F365463

General Info

Members Datasets Scaffolds Average Seq Length
255 164 510 267

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100236967|Ga0070671_1002369672
Length 283
Sequence MRHSPGARAGHSPKLPVTGGSLGELLPSGVLAGFVAGMLGVGGGIVTVPVLEYSLRFAGVPEEYRMHVAVATSLAAIIPTSISSARTHHSKGAVDWQLAKSWGVAVVLGAAAGSLLASHAPQSVLAAVFGSVALLIAAKMLLPLDHLRVAHDVPRGVGGALLGGVIGGVSAMMGIGGGTLTVPTLNLCGYPIHRAVGTAAFFGIFISIPGTLGYLLARPAAPLPWATVGFVSLVGLAVIAPGSMLTANLGARVAHRLSRRRLSQAFGLFLLIVGARMVYRALA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
136 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
137 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.35
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100236967 3300005355 Bacteria 1549
2 rootL2_10036981 3300003322 Bacteria 2181
3 rootL2_10036982 3300003322 Bacteria 2417
4 Ga0070676_10158491 3300005328 Bacteria 1455
5 Ga0070690_100071113 3300005330 Unclassified 2260
6 Ga0070670_100534308 3300005331 Bacteria 1045
7 Ga0068869_100049277 3300005334 Bacteria 3048
8 Ga0068869_100060741 3300005334 Bacteria 2771
9 Ga0070682_100026863 3300005337 Bacteria 3449
10 Ga0070682_100043486 3300005337 Bacteria 2778
11 Ga0070682_100093664 3300005337 Bacteria 1970
12 Ga0070689_100028238 3300005340 Bacteria 4239
13 Ga0070689_100099388 3300005340 Unclassified 2302
14 Ga0070691_10007335 3300005341 Bacteria 5048
15 Ga0070668_100071870 3300005347 Bacteria 2695
16 Ga0070669_100107523 3300005353 Bacteria 2113
17 Ga0070675_100266093 3300005354 Unclassified 1503
18 Ga0070675_100597313 3300005354 Bacteria 1001
19 Ga0070674_100031775 3300005356 Unclassified 3501
20 Ga0070673_100011911 3300005364 Bacteria 5956
21 Ga0070673_100051806 3300005364 Bacteria 3217
22 Ga0070688_100089490 3300005365 Bacteria 2009
23 Ga0070659_100081972 3300005366 Unclassified 2577
24 Ga0070714_100079237 3300005435 Bacteria 2856
25 Ga0070713_100000098 3300005436 Bacteria 55237
26 Ga0070710_10026969 3300005437 Bacteria 3059
27 Ga0070705_100008045 3300005440 Bacteria 5214
28 Ga0070705_100045504 3300005440 Bacteria 2525
29 Ga0070700_100038625 3300005441 Bacteria 2911
30 Ga0070700_100046681 3300005441 Unclassified 2677
31 Ga0070700_100050970 3300005441 Unclassified 2575
32 Ga0070700_100097929 3300005441 Bacteria 1927
33 Ga0070708_100432369 3300005445 Bacteria 1241
34 Ga0070663_100580638 3300005455 Bacteria 940
35 Ga0070678_100017909 3300005456 Bacteria 4576
36 Ga0070678_100019876 3300005456 Unclassified 4392
37 Ga0068867_100053232 3300005459 Bacteria 2989
38 Ga0070685_10112049 3300005466 Unclassified 1682
39 Ga0070672_100001904 3300005543 Bacteria 13073
40 Ga0070672_100083930 3300005543 Bacteria 2558
41 Ga0070686_100224262 3300005544 Bacteria 1360
42 Ga0070696_100026663 3300005546 Bacteria 3931
43 Ga0070693_100005249 3300005547 Bacteria 6200
44 Ga0070665_100001600 3300005548 Bacteria 26064
45 Ga0070665_100601353 3300005548 Bacteria 1113
46 Ga0070664_100012750 3300005564 Bacteria 6839
47 Ga0068857_100000172 3300005577 Bacteria 40867
48 Ga0068857_100732640 3300005577 Bacteria 941
49 Ga0068856_100000185 3300005614 Bacteria 64973
50 Ga0068856_100033134 3300005614 Bacteria 5059
51 Ga0070702_100043856 3300005615 Bacteria 2522
52 Ga0070702_100236761 3300005615 Unclassified 1230
53 Ga0068859_100274978 3300005617 Bacteria 1777
54 Ga0068859_100292905 3300005617 Bacteria 1721
55 Ga0068864_100043982 3300005618 Bacteria 3826
56 Ga0068864_100262292 3300005618 Bacteria 1608
57 Ga0068861_100000744 3300005719 Bacteria 19515
58 Ga0068861_100021738 3300005719 Bacteria 4614
59 Ga0068861_100197122 3300005719 Bacteria 1688
60 Ga0068870_10002210 3300005840 Bacteria 8065
61 Ga0068870_10245188 3300005840 Bacteria 1108
62 Ga0068863_100028638 3300005841 Bacteria 5318
63 Ga0068863_100063035 3300005841 Bacteria 3506
64 Ga0068863_100140412 3300005841 Unclassified 2308
65 Ga0068860_100019002 3300005843 Bacteria 6673
66 Ga0068860_100759190 3300005843 Unclassified 982
67 Ga0068862_100181799 3300005844 Bacteria 1888
68 Ga0081455_10002126 3300005937 Bacteria 23617
69 Ga0070712_100000790 3300006175 Bacteria 18746
70 Ga0097621_100106250 3300006237 Bacteria 2368
71 Ga0068871_100178885 3300006358 Bacteria 1822
72 Ga0068871_100319075 3300006358 Bacteria 1368
73 Ga0075436_100000092 3300006914 Bacteria 52229
74 Ga0097620_100274970 3300006931 Bacteria 1777
75 Ga0097620_100292913 3300006931 Bacteria 1721
76 Ga0105240_10208668 3300009093 Bacteria 2284
77 Ga0111539_11045988 3300009094 Unclassified 949
78 Ga0105243_10373718 3300009148 Bacteria 1316
79 Ga0105248_10076863 3300009177 Bacteria 3752
80 Ga0105238_10002694 3300009551 Bacteria 17666
81 Ga0105239_10058690 3300010375 Bacteria 4223
82 Ga0157370_10040312 3300013104 Bacteria 4509
83 Ga0157369_10008714 3300013105 Bacteria 11630
84 Ga0163162_10040793 3300013306 Bacteria 4643
85 Ga0163162_10065786 3300013306 Bacteria 3673
86 Ga0157372_10013207 3300013307 Bacteria 8812
87 Ga0157372_10019895 3300013307 Bacteria 7235
88 Ga0157372_10020888 3300013307 Bacteria 7068
89 Ga0157372_10175398 3300013307 Bacteria 2481
90 Ga0157375_10157324 3300013308 Bacteria 2412
91 Ga0163163_10058969 3300014325 Bacteria 3795
92 Ga0157380_10096720 3300014326 Unclassified 2448
93 Ga0157380_10183817 3300014326 Bacteria 1839
94 Ga0157380_10615430 3300014326 Bacteria 1077
95 Ga0157379_10100102 3300014968 Bacteria 2602
96 Ga0157376_10036449 3300014969 Bacteria 3985
97 Ga0157376_10115449 3300014969 Bacteria 2370
98 Ga0163161_10047826 3300017792 Bacteria 3088
99 Ga0213876_10000223 3300021384 Bacteria 56685
100 Ga0207682_10005367 3300025893 Bacteria 5224
101 Ga0207682_10015298 3300025893 Bacteria 2986
102 Ga0207688_10200557 3300025901 Bacteria 1196
103 Ga0207645_10017030 3300025907 Bacteria 4803
104 Ga0207643_10011129 3300025908 Bacteria 4857
105 Ga0207695_10028124 3300025913 Bacteria 6242
106 Ga0207693_10002639 3300025915 Bacteria 15573
107 Ga0207681_10042700 3300025923 Bacteria 3030
108 Ga0207650_10098093 3300025925 Bacteria 2251
109 Ga0207650_10145522 3300025925 Bacteria 1866
110 Ga0207659_10079983 3300025926 Bacteria 2413
111 Ga0207659_10415575 3300025926 Bacteria 1127
112 Ga0207700_10000453 3300025928 Bacteria 24004
113 Ga0207664_10210543 3300025929 Bacteria 1682
114 Ga0207690_10219267 3300025932 Unclassified 1455
115 Ga0207670_10039186 3300025936 Bacteria 3101
116 Ga0207669_10092821 3300025937 Archaea 1970
117 Ga0207704_10112630 3300025938 Bacteria 1843
118 Ga0207691_10002478 3300025940 Bacteria 18056
119 Ga0207691_10015291 3300025940 Bacteria 7301
120 Ga0207691_10032788 3300025940 Bacteria 4841
121 Ga0207691_10345602 3300025940 Bacteria 1273
122 Ga0207691_10532528 3300025940 Bacteria 997
123 Ga0207689_10030188 3300025942 Bacteria 4517
124 Ga0207689_10199026 3300025942 Bacteria 1653
125 Ga0207667_10056610 3300025949 Bacteria 4118
126 Ga0207651_10043945 3300025960 Bacteria 2986
127 Ga0207651_10581277 3300025960 Unclassified 977
128 Ga0207668_10765398 3300025972 Bacteria 853
129 Ga0207640_10510023 3300025981 Bacteria 1003
130 Ga0207639_10079157 3300026041 Bacteria 2597
131 Ga0207678_10181145 3300026067 Bacteria 1799
132 Ga0207708_10014921 3300026075 Bacteria 5818
133 Ga0207708_10034046 3300026075 Bacteria 3874
134 Ga0207708_10036197 3300026075 Bacteria 3757
135 Ga0207708_10094037 3300026075 Bacteria 2313
136 Ga0207702_10000174 3300026078 Bacteria 77455
137 Ga0207702_10009015 3300026078 Bacteria 8400
138 Ga0207702_10451965 3300026078 Bacteria 1247
139 Ga0207641_10032763 3300026088 Bacteria 4315
140 Ga0207648_10148240 3300026089 Bacteria 2070
141 Ga0207676_10317650 3300026095 Bacteria 1428
142 Ga0207676_10405401 3300026095 Unclassified 1275
143 Ga0207676_10701640 3300026095 Bacteria 980
144 Ga0207674_10000952 3300026116 Bacteria 37804
145 Ga0207674_10268143 3300026116 Bacteria 1655
146 Ga0207675_100004074 3300026118 Bacteria 14148
147 Ga0207675_100013245 3300026118 Bacteria 7698
148 Ga0207675_100052552 3300026118 Bacteria 3802
149 Ga0207683_10004479 3300026121 Bacteria 12061
150 Ga0207683_10571887 3300026121 Bacteria 1045
151 Ga0268266_10171276 3300028379 Bacteria 1971
152 Ga0268265_10091762 3300028380 Bacteria 2430
153 Ga0268265_10335974 3300028380 Bacteria 1374
154 Ga0268264_10106900 3300028381 Bacteria 2443
155 Ga0307515_10142796 3300028794 Bacteria 2557
156 Ga0265338_10143754 3300028800 Bacteria 1864
157 Ga0265328_10041190 3300031239 Bacteria 1701
158 Ga0265325_10022989 3300031241 Bacteria 3409
159 Ga0265339_10005054 3300031249 Bacteria 8863
160 Ga0265339_10021156 3300031249 Bacteria 3790
161 Ga0265339_10129216 3300031249 Bacteria 1293
162 Ga0265316_10342537 3300031344 Archaea 1083
163 Ga0307513_10012701 3300031456 Bacteria 10369
164 Ga0307513_10037297 3300031456 Bacteria 5411
165 Ga0307513_10301118 3300031456 Bacteria 1370
166 Ga0307509_10488280 3300031507 Bacteria 918
167 Ga0265313_10067601 3300031595 Bacteria 1653
168 Ga0265314_10000511 3300031711 Bacteria 50084
169 Ga0265342_10006119 3300031712 Bacteria 9016
170 Ga0265342_10030583 3300031712 Archaea 3335
171 Ga0307405_10278528 3300031731 Bacteria 1258
172 Ga0307410_10044879 3300031852 Bacteria 2939
173 Ga0307410_10074937 3300031852 Bacteria 2358
174 Ga0307407_10257116 3300031903 Bacteria 1199
175 Ga0307412_10185978 3300031911 Bacteria 1567
176 Ga0307409_100000672 3300031995 Bacteria 15152
177 Ga0307409_100108676 3300031995 Bacteria 2320
178 Ga0307409_100109201 3300031995 Bacteria 2316
179 Ga0307409_100119565 3300031995 Bacteria 2228
180 Ga0307416_100061603 3300032002 Bacteria 3063
181 Ga0307416_100108938 3300032002 Unclassified 2435
182 Ga0307416_100158322 3300032002 Bacteria 2089
183 Ga0307416_100355760 3300032002 Bacteria 1484
184 Ga0307411_10033394 3300032005 Bacteria 3191
185 Ga0307415_100203031 3300032126 Bacteria 1575
186 Ga0373955_0121775 3300035172 Bacteria 1517
187 Ga0373935_0071267 3300035692 Bacteria 2242
188 Ga0373925_0206773 3300037068 Bacteria 1563
189 Ga0436365_0412683 3300039437 Bacteria 137628
190 Ga0436363_0607910 3300039450 Bacteria 9062
191 Ga0451793_0729101 3300041452 Bacteria 1953
192 Ga0451800_0968326 3300041459 Bacteria 1211
193 Ga0451802_0983375 3300041460 Bacteria 2358
194 Ga0451802_1603167 3300041460 Unclassified 967
195 Ga0451807_0420440 3300041486 Bacteria 1861
196 Ga0451833_0748211 3300041491 Bacteria 1240
197 Ga0453684_0003871 3300044712 Archaea 32951
198 Ga0453684_0009776 3300044712 Archaea 16647
199 Ga0453684_0015809 3300044712 Archaea 11871
200 Ga0453684_0037407 3300044712 Archaea 6662
201 Ga0453684_0182005 3300044712 Archaea 2466
202 Ga0466967_0983291 3300045976 Bacteria 840
203 Ga0495590_0001086 3300046457 Bacteria 11981
204 Ga0495638_0003306 3300046460 Bacteria 12716
205 Ga0495638_0045472 3300046460 Unclassified 2761
206 Ga0495641_0142595 3300046461 Bacteria 1070
207 Ga0495580_0244810 3300046472 Bacteria 1229
208 Ga0495616_0001981 3300046513 Bacteria 13781
209 Ga0495620_0107555 3300046515 Unclassified 1107
210 Ga0495632_0014947 3300046519 Bacteria 4372
211 Ga0495656_0125867 3300046615 Bacteria 1215
212 Ga0495625_0036065 3300046660 Bacteria 3639
213 Ga0495625_0119783 3300046660 Unclassified 1792
214 Ga0495649_0003903 3300046694 Bacteria 9866
215 Ga0495649_0154320 3300046694 Bacteria 1205
216 Ga0495686_0087586 3300047472 Unclassified 1894
217 Ga0495602_0084164 3300048088 Bacteria 2662
218 Ga0496114_0133305 3300048917 Bacteria 2147
219 Ga0501040_0000193 3300049576 Bacteria 35390
220 Ga0501040_0159080 3300049576 Bacteria 1596
221 Ga0501042_0000377 3300049578 Bacteria 22543
222 Ga0501042_0015060 3300049578 Bacteria 5288
223 Ga0501042_0169210 3300049578 Bacteria 1577
224 Ga0501042_0384520 3300049578 Bacteria 1016
225 Ga0501067_0006153 3300049583 Bacteria 6653
226 Ga0501068_0002903 3300049584 Bacteria 9127
227 Ga0501068_0006951 3300049584 Bacteria 6258
228 Ga0501068_0262709 3300049584 Bacteria 1101
229 Ga0501069_0029694 3300049585 Bacteria 3001
230 Ga0501070_0014336 3300049586 Bacteria 6672
231 Ga0501070_0072584 3300049586 Bacteria 2849
232 Ga0501070_0286272 3300049586 Bacteria 1344
233 Ga0501071_0006129 3300049587 Bacteria 7794
234 Ga0501071_0020550 3300049587 Bacteria 4589
235 Ga0501072_0237537 3300049588 Unclassified 1451
236 Ga0501073_0002020 3300049589 Bacteria 15150
237 Ga0501073_0003043 3300049589 Bacteria 12572
238 Ga0501074_0000735 3300049590 Bacteria 20549
239 Ga0501074_0008838 3300049590 Bacteria 7301
240 Ga0501075_0024879 3300049591 Bacteria 4396
241 Ga0501075_0295543 3300049591 Unclassified 1234
242 Ga0501076_0019064 3300049592 Bacteria 5235
243 Ga0501076_0148351 3300049592 Unclassified 1907
244 Ga0501077_0001425 3300049593 Bacteria 14344
245 Ga0501077_0005074 3300049593 Bacteria 7988
246 Ga0501079_0001693 3300049741 Bacteria 15688
247 Ga0501079_0002476 3300049741 Bacteria 13412
248 Ga0501080_0041520 3300049742 Bacteria 4285
249 Ga0501083_0103850 3300049744 Bacteria 1872
250 Ga0501044_0131097 3300049823 Bacteria 2501
251 nmdc:mga08y16_104115_c1 3300050511 Bacteria 2954
252 nmdc:mga08y16_527177_c1 3300050511 Bacteria 1197
253 nmdc:mga0rr50_108091_c1 3300050513 Bacteria 2197
254 nmdc:mga08x19_139_c1 3300050514 Bacteria 64397
255 Ga0501084_0003793 3300054114 Bacteria 12298
256 Ga0070671_100236967
257 rootL2_10036981
258 rootL2_10036982
259 Ga0070676_10158491
260 Ga0070690_100071113
261 Ga0070670_100534308
262 Ga0068869_100049277
263 Ga0068869_100060741
264 Ga0070682_100026863
265 Ga0070682_100043486
266 Ga0070682_100093664
267 Ga0070689_100028238
268 Ga0070689_100099388
269 Ga0070691_10007335
270 Ga0070668_100071870
271 Ga0070669_100107523
272 Ga0070675_100266093
273 Ga0070675_100597313
274 Ga0070674_100031775
275 Ga0070673_100011911
276 Ga0070673_100051806
277 Ga0070688_100089490
278 Ga0070659_100081972
279 Ga0070714_100079237
280 Ga0070713_100000098
281 Ga0070710_10026969
282 Ga0070705_100008045
283 Ga0070705_100045504
284 Ga0070700_100038625
285 Ga0070700_100046681
286 Ga0070700_100050970
287 Ga0070700_100097929
288 Ga0070708_100432369
289 Ga0070663_100580638
290 Ga0070678_100017909
291 Ga0070678_100019876
292 Ga0068867_100053232
293 Ga0070685_10112049
294 Ga0070672_100001904
295 Ga0070672_100083930
296 Ga0070686_100224262
297 Ga0070696_100026663
298 Ga0070693_100005249
299 Ga0070665_100001600
300 Ga0070665_100601353
301 Ga0070664_100012750
302 Ga0068857_100000172
303 Ga0068857_100732640
304 Ga0068856_100000185
305 Ga0068856_100033134
306 Ga0070702_100043856
307 Ga0070702_100236761
308 Ga0068859_100274978
309 Ga0068859_100292905
310 Ga0068864_100043982
311 Ga0068864_100262292
312 Ga0068861_100000744
313 Ga0068861_100021738
314 Ga0068861_100197122
315 Ga0068870_10002210
316 Ga0068870_10245188
317 Ga0068863_100028638
318 Ga0068863_100063035
319 Ga0068863_100140412
320 Ga0068860_100019002
321 Ga0068860_100759190
322 Ga0068862_100181799
323 Ga0081455_10002126
324 Ga0070712_100000790
325 Ga0097621_100106250
326 Ga0068871_100178885
327 Ga0068871_100319075
328 Ga0075436_100000092
329 Ga0097620_100274970
330 Ga0097620_100292913
331 Ga0105240_10208668
332 Ga0111539_11045988
333 Ga0105243_10373718
334 Ga0105248_10076863
335 Ga0105238_10002694
336 Ga0105239_10058690
337 Ga0157370_10040312
338 Ga0157369_10008714
339 Ga0163162_10040793
340 Ga0163162_10065786
341 Ga0157372_10013207
342 Ga0157372_10019895
343 Ga0157372_10020888
344 Ga0157372_10175398
345 Ga0157375_10157324
346 Ga0163163_10058969
347 Ga0157380_10096720
348 Ga0157380_10183817
349 Ga0157380_10615430
350 Ga0157379_10100102
351 Ga0157376_10036449
352 Ga0157376_10115449
353 Ga0163161_10047826
354 Ga0213876_10000223
355 Ga0207682_10005367
356 Ga0207682_10015298
357 Ga0207688_10200557
358 Ga0207645_10017030
359 Ga0207643_10011129
360 Ga0207695_10028124
361 Ga0207693_10002639
362 Ga0207681_10042700
363 Ga0207650_10098093
364 Ga0207650_10145522
365 Ga0207659_10079983
366 Ga0207659_10415575
367 Ga0207700_10000453
368 Ga0207664_10210543
369 Ga0207690_10219267
370 Ga0207670_10039186
371 Ga0207669_10092821
372 Ga0207704_10112630
373 Ga0207691_10002478
374 Ga0207691_10015291
375 Ga0207691_10032788
376 Ga0207691_10345602
377 Ga0207691_10532528
378 Ga0207689_10030188
379 Ga0207689_10199026
380 Ga0207667_10056610
381 Ga0207651_10043945
382 Ga0207651_10581277
383 Ga0207668_10765398
384 Ga0207640_10510023
385 Ga0207639_10079157
386 Ga0207678_10181145
387 Ga0207708_10014921
388 Ga0207708_10034046
389 Ga0207708_10036197
390 Ga0207708_10094037
391 Ga0207702_10000174
392 Ga0207702_10009015
393 Ga0207702_10451965
394 Ga0207641_10032763
395 Ga0207648_10148240
396 Ga0207676_10317650
397 Ga0207676_10405401
398 Ga0207676_10701640
399 Ga0207674_10000952
400 Ga0207674_10268143
401 Ga0207675_100004074
402 Ga0207675_100013245
403 Ga0207675_100052552
404 Ga0207683_10004479
405 Ga0207683_10571887
406 Ga0268266_10171276
407 Ga0268265_10091762
408 Ga0268265_10335974
409 Ga0268264_10106900
410 Ga0307515_10142796
411 Ga0265338_10143754
412 Ga0265328_10041190
413 Ga0265325_10022989
414 Ga0265339_10005054
415 Ga0265339_10021156
416 Ga0265339_10129216
417 Ga0265316_10342537
418 Ga0307513_10012701
419 Ga0307513_10037297
420 Ga0307513_10301118
421 Ga0307509_10488280
422 Ga0265313_10067601
423 Ga0265314_10000511
424 Ga0265342_10006119
425 Ga0265342_10030583
426 Ga0307405_10278528
427 Ga0307410_10044879
428 Ga0307410_10074937
429 Ga0307407_10257116
430 Ga0307412_10185978
431 Ga0307409_100000672
432 Ga0307409_100108676
433 Ga0307409_100109201
434 Ga0307409_100119565
435 Ga0307416_100061603
436 Ga0307416_100108938
437 Ga0307416_100158322
438 Ga0307416_100355760
439 Ga0307411_10033394
440 Ga0307415_100203031
441 Ga0373955_0121775
442 Ga0373935_0071267
443 Ga0373925_0206773
444 Ga0436365_0412683
445 Ga0436363_0607910
446 Ga0451793_0729101
447 Ga0451800_0968326
448 Ga0451802_0983375
449 Ga0451802_1603167
450 Ga0451807_0420440
451 Ga0451833_0748211
452 Ga0453684_0003871
453 Ga0453684_0009776
454 Ga0453684_0015809
455 Ga0453684_0037407
456 Ga0453684_0182005
457 Ga0466967_0983291
458 Ga0495590_0001086
459 Ga0495638_0003306
460 Ga0495638_0045472
461 Ga0495641_0142595
462 Ga0495580_0244810
463 Ga0495616_0001981
464 Ga0495620_0107555
465 Ga0495632_0014947
466 Ga0495656_0125867
467 Ga0495625_0036065
468 Ga0495625_0119783
469 Ga0495649_0003903
470 Ga0495649_0154320
471 Ga0495686_0087586
472 Ga0495602_0084164
473 Ga0496114_0133305
474 Ga0501040_0000193
475 Ga0501040_0159080
476 Ga0501042_0000377
477 Ga0501042_0015060
478 Ga0501042_0169210
479 Ga0501042_0384520
480 Ga0501067_0006153
481 Ga0501068_0002903
482 Ga0501068_0006951
483 Ga0501068_0262709
484 Ga0501069_0029694
485 Ga0501070_0014336
486 Ga0501070_0072584
487 Ga0501070_0286272
488 Ga0501071_0006129
489 Ga0501071_0020550
490 Ga0501072_0237537
491 Ga0501073_0002020
492 Ga0501073_0003043
493 Ga0501074_0000735
494 Ga0501074_0008838
495 Ga0501075_0024879
496 Ga0501075_0295543
497 Ga0501076_0019064
498 Ga0501076_0148351
499 Ga0501077_0001425
500 Ga0501077_0005074
501 Ga0501079_0001693
502 Ga0501079_0002476
503 Ga0501080_0041520
504 Ga0501083_0103850
505 Ga0501044_0131097
506 nmdc:mga08y16_104115_c1
507 nmdc:mga08y16_527177_c1
508 nmdc:mga0rr50_108091_c1
509 nmdc:mga08x19_139_c1
510 Ga0501084_0003793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

25

277

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6t1z-assembly1.cif.gz_A lmrp from l. lactis, in an outward-open conformation, bound to hoechst 33342 0.48 41 268
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.472 7 269
8bvs-assembly1.cif.gz_A cryo-em structure of rat slc22a6 bound to tenofovir 0.467 64 265
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.4626 7 269
4d2c-assembly1.cif.gz_A structure of a di peptide bound pot family peptide transporter 0.4262 7 266
ID Description Score Start End Superfamily
af_Q9V7S5_35_265_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5207 84 264 1.20.1250.20
af_A0A0R4IK09_318_470_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.509 84 268 1.20.1250.20
af_P09836_19_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4891 52 266 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4843 6 269 1.20.1250.20
af_P53918_423_671_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4804 6 267 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A099L8K8-F1-model_v4 Probable membrane transporter protein 0.984 2 268 GO:0005886
AF-A0A2E9SRJ2-F1-model_v4 Probable membrane transporter protein 0.9782 5 269 GO:0005886
AF-A0A1Y5SD13-F1-model_v4 Probable membrane transporter protein 0.9767 3 268 GO:0005886
AF-Q0BYN1-F1-model_v4 Probable membrane transporter protein 0.9759 8 268 GO:0005886
AF-A0A099L8K8-F1-model_v4 Probable membrane transporter protein 0.9732 2 268 GO:0005886

Map