F365339

General Info

Members Datasets Scaffolds Average Seq Length
255 145 245 388

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10004907|JGI24739J22299_100049072
Length 403
Sequence VTLKDHNQPSSTHKKHAKLARPSTGNFGRNEWAILGGPCTVIKLLADDVIRSLSPVYKCAYVDMSHNDDITLLPGRLVGGASLEYTDQVNYQQFNYQNPVYPYQLKQQFSFADLILVNGNHQQANAQIVIIDSNKETSLQKRTAQLNNVQLFLLADNASQIPGFIQEVLPHWQQIPVLKVDDRERIVAFFETALKQAKPVLNGLVLAGGKSTRMGFDKGAAKWHGKQQRYYMADLLKTFCREVYISGRPGQQQEIDPAYPVIEDTFTGLGPYGAILSAFREQPDAAWLVIACDLPLMDDATLRNLVAWRNSSSVATAYHSPVTNFPEPLIAIWEPKSYPVLLSFLAQGYSCPRKVLINSDITLLNAPQQEALTNVNTPEELEKVKSMIHHTIVATNESGFTTI

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
4 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
5 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
11 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
120 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 0.78
Isolates 3.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 0
Rhizoplane 0.39
Rhizosphere 82.75
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005096 3300001979 Bacteria 5579
2 JGI24740J21852_10017665 3300001979 Bacteria 2545
3 JGI24739J22299_10004907 3300001989 Bacteria 5096
4 JGI24737J22298_10003849 3300001990 Bacteria 5277
5 JGI24735J21928_10000004 3300002067 Bacteria 381713
6 JGI24744J21845_10002604 3300002077 Bacteria 3685
7 JGI25162J39368_1000017 3300002737 Bacteria 281385
8 JGI25162J39368_1002129 3300002737 Bacteria 8382
9 JGI25164J39214_1002241 3300002772 Bacteria 3152
10 JGI25406J46586_10013358 3300003203 Bacteria 3530
11 JGI25165J46597_1001445 3300003214 Bacteria 12601
12 rootH1_10005314 3300003316 Bacteria 25578
13 rootH1_10108125 3300003316 Bacteria 2302
14 rootH2_10001101 3300003320 Bacteria 45863
15 rootH2_10043765 3300003320 Bacteria 15088
16 rootH2_10215700 3300003320 Bacteria 2621
17 rootH1_10009528 3300003323 Bacteria 31356
18 rootH1_10158475 3300003323 Bacteria 2210
19 rootH1_10232185 3300003323 Bacteria 3721
20 JGI25160J50197_1010557 3300003354 Unclassified 3329
21 Ga0058863_11903483 3300004799 Bacteria 5348
22 Ga0065714_10006471 3300005288 Bacteria 5544
23 Ga0070658_10000011 3300005327 Bacteria 294396
24 Ga0070658_10059182 3300005327 Bacteria 3120
25 Ga0070658_10119943 3300005327 Bacteria 2185
26 Ga0070676_10000471 3300005328 Bacteria 19324
27 Ga0070660_100014306 3300005339 Bacteria 5714
28 Ga0070671_100029755 3300005355 Bacteria 4505
29 Ga0070674_100117968 3300005356 Unclassified 1960
30 Ga0070673_100006304 3300005364 Bacteria 7702
31 Ga0070659_100004095 3300005366 Bacteria 10394
32 Ga0070659_100038481 3300005366 Unclassified 3730
33 Ga0070678_100002096 3300005456 Bacteria 10811
34 Ga0068867_100003012 3300005459 Bacteria 11876
35 Ga0070679_100032826 3300005530 Bacteria 5138
36 Ga0070684_100121665 3300005535 Unclassified 2348
37 Ga0068853_100049786 3300005539 Bacteria 3602
38 Ga0068855_100000070 3300005563 Bacteria 123584
39 Ga0068855_100000388 3300005563 Bacteria 54070
40 Ga0068855_100010991 3300005563 Bacteria 10924
41 Ga0068855_100017518 3300005563 Bacteria 8614
42 Ga0068855_100208154 3300005563 Unclassified 2199
43 Ga0070664_100104407 3300005564 Bacteria 2467
44 Ga0068857_100037446 3300005577 Bacteria 4297
45 Ga0068856_100005531 3300005614 Bacteria 12443
46 Ga0068852_100006806 3300005616 Bacteria 8299
47 Ga0068863_100250969 3300005841 Bacteria 1709
48 Ga0081539_10001000 3300005985 Bacteria 52492
49 Ga0081539_10027743 3300005985 Bacteria 3578
50 Ga0075366_10002253 3300006195 Bacteria 9856
51 Ga0075366_10029400 3300006195 Bacteria 3228
52 Ga0097621_100000020 3300006237 Bacteria 86226
53 Ga0075370_10048843 3300006353 Unclassified 2398
54 Ga0068871_100000130 3300006358 Bacteria 47875
55 Ga0068871_100203341 3300006358 Bacteria 1711
56 Ga0068865_100000050 3300006881 Bacteria 65632
57 Ga0105240_10000728 3300009093 Bacteria 60140
58 Ga0105240_10010235 3300009093 Bacteria 13201
59 Ga0105240_10018707 3300009093 Bacteria 9281
60 Ga0105240_10035414 3300009093 Bacteria 6433
61 Ga0105240_10261596 3300009093 Bacteria 1996
62 Ga0105240_10299615 3300009093 Bacteria 1839
63 Ga0105240_10320941 3300009093 Bacteria 1765
64 Ga0105240_10341939 3300009093 Bacteria 1699
65 Ga0105240_10472095 3300009093 Bacteria 1400
66 Ga0105245_10029178 3300009098 Bacteria 4872
67 Ga0105241_10000281 3300009174 Bacteria 37919
68 Ga0105241_10009625 3300009174 Bacteria 7101
69 Ga0105241_10063493 3300009174 Unclassified 2850
70 Ga0105242_10017684 3300009176 Bacteria 5561
71 Ga0105237_10000841 3300009545 Bacteria 41862
72 Ga0105237_10003737 3300009545 Bacteria 17929
73 Ga0105237_10005432 3300009545 Bacteria 14392
74 Ga0105237_10018441 3300009545 Bacteria 7222
75 Ga0105237_10053178 3300009545 Bacteria 4062
76 Ga0105237_10140523 3300009545 Bacteria 2409
77 Ga0105238_10018941 3300009551 Bacteria 7009
78 Ga0105238_10208784 3300009551 Bacteria 1929
79 Ga0105239_10000002 3300010375 Bacteria 610298
80 Ga0105239_10000012 3300010375 Bacteria 332279
81 Ga0105239_10000445 3300010375 Bacteria 60337
82 Ga0105239_10000959 3300010375 Bacteria 40551
83 Ga0105239_10006358 3300010375 Bacteria 13727
84 Ga0105239_10008543 3300010375 Bacteria 11630
85 Ga0105239_10077424 3300010375 Bacteria 3659
86 Ga0105239_10081977 3300010375 Bacteria 3551
87 Ga0105239_10207639 3300010375 Bacteria 2195
88 Ga0105239_10363443 3300010375 Bacteria 1635
89 Ga0105239_10417369 3300010375 Bacteria 1520
90 Ga0105246_10012536 3300011119 Bacteria 5294
91 Ga0157371_10000269 3300013102 Bacteria 70787
92 Ga0157371_10014776 3300013102 Bacteria 5877
93 Ga0157371_10032880 3300013102 Bacteria 3730
94 Ga0157371_10070860 3300013102 Bacteria 2468
95 Ga0157371_10102234 3300013102 Unclassified 2033
96 Ga0157370_10083214 3300013104 Bacteria 3009
97 Ga0157370_10132970 3300013104 Bacteria 2320
98 Ga0157369_10002318 3300013105 Bacteria 22909
99 Ga0157369_10099032 3300013105 Bacteria 3108
100 Ga0157369_10157365 3300013105 Unclassified 2399
101 Ga0157374_10003065 3300013296 Bacteria 14011
102 Ga0157374_10032460 3300013296 Bacteria 4754
103 Ga0157378_10011737 3300013297 Bacteria 7670
104 Ga0157378_10158271 3300013297 Bacteria 2116
105 Ga0163162_10000031 3300013306 Bacteria 157666
106 Ga0163162_10005497 3300013306 Bacteria 12245
107 Ga0163162_10006956 3300013306 Bacteria 10971
108 Ga0163162_10360658 3300013306 Bacteria 1586
109 Ga0157372_10000034 3300013307 Bacteria 174784
110 Ga0157372_10001534 3300013307 Bacteria 25119
111 Ga0157372_10002075 3300013307 Bacteria 21762
112 Ga0157372_10074598 3300013307 Bacteria 3826
113 Ga0157372_10261500 3300013307 Unclassified 2010
114 Ga0157375_10016536 3300013308 Bacteria 6632
115 Ga0157375_10070001 3300013308 Bacteria 3516
116 Ga0157377_10120996 3300014745 Bacteria 1586
117 Ga0163161_10014065 3300017792 Bacteria 5572
118 Ga0206351_10035624 3300020077 Bacteria 2310
119 Ga0213872_10008555 3300021361 Bacteria 4949
120 Ga0209563_104761 3300025230 Bacteria 2545
121 Ga0207427_100766 3300025231 Bacteria 14625
122 Ga0209437_100024 3300025233 Bacteria 592878
123 Ga0209437_100052 3300025233 Bacteria 380548
124 Ga0209233_1000067 3300025261 Bacteria 380554
125 Ga0209233_1001304 3300025261 Bacteria 9948
126 Ga0209455_1004456 3300025272 Bacteria 4576
127 Ga0207426_1000030 3300025302 Bacteria 461478
128 Ga0207647_10000463 3300025904 Bacteria 32923
129 Ga0207647_10002317 3300025904 Bacteria 14485
130 Ga0207645_10000082 3300025907 Bacteria 68372
131 Ga0207705_10000015 3300025909 Bacteria 382901
132 Ga0207654_10094726 3300025911 Bacteria 1828
133 Ga0207707_10029641 3300025912 Bacteria 4785
134 Ga0207695_10000189 3300025913 Bacteria 177142
135 Ga0207695_10010555 3300025913 Bacteria 11295
136 Ga0207695_10030752 3300025913 Bacteria 5907
137 Ga0207695_10045184 3300025913 Bacteria 4678
138 Ga0207695_10140873 3300025913 Bacteria 2360
139 Ga0207695_10169042 3300025913 Unclassified 2113
140 Ga0207695_10205683 3300025913 Bacteria 1881
141 Ga0207671_10001801 3300025914 Bacteria 23958
142 Ga0207671_10002710 3300025914 Bacteria 18563
143 Ga0207671_10004889 3300025914 Bacteria 12594
144 Ga0207671_10062274 3300025914 Bacteria 2770
145 Ga0207660_10157758 3300025917 Bacteria 1748
146 Ga0207657_10108422 3300025919 Bacteria 2296
147 Ga0207657_10118301 3300025919 Bacteria 2181
148 Ga0207657_10148646 3300025919 Bacteria 1909
149 Ga0207657_10168624 3300025919 Bacteria 1775
150 Ga0207652_10125616 3300025921 Bacteria 2285
151 Ga0207694_10248463 3300025924 Bacteria 1455
152 Ga0207659_10110951 3300025926 Unclassified 2085
153 Ga0207644_10025333 3300025931 Bacteria 4080
154 Ga0207690_10018517 3300025932 Bacteria 4271
155 Ga0207690_10137058 3300025932 Bacteria 1798
156 Ga0207706_10001363 3300025933 Bacteria 24429
157 Ga0207686_10184868 3300025934 Bacteria 1481
158 Ga0207669_10099444 3300025937 Unclassified 1918
159 Ga0207704_10000078 3300025938 Bacteria 59491
160 Ga0207691_10259603 3300025940 Bacteria 1498
161 Ga0207661_10217722 3300025944 Unclassified 1686
162 Ga0207667_10000009 3300025949 Bacteria 603135
163 Ga0207667_10001584 3300025949 Bacteria 28609
164 Ga0207667_10013812 3300025949 Bacteria 9224
165 Ga0207667_10037382 3300025949 Bacteria 5190
166 Ga0207667_10056234 3300025949 Bacteria 4134
167 Ga0207651_10003963 3300025960 Bacteria 7353
168 Ga0207677_10052982 3300026023 Unclassified 2759
169 Ga0207639_10002536 3300026041 Bacteria 12254
170 Ga0207702_10001984 3300026078 Bacteria 19874
171 Ga0207702_10269877 3300026078 Unclassified 1604
172 Ga0207702_10310910 3300026078 Bacteria 1498
173 Ga0207648_10000472 3300026089 Bacteria 44933
174 Ga0207683_10014226 3300026121 Bacteria 6778
175 Ga0268264_10175717 3300028381 Bacteria 1941
176 Ga0307517_10013049 3300028786 Bacteria 11328
177 Ga0307515_10000280 3300028794 Bacteria 125330
178 Ga0307515_10000353 3300028794 Bacteria 112876
179 Ga0265327_10000527 3300031251 Bacteria 65908
180 Ga0307507_10000345 3300033179 Bacteria 94462
181 Ga0395899_0000002 3300037312 Bacteria 1324310
182 Ga0395899_0000182 3300037312 Bacteria 92470
183 Ga0395900_0000014 3300037418 Bacteria 386513
184 Ga0395900_0000128 3300037418 Bacteria 127446
185 Ga0395900_0005426 3300037418 Bacteria 13362
186 Ga0395898_0021189 3300037466 Bacteria 6594
187 Ga0395905_0000037 3300037471 Bacteria 261808
188 Ga0395905_0006237 3300037471 Bacteria 12038
189 Ga0395901_0000166 3300038443 Bacteria 86352
190 Ga0395901_0146047 3300038443 Bacteria 2486
191 Ga0395901_0201542 3300038443 Bacteria 2086
192 Ga0436361_0360494 3300039447 Bacteria 8737
193 Ga0439448_0052261 3300042005 Bacteria 1339
194 Ga0451577_0000120 3300042876 Bacteria 172425
195 Ga0451577_0011145 3300042876 Bacteria 8528
196 Ga0451577_0071769 3300042876 Unclassified 3088
197 Ga0466966_0073976 3300044684 Bacteria 2130
198 Ga0453684_0096941 3300044712 Bacteria 3621
199 Ga0466958_0033030 3300045836 Bacteria 3082
200 Ga0495650_0000087 3300046471 Bacteria 234870
201 Ga0495585_0000167 3300046492 Bacteria 70874
202 Ga0495585_0013561 3300046492 Bacteria 4763
203 Ga0495583_0069507 3300046506 Bacteria 1551
204 Ga0495606_0000052 3300046507 Bacteria 201529
205 Ga0495606_0008205 3300046507 Bacteria 9134
206 Ga0495606_0012014 3300046507 Bacteria 6993
207 Ga0495606_0026982 3300046507 Bacteria 4080
208 Ga0495610_0001840 3300046512 Bacteria 18389
209 Ga0495610_0064142 3300046512 Bacteria 1737
210 Ga0495616_0002580 3300046513 Bacteria 11923
211 Ga0495616_0005811 3300046513 Bacteria 7538
212 Ga0495648_0005125 3300046524 Bacteria 10975
213 Ga0495654_0034622 3300046530 Bacteria 2547
214 Ga0495609_0016612 3300046538 Bacteria 3427
215 Ga0495633_0000029 3300046558 Bacteria 200381
216 Ga0495633_0021535 3300046558 Bacteria 3223
217 Ga0495668_0000070 3300046616 Bacteria 174051
218 Ga0495625_0000008 3300046660 Bacteria 536165
219 Ga0495625_0001080 3300046660 Bacteria 35353
220 Ga0495625_0001647 3300046660 Bacteria 26189
221 Ga0495625_0014767 3300046660 Bacteria 6216
222 Ga0495625_0075720 3300046660 Bacteria 2354
223 Ga0495661_0003217 3300046665 Bacteria 12191
224 Ga0495661_0003891 3300046665 Bacteria 10914
225 Ga0495661_0025617 3300046665 Bacteria 3808
226 Ga0495649_0000018 3300046694 Bacteria 220586
227 Ga0495687_000972 3300047443 Bacteria 29181
228 Ga0495687_001574 3300047443 Bacteria 20718
229 Ga0495677_0021762 3300047445 Bacteria 2324
230 Ga0495679_025297 3300047446 Bacteria 1987
231 Ga0495686_0000052 3300047472 Bacteria 262622
232 Ga0495686_0025603 3300047472 Bacteria 3867
233 Ga0495686_0030076 3300047472 Unclassified 3530
234 Ga0495686_0179862 3300047472 Bacteria 1226
235 Ga0495614_0055830 3300048089 Bacteria 1694
236 nmdc:mga0k408_13355_c1 3300050493 Bacteria 4502
237 nmdc:mga0k408_2290_c1 3300050493 Bacteria 10217
238 nmdc:mga07m45_48083_c1 3300050496 Unclassified 2398
239 nmdc:mga07m45_94502_c2 3300050496 Bacteria 1355
240 Ga0500635_0002470 3300053080 Bacteria 4588
241 Ga0500608_028201 3300053122 Bacteria 2650
242 Ga0500618_000037 3300053125 Bacteria 117320
243 Ga0500559_0040246 3300053136 Bacteria 2035
244 Ga0500622_0000891 3300053156 Bacteria 25423
245 Ga0500624_000134 3300053157 Bacteria 31729

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0179862 Ga0495686_0179862_43_1053 320
2 3300053122 Ga0500608_028201 Ga0500608_028201_443_1609 341
3 3300005614 Ga0068856_100005531 Ga0068856_1000055315 344
4 3300050496 nmdc:mga07m45_94502_c2 nmdc:mga07m45_94502_c2_91_1218 344
5 3300047445 Ga0495677_0021762 Ga0495677_0021762_970_2133 351
6 3300037418 Ga0395900_0005426 Ga0395900_0005426_9705_10823 352
7 3300037471 Ga0395905_0006237 Ga0395905_0006237_10365_11483 352
8 3300038443 Ga0395901_0146047 Ga0395901_0146047_978_2096 352
9 3300046506 Ga0495583_0069507 Ga0495583_0069507_192_1358 352
10 3300053156 Ga0500622_0000891 Ga0500622_0000891_22383_23549 353
11 3300047472 Ga0495686_0025603 Ga0495686_0025603_1566_2669 354
12 3300042876 Ga0451577_0011145 Ga0451577_0011145_1712_2848 355
13 3300037312 Ga0395899_0000002 Ga0395899_0000002_1306142_1307257 356
14 3300006195 Ga0075366_10002253 Ga0075366_100022533 359
15 3300050493 nmdc:mga0k408_2290_c1 nmdc:mga0k408_2290_c1_7372_8544 359
16 3300028794 Ga0307515_10000353 Ga0307515_1000035335 360
17 3300046524 Ga0495648_0005125 Ga0495648_0005125_7611_8795 360
18 3300046530 Ga0495654_0034622 Ga0495654_0034622_952_2136 360
19 3300046660 Ga0495625_0001080 Ga0495625_0001080_17870_19054 360
20 3300025913 Ga0207695_10205683 Ga0207695_102056832 361
21 3300048089 Ga0495614_0055830 Ga0495614_0055830_145_1329 361
22 3300005539 Ga0068853_100049786 Ga0068853_1000497864 362
23 3300006237 Ga0097621_100000020 Ga0097621_10000002076 362
24 3300006358 Ga0068871_100000130 Ga0068871_10000013022 362
25 3300006881 Ga0068865_100000050 Ga0068865_10000005029 362
26 3300025904 Ga0207647_10002317 Ga0207647_100023176 362
27 3300025907 Ga0207645_10000082 Ga0207645_1000008248 362
28 3300025913 Ga0207695_10045184 Ga0207695_100451843 362
29 3300025933 Ga0207706_10001363 Ga0207706_1000136314 362
30 3300025938 Ga0207704_10000078 Ga0207704_1000007831 362
31 3300026041 Ga0207639_10002536 Ga0207639_1000253610 362
32 3300026089 Ga0207648_10000472 Ga0207648_1000047223 362
33 3300033179 Ga0307507_10000345 Ga0307507_1000034583 364
34 3300010375 Ga0105239_10077424 Ga0105239_100774243 365
35 3300053125 Ga0500618_000037 Ga0500618_000037_94673_95869 366
36 iso_pu_bacteria 2977232053 2977234300 366
37 3300025261 Ga0209233_1001304 Ga0209233_10013046 367
38 3300042876 Ga0451577_0000120 Ga0451577_0000120_111962_113101 368
39 3300046507 Ga0495606_0008205 Ga0495606_0008205_6674_7819 368
40 iso_pu_bacteria 2739367866 2740031916 368
41 3300009545 Ga0105237_10140523 Ga0105237_101405232 369
42 3300009551 Ga0105238_10208784 Ga0105238_102087843 369
43 3300010375 Ga0105239_10000012 Ga0105239_10000012188 369
44 3300025914 Ga0207671_10001801 Ga0207671_1000180118 369
45 3300025924 Ga0207694_10248463 Ga0207694_102484632 369
46 3300046558 Ga0495633_0000029 Ga0495633_0000029_153505_154695 369
47 iso_pu_bacteria 2599185184 2599478265 369
48 iso_pu_bacteria 2852623160 2852623772 369
49 iso_pu_bacteria 2884933994 2884937322 369
50 iso_pu_bacteria 2919437846 2919438960 369
51 iso_pu_bacteria 2928078545 2928080685 369
52 iso_pu_bacteria 2928147474 2928150910 369
53 iso_pu_bacteria 2932082852 2932082931 369
54 3300003320 rootH2_10215700 rootH2_102157002 370
55 3300006358 Ga0068871_100203341 Ga0068871_1002033412 370
56 3300010375 Ga0105239_10363443 Ga0105239_103634432 370
57 3300025940 Ga0207691_10259603 Ga0207691_102596032 370
58 3300028381 Ga0268264_10175717 Ga0268264_101757172 370
59 3300001979 JGI24740J21852_10017665 JGI24740J21852_100176652 371
60 3300003203 JGI25406J46586_10013358 JGI25406J46586_100133585 371
61 3300003354 JGI25160J50197_1010557 JGI25160J50197_10105573 371
62 3300005339 Ga0070660_100014306 Ga0070660_1000143063 371
63 3300005366 Ga0070659_100038481 Ga0070659_1000384811 371
64 3300005535 Ga0070684_100121665 Ga0070684_1001216651 371
65 3300005563 Ga0068855_100208154 Ga0068855_1002081542 371
66 3300005564 Ga0070664_100104407 Ga0070664_1001044072 371
67 3300005841 Ga0068863_100250969 Ga0068863_1002509692 371
68 3300005985 Ga0081539_10001000 Ga0081539_100010002 371
69 3300005985 Ga0081539_10027743 Ga0081539_100277432 371
70 3300009545 Ga0105237_10018441 Ga0105237_100184415 371
71 3300010375 Ga0105239_10081977 Ga0105239_100819773 371
72 3300013102 Ga0157371_10102234 Ga0157371_101022342 371
73 3300013105 Ga0157369_10157365 Ga0157369_101573653 371
74 3300013296 Ga0157374_10032460 Ga0157374_100324602 371
75 3300013307 Ga0157372_10074598 Ga0157372_100745981 371
76 3300013307 Ga0157372_10261500 Ga0157372_102615002 371
77 3300025302 Ga0207426_1000030 Ga0207426_1000030213 371
78 3300025914 Ga0207671_10062274 Ga0207671_100622741 371
79 3300025917 Ga0207660_10157758 Ga0207660_101577582 371
80 3300025919 Ga0207657_10118301 Ga0207657_101183012 371
81 3300025926 Ga0207659_10110951 Ga0207659_101109512 371
82 3300025932 Ga0207690_10137058 Ga0207690_101370582 371
83 3300025944 Ga0207661_10217722 Ga0207661_102177222 371
84 3300025949 Ga0207667_10056234 Ga0207667_100562343 371
85 3300026023 Ga0207677_10052982 Ga0207677_100529822 371
86 3300026078 Ga0207702_10269877 Ga0207702_102698772 371
87 3300053136 Ga0500559_0040246 Ga0500559_0040246_718_1857 371
88 iso_pu_bacteria 2839989709 2839992638 371
89 3300003323 rootH1_10232185 rootH1_102321852 372
90 3300009093 Ga0105240_10341939 Ga0105240_103419392 372
91 3300013306 Ga0163162_10005497 Ga0163162_1000549712 372
92 3300025913 Ga0207695_10169042 Ga0207695_101690421 372
93 3300031251 Ga0265327_10000527 Ga0265327_1000052749 372
94 3300047472 Ga0495686_0030076 Ga0495686_0030076_1260_2423 372
95 3300001989 JGI24739J22299_10004907 JGI24739J22299_100049072 373
96 3300001990 JGI24737J22298_10003849 JGI24737J22298_100038494 373
97 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004173 373
98 3300002077 JGI24744J21845_10002604 JGI24744J21845_100026045 373
99 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001782 373
100 3300002737 JGI25162J39368_1002129 JGI25162J39368_10021299 373
101 3300002772 JGI25164J39214_1002241 JGI25164J39214_10022413 373
102 3300003214 JGI25165J46597_1001445 JGI25165J46597_10014455 373
103 3300003316 rootH1_10005314 rootH1_1000531417 373
104 3300003316 rootH1_10108125 rootH1_101081252 373
105 3300003320 rootH2_10001101 rootH2_1000110126 373
106 3300003320 rootH2_10043765 rootH2_1004376510 373
107 3300003323 rootH1_10009528 rootH1_1000952819 373
108 3300003323 rootH1_10158475 rootH1_101584752 373
109 3300004799 Ga0058863_11903483 Ga0058863_119034834 373
110 3300005288 Ga0065714_10006471 Ga0065714_100064717 373
111 3300005327 Ga0070658_10000011 Ga0070658_10000011100 373
112 3300005327 Ga0070658_10059182 Ga0070658_100591822 373
113 3300005327 Ga0070658_10119943 Ga0070658_101199432 373
114 3300005328 Ga0070676_10000471 Ga0070676_100004717 373
115 3300005355 Ga0070671_100029755 Ga0070671_1000297552 373
116 3300005356 Ga0070674_100117968 Ga0070674_1001179682 373
117 3300005364 Ga0070673_100006304 Ga0070673_1000063042 373
118 3300005366 Ga0070659_100004095 Ga0070659_10000409511 373
119 3300005456 Ga0070678_100002096 Ga0070678_1000020967 373
120 3300005459 Ga0068867_100003012 Ga0068867_1000030129 373
121 3300005530 Ga0070679_100032826 Ga0070679_1000328263 373
122 3300005563 Ga0068855_100000070 Ga0068855_10000007040 373
123 3300005563 Ga0068855_100000388 Ga0068855_10000038850 373
124 3300005563 Ga0068855_100010991 Ga0068855_1000109919 373
125 3300005563 Ga0068855_100017518 Ga0068855_1000175182 373
126 3300005577 Ga0068857_100037446 Ga0068857_1000374463 373
127 3300005616 Ga0068852_100006806 Ga0068852_1000068067 373
128 3300006195 Ga0075366_10029400 Ga0075366_100294003 373
129 3300006353 Ga0075370_10048843 Ga0075370_100488432 373
130 3300009093 Ga0105240_10000728 Ga0105240_100007289 373
131 3300009093 Ga0105240_10010235 Ga0105240_100102359 373
132 3300009093 Ga0105240_10018707 Ga0105240_100187079 373
133 3300009093 Ga0105240_10035414 Ga0105240_100354142 373
134 3300009093 Ga0105240_10261596 Ga0105240_102615962 373
135 3300009093 Ga0105240_10299615 Ga0105240_102996152 373
136 3300009093 Ga0105240_10320941 Ga0105240_103209412 373
137 3300009093 Ga0105240_10472095 Ga0105240_104720952 373
138 3300009098 Ga0105245_10029178 Ga0105245_100291782 373
139 3300009174 Ga0105241_10000281 Ga0105241_1000028130 373
140 3300009174 Ga0105241_10009625 Ga0105241_100096256 373
141 3300009174 Ga0105241_10063493 Ga0105241_100634933 373
142 3300009176 Ga0105242_10017684 Ga0105242_100176844 373
143 3300009545 Ga0105237_10000841 Ga0105237_100008415 373
144 3300009545 Ga0105237_10003737 Ga0105237_1000373717 373
145 3300009545 Ga0105237_10005432 Ga0105237_100054327 373
146 3300009545 Ga0105237_10053178 Ga0105237_100531783 373
147 3300009551 Ga0105238_10018941 Ga0105238_100189414 373
148 3300010375 Ga0105239_10000002 Ga0105239_10000002266 373
149 3300010375 Ga0105239_10000445 Ga0105239_1000044530 373
150 3300010375 Ga0105239_10000959 Ga0105239_1000095920 373
151 3300010375 Ga0105239_10006358 Ga0105239_100063589 373
152 3300010375 Ga0105239_10008543 Ga0105239_100085434 373
153 3300010375 Ga0105239_10207639 Ga0105239_102076392 373
154 3300010375 Ga0105239_10417369 Ga0105239_104173692 373
155 3300011119 Ga0105246_10012536 Ga0105246_100125365 373
156 3300013102 Ga0157371_10000269 Ga0157371_100002693 373
157 3300013102 Ga0157371_10032880 Ga0157371_100328803 373
158 3300013104 Ga0157370_10083214 Ga0157370_100832142 373
159 3300013105 Ga0157369_10099032 Ga0157369_100990323 373
160 3300013296 Ga0157374_10003065 Ga0157374_100030657 373
161 3300013297 Ga0157378_10011737 Ga0157378_100117375 373
162 3300013297 Ga0157378_10158271 Ga0157378_101582711 373
163 3300013306 Ga0163162_10000031 Ga0163162_1000003122 373
164 3300013306 Ga0163162_10006956 Ga0163162_100069565 373
165 3300013306 Ga0163162_10360658 Ga0163162_103606582 373
166 3300013307 Ga0157372_10001534 Ga0157372_1000153416 373
167 3300013307 Ga0157372_10002075 Ga0157372_1000207515 373
168 3300013308 Ga0157375_10016536 Ga0157375_100165362 373
169 3300013308 Ga0157375_10070001 Ga0157375_100700014 373
170 3300014745 Ga0157377_10120996 Ga0157377_101209962 373
171 3300017792 Ga0163161_10014065 Ga0163161_100140655 373
172 3300020077 Ga0206351_10035624 Ga0206351_100356242 373
173 3300021361 Ga0213872_10008555 Ga0213872_100085552 373
174 3300025230 Ga0209563_104761 Ga0209563_1047611 373
175 3300025231 Ga0207427_100766 Ga0207427_10076612 373
176 3300025233 Ga0209437_100024 Ga0209437_100024232 373
177 3300025233 Ga0209437_100052 Ga0209437_100052115 373
178 3300025261 Ga0209233_1000067 Ga0209233_1000067115 373
179 3300025272 Ga0209455_1004456 Ga0209455_10044564 373
180 3300025904 Ga0207647_10000463 Ga0207647_1000046315 373
181 3300025909 Ga0207705_10000015 Ga0207705_10000015100 373
182 3300025911 Ga0207654_10094726 Ga0207654_100947262 373
183 3300025912 Ga0207707_10029641 Ga0207707_100296417 373
184 3300025913 Ga0207695_10000189 Ga0207695_10000189156 373
185 3300025913 Ga0207695_10010555 Ga0207695_100105556 373
186 3300025913 Ga0207695_10030752 Ga0207695_100307527 373
187 3300025913 Ga0207695_10140873 Ga0207695_101408733 373
188 3300025914 Ga0207671_10002710 Ga0207671_100027105 373
189 3300025914 Ga0207671_10004889 Ga0207671_100048896 373
190 3300025919 Ga0207657_10108422 Ga0207657_101084222 373
191 3300025919 Ga0207657_10148646 Ga0207657_101486462 373
192 3300025921 Ga0207652_10125616 Ga0207652_101256162 373
193 3300025931 Ga0207644_10025333 Ga0207644_100253335 373
194 3300025932 Ga0207690_10018517 Ga0207690_100185173 373
195 3300025934 Ga0207686_10184868 Ga0207686_101848682 373
196 3300025937 Ga0207669_10099444 Ga0207669_100994442 373
197 3300025949 Ga0207667_10000009 Ga0207667_10000009471 373
198 3300025949 Ga0207667_10001584 Ga0207667_1000158415 373
199 3300025949 Ga0207667_10013812 Ga0207667_100138124 373
200 3300025949 Ga0207667_10037382 Ga0207667_100373825 373
201 3300025960 Ga0207651_10003963 Ga0207651_100039636 373
202 3300026078 Ga0207702_10001984 Ga0207702_1000198418 373
203 3300026078 Ga0207702_10310910 Ga0207702_103109102 373
204 3300026121 Ga0207683_10014226 Ga0207683_100142266 373
205 3300028786 Ga0307517_10013049 Ga0307517_1001304910 373
206 3300028794 Ga0307515_10000280 Ga0307515_1000028041 373
207 3300037418 Ga0395900_0000014 Ga0395900_0000014_46406_47578 373
208 3300037418 Ga0395900_0000128 Ga0395900_0000128_91643_92809 373
209 3300037466 Ga0395898_0021189 Ga0395898_0021189_1647_2819 373
210 3300037471 Ga0395905_0000037 Ga0395905_0000037_46396_47568 373
211 3300038443 Ga0395901_0000166 Ga0395901_0000166_46260_47432 373
212 3300038443 Ga0395901_0201542 Ga0395901_0201542_901_2073 373
213 3300039447 Ga0436361_0360494 Ga0436361_0360494_5291_6463 373
214 3300042005 Ga0439448_0052261 Ga0439448_0052261_86_1258 373
215 3300046471 Ga0495650_0000087 Ga0495650_0000087_88593_89786 373
216 3300046492 Ga0495585_0000167 Ga0495585_0000167_32560_33753 373
217 3300046492 Ga0495585_0013561 Ga0495585_0013561_246_1430 373
218 3300046507 Ga0495606_0000052 Ga0495606_0000052_104916_106109 373
219 3300046507 Ga0495606_0012014 Ga0495606_0012014_232_1422 373
220 3300046507 Ga0495606_0026982 Ga0495606_0026982_147_1340 373
221 3300046512 Ga0495610_0001840 Ga0495610_0001840_8425_9618 373
222 3300046512 Ga0495610_0064142 Ga0495610_0064142_512_1705 373
223 3300046513 Ga0495616_0002580 Ga0495616_0002580_7727_8920 373
224 3300046513 Ga0495616_0005811 Ga0495616_0005811_4695_5861 373
225 3300046538 Ga0495609_0016612 Ga0495609_0016612_1270_2463 373
226 3300046558 Ga0495633_0021535 Ga0495633_0021535_491_1684 373
227 3300046616 Ga0495668_0000070 Ga0495668_0000070_16418_17602 373
228 3300046660 Ga0495625_0000008 Ga0495625_0000008_470938_472131 373
229 3300046660 Ga0495625_0001647 Ga0495625_0001647_16594_17784 373
230 3300046660 Ga0495625_0014767 Ga0495625_0014767_4011_5177 373
231 3300046660 Ga0495625_0075720 Ga0495625_0075720_934_2100 373
232 3300046665 Ga0495661_0003217 Ga0495661_0003217_2756_3949 373
233 3300046665 Ga0495661_0003891 Ga0495661_0003891_1153_2334 373
234 3300046665 Ga0495661_0025617 Ga0495661_0025617_495_1688 373
235 3300046694 Ga0495649_0000018 Ga0495649_0000018_64034_65227 373
236 3300047443 Ga0495687_000972 Ga0495687_000972_2596_3789 373
237 3300047443 Ga0495687_001574 Ga0495687_001574_2283_3455 373
238 3300047446 Ga0495679_025297 Ga0495679_025297_655_1848 373
239 3300047472 Ga0495686_0000052 Ga0495686_0000052_192496_193662 373
240 3300050493 nmdc:mga0k408_13355_c1 nmdc:mga0k408_13355_c1_322_1533 373
241 3300050496 nmdc:mga07m45_48083_c1 nmdc:mga07m45_48083_c1_145_1305 373
242 3300053080 Ga0500635_0002470 Ga0500635_0002470_945_2111 373
243 3300053157 Ga0500624_000134 Ga0500624_000134_24442_25629 373
244 3300013102 Ga0157371_10070860 Ga0157371_100708603 375
245 3300013104 Ga0157370_10132970 Ga0157370_101329703 375
246 3300025919 Ga0207657_10168624 Ga0207657_101686242 375
247 3300042876 Ga0451577_0071769 Ga0451577_0071769_1761_3029 375
248 3300044712 Ga0453684_0096941 Ga0453684_0096941_2263_3531 375
249 3300001979 JGI24740J21852_10005096 JGI24740J21852_100050967 391
250 3300013102 Ga0157371_10014776 Ga0157371_100147767 391
251 3300013105 Ga0157369_10002318 Ga0157369_100023187 391
252 3300013307 Ga0157372_10000034 Ga0157372_1000003484 391
253 3300037312 Ga0395899_0000182 Ga0395899_0000182_9544_10719 391
254 3300044684 Ga0466966_0073976 Ga0466966_0073976_646_1842 391
255 3300045836 Ga0466958_0033030 Ga0466958_0033030_1563_2759 391

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

203

361

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h4e-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8354 200 382
1hjj-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8328 200 382
1h4c-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8315 200 382
1hjl-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8312 200 382
1h4d-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.8303 200 382
ID Description Score Start End Superfamily
af_Q2FVY4_1_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8675 202 383 3.90.550.10
af_Q59057_8_204_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8397 204 380 3.90.550.10
1frwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8294 198 381 3.90.550.10
af_P9WJQ9_9_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8188 200 380 3.90.550.10
1frwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8052 198 381 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2U2PDM4-F1-model_v4 Molybdenum cofactor guanylyltransferase 0.9797 198 385 GO:0005525
GO:0006777
GO:0016779
AF-A0A519UI39-F1-model_v4 MobA-like NTP transferase domain-containing protein 0.977 275 385 GO:0016779
AF-A0A1G9TBK6-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9754 198 383 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0061603
AF-A0A1I5NZ73-F1-model_v4 Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9703 197 388 GO:0005525
GO:0005737
GO:0006777
GO:0046872
GO:0061603
AF-A0A4Q2ZKG7-F1-model_v4 deleted 0.969 184 386

Feature Viewer

pLDDT pTM Quality
89.22 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map