524
GO:0005886
GO:0008556
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9184 131 208 GO:0005524
GO:0005886
GO:0008556
AF-A0A1V4DX91-F1-model_v4 K+-transporting ATPase subunit C 0.9168 136 208 GO:0005524
GO:0005886
GO:0008556
AF-A0A7K2VFX8-F1-model_v4 Potassium-transporting ATPase subunit C 0.9157 131 208 GO:0005524
GO:0005886
GO:0008556

Map