F365339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 255 | 145 | 245 | 388 |
Family's Representative Sequence
| Representative Sequence | 3300001989|JGI24739J22299_10004907|JGI24739J22299_100049072 |
| Length | 403 |
| Sequence | VTLKDHNQPSSTHKKHAKLARPSTGNFGRNEWAILGGPCTVIKLLADDVIRSLSPVYKCAYVDMSHNDDITLLPGRLVGGASLEYTDQVNYQQFNYQNPVYPYQLKQQFSFADLILVNGNHQQANAQIVIIDSNKETSLQKRTAQLNNVQLFLLADNASQIPGFIQEVLPHWQQIPVLKVDDRERIVAFFETALKQAKPVLNGLVLAGGKSTRMGFDKGAAKWHGKQQRYYMADLLKTFCREVYISGRPGQQQEIDPAYPVIEDTFTGLGPYGAILSAFREQPDAAWLVIACDLPLMDDATLRNLVAWRNSSSVATAYHSPVTNFPEPLIAIWEPKSYPVLLSFLAQGYSCPRKVLINSDITLLNAPQQEALTNVNTPEELEKVKSMIHHTIVATNESGFTTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 3 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 4 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 5 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 8 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 9 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 10 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 11 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 70 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 107 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 108 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 109 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 110 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 111 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 112 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 113 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 114 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 115 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 139 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 140 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 141 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 142 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 143 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 144 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 145 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.29 |
| Metatranscriptomes | 0.78 |
| Isolates | 3.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.2 |
| Nodule | 0 |
| Rhizoplane | 0.39 |
| Rhizosphere | 82.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005096 | 3300001979 | Bacteria | 5579 |
| 2 | JGI24740J21852_10017665 | 3300001979 | Bacteria | 2545 |
| 3 | JGI24739J22299_10004907 | 3300001989 | Bacteria | 5096 |
| 4 | JGI24737J22298_10003849 | 3300001990 | Bacteria | 5277 |
| 5 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 6 | JGI24744J21845_10002604 | 3300002077 | Bacteria | 3685 |
| 7 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 8 | JGI25162J39368_1002129 | 3300002737 | Bacteria | 8382 |
| 9 | JGI25164J39214_1002241 | 3300002772 | Bacteria | 3152 |
| 10 | JGI25406J46586_10013358 | 3300003203 | Bacteria | 3530 |
| 11 | JGI25165J46597_1001445 | 3300003214 | Bacteria | 12601 |
| 12 | rootH1_10005314 | 3300003316 | Bacteria | 25578 |
| 13 | rootH1_10108125 | 3300003316 | Bacteria | 2302 |
| 14 | rootH2_10001101 | 3300003320 | Bacteria | 45863 |
| 15 | rootH2_10043765 | 3300003320 | Bacteria | 15088 |
| 16 | rootH2_10215700 | 3300003320 | Bacteria | 2621 |
| 17 | rootH1_10009528 | 3300003323 | Bacteria | 31356 |
| 18 | rootH1_10158475 | 3300003323 | Bacteria | 2210 |
| 19 | rootH1_10232185 | 3300003323 | Bacteria | 3721 |
| 20 | JGI25160J50197_1010557 | 3300003354 | Unclassified | 3329 |
| 21 | Ga0058863_11903483 | 3300004799 | Bacteria | 5348 |
| 22 | Ga0065714_10006471 | 3300005288 | Bacteria | 5544 |
| 23 | Ga0070658_10000011 | 3300005327 | Bacteria | 294396 |
| 24 | Ga0070658_10059182 | 3300005327 | Bacteria | 3120 |
| 25 | Ga0070658_10119943 | 3300005327 | Bacteria | 2185 |
| 26 | Ga0070676_10000471 | 3300005328 | Bacteria | 19324 |
| 27 | Ga0070660_100014306 | 3300005339 | Bacteria | 5714 |
| 28 | Ga0070671_100029755 | 3300005355 | Bacteria | 4505 |
| 29 | Ga0070674_100117968 | 3300005356 | Unclassified | 1960 |
| 30 | Ga0070673_100006304 | 3300005364 | Bacteria | 7702 |
| 31 | Ga0070659_100004095 | 3300005366 | Bacteria | 10394 |
| 32 | Ga0070659_100038481 | 3300005366 | Unclassified | 3730 |
| 33 | Ga0070678_100002096 | 3300005456 | Bacteria | 10811 |
| 34 | Ga0068867_100003012 | 3300005459 | Bacteria | 11876 |
| 35 | Ga0070679_100032826 | 3300005530 | Bacteria | 5138 |
| 36 | Ga0070684_100121665 | 3300005535 | Unclassified | 2348 |
| 37 | Ga0068853_100049786 | 3300005539 | Bacteria | 3602 |
| 38 | Ga0068855_100000070 | 3300005563 | Bacteria | 123584 |
| 39 | Ga0068855_100000388 | 3300005563 | Bacteria | 54070 |
| 40 | Ga0068855_100010991 | 3300005563 | Bacteria | 10924 |
| 41 | Ga0068855_100017518 | 3300005563 | Bacteria | 8614 |
| 42 | Ga0068855_100208154 | 3300005563 | Unclassified | 2199 |
| 43 | Ga0070664_100104407 | 3300005564 | Bacteria | 2467 |
| 44 | Ga0068857_100037446 | 3300005577 | Bacteria | 4297 |
| 45 | Ga0068856_100005531 | 3300005614 | Bacteria | 12443 |
| 46 | Ga0068852_100006806 | 3300005616 | Bacteria | 8299 |
| 47 | Ga0068863_100250969 | 3300005841 | Bacteria | 1709 |
| 48 | Ga0081539_10001000 | 3300005985 | Bacteria | 52492 |
| 49 | Ga0081539_10027743 | 3300005985 | Bacteria | 3578 |
| 50 | Ga0075366_10002253 | 3300006195 | Bacteria | 9856 |
| 51 | Ga0075366_10029400 | 3300006195 | Bacteria | 3228 |
| 52 | Ga0097621_100000020 | 3300006237 | Bacteria | 86226 |
| 53 | Ga0075370_10048843 | 3300006353 | Unclassified | 2398 |
| 54 | Ga0068871_100000130 | 3300006358 | Bacteria | 47875 |
| 55 | Ga0068871_100203341 | 3300006358 | Bacteria | 1711 |
| 56 | Ga0068865_100000050 | 3300006881 | Bacteria | 65632 |
| 57 | Ga0105240_10000728 | 3300009093 | Bacteria | 60140 |
| 58 | Ga0105240_10010235 | 3300009093 | Bacteria | 13201 |
| 59 | Ga0105240_10018707 | 3300009093 | Bacteria | 9281 |
| 60 | Ga0105240_10035414 | 3300009093 | Bacteria | 6433 |
| 61 | Ga0105240_10261596 | 3300009093 | Bacteria | 1996 |
| 62 | Ga0105240_10299615 | 3300009093 | Bacteria | 1839 |
| 63 | Ga0105240_10320941 | 3300009093 | Bacteria | 1765 |
| 64 | Ga0105240_10341939 | 3300009093 | Bacteria | 1699 |
| 65 | Ga0105240_10472095 | 3300009093 | Bacteria | 1400 |
| 66 | Ga0105245_10029178 | 3300009098 | Bacteria | 4872 |
| 67 | Ga0105241_10000281 | 3300009174 | Bacteria | 37919 |
| 68 | Ga0105241_10009625 | 3300009174 | Bacteria | 7101 |
| 69 | Ga0105241_10063493 | 3300009174 | Unclassified | 2850 |
| 70 | Ga0105242_10017684 | 3300009176 | Bacteria | 5561 |
| 71 | Ga0105237_10000841 | 3300009545 | Bacteria | 41862 |
| 72 | Ga0105237_10003737 | 3300009545 | Bacteria | 17929 |
| 73 | Ga0105237_10005432 | 3300009545 | Bacteria | 14392 |
| 74 | Ga0105237_10018441 | 3300009545 | Bacteria | 7222 |
| 75 | Ga0105237_10053178 | 3300009545 | Bacteria | 4062 |
| 76 | Ga0105237_10140523 | 3300009545 | Bacteria | 2409 |
| 77 | Ga0105238_10018941 | 3300009551 | Bacteria | 7009 |
| 78 | Ga0105238_10208784 | 3300009551 | Bacteria | 1929 |
| 79 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 80 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 81 | Ga0105239_10000445 | 3300010375 | Bacteria | 60337 |
| 82 | Ga0105239_10000959 | 3300010375 | Bacteria | 40551 |
| 83 | Ga0105239_10006358 | 3300010375 | Bacteria | 13727 |
| 84 | Ga0105239_10008543 | 3300010375 | Bacteria | 11630 |
| 85 | Ga0105239_10077424 | 3300010375 | Bacteria | 3659 |
| 86 | Ga0105239_10081977 | 3300010375 | Bacteria | 3551 |
| 87 | Ga0105239_10207639 | 3300010375 | Bacteria | 2195 |
| 88 | Ga0105239_10363443 | 3300010375 | Bacteria | 1635 |
| 89 | Ga0105239_10417369 | 3300010375 | Bacteria | 1520 |
| 90 | Ga0105246_10012536 | 3300011119 | Bacteria | 5294 |
| 91 | Ga0157371_10000269 | 3300013102 | Bacteria | 70787 |
| 92 | Ga0157371_10014776 | 3300013102 | Bacteria | 5877 |
| 93 | Ga0157371_10032880 | 3300013102 | Bacteria | 3730 |
| 94 | Ga0157371_10070860 | 3300013102 | Bacteria | 2468 |
| 95 | Ga0157371_10102234 | 3300013102 | Unclassified | 2033 |
| 96 | Ga0157370_10083214 | 3300013104 | Bacteria | 3009 |
| 97 | Ga0157370_10132970 | 3300013104 | Bacteria | 2320 |
| 98 | Ga0157369_10002318 | 3300013105 | Bacteria | 22909 |
| 99 | Ga0157369_10099032 | 3300013105 | Bacteria | 3108 |
| 100 | Ga0157369_10157365 | 3300013105 | Unclassified | 2399 |
| 101 | Ga0157374_10003065 | 3300013296 | Bacteria | 14011 |
| 102 | Ga0157374_10032460 | 3300013296 | Bacteria | 4754 |
| 103 | Ga0157378_10011737 | 3300013297 | Bacteria | 7670 |
| 104 | Ga0157378_10158271 | 3300013297 | Bacteria | 2116 |
| 105 | Ga0163162_10000031 | 3300013306 | Bacteria | 157666 |
| 106 | Ga0163162_10005497 | 3300013306 | Bacteria | 12245 |
| 107 | Ga0163162_10006956 | 3300013306 | Bacteria | 10971 |
| 108 | Ga0163162_10360658 | 3300013306 | Bacteria | 1586 |
| 109 | Ga0157372_10000034 | 3300013307 | Bacteria | 174784 |
| 110 | Ga0157372_10001534 | 3300013307 | Bacteria | 25119 |
| 111 | Ga0157372_10002075 | 3300013307 | Bacteria | 21762 |
| 112 | Ga0157372_10074598 | 3300013307 | Bacteria | 3826 |
| 113 | Ga0157372_10261500 | 3300013307 | Unclassified | 2010 |
| 114 | Ga0157375_10016536 | 3300013308 | Bacteria | 6632 |
| 115 | Ga0157375_10070001 | 3300013308 | Bacteria | 3516 |
| 116 | Ga0157377_10120996 | 3300014745 | Bacteria | 1586 |
| 117 | Ga0163161_10014065 | 3300017792 | Bacteria | 5572 |
| 118 | Ga0206351_10035624 | 3300020077 | Bacteria | 2310 |
| 119 | Ga0213872_10008555 | 3300021361 | Bacteria | 4949 |
| 120 | Ga0209563_104761 | 3300025230 | Bacteria | 2545 |
| 121 | Ga0207427_100766 | 3300025231 | Bacteria | 14625 |
| 122 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 123 | Ga0209437_100052 | 3300025233 | Bacteria | 380548 |
| 124 | Ga0209233_1000067 | 3300025261 | Bacteria | 380554 |
| 125 | Ga0209233_1001304 | 3300025261 | Bacteria | 9948 |
| 126 | Ga0209455_1004456 | 3300025272 | Bacteria | 4576 |
| 127 | Ga0207426_1000030 | 3300025302 | Bacteria | 461478 |
| 128 | Ga0207647_10000463 | 3300025904 | Bacteria | 32923 |
| 129 | Ga0207647_10002317 | 3300025904 | Bacteria | 14485 |
| 130 | Ga0207645_10000082 | 3300025907 | Bacteria | 68372 |
| 131 | Ga0207705_10000015 | 3300025909 | Bacteria | 382901 |
| 132 | Ga0207654_10094726 | 3300025911 | Bacteria | 1828 |
| 133 | Ga0207707_10029641 | 3300025912 | Bacteria | 4785 |
| 134 | Ga0207695_10000189 | 3300025913 | Bacteria | 177142 |
| 135 | Ga0207695_10010555 | 3300025913 | Bacteria | 11295 |
| 136 | Ga0207695_10030752 | 3300025913 | Bacteria | 5907 |
| 137 | Ga0207695_10045184 | 3300025913 | Bacteria | 4678 |
| 138 | Ga0207695_10140873 | 3300025913 | Bacteria | 2360 |
| 139 | Ga0207695_10169042 | 3300025913 | Unclassified | 2113 |
| 140 | Ga0207695_10205683 | 3300025913 | Bacteria | 1881 |
| 141 | Ga0207671_10001801 | 3300025914 | Bacteria | 23958 |
| 142 | Ga0207671_10002710 | 3300025914 | Bacteria | 18563 |
| 143 | Ga0207671_10004889 | 3300025914 | Bacteria | 12594 |
| 144 | Ga0207671_10062274 | 3300025914 | Bacteria | 2770 |
| 145 | Ga0207660_10157758 | 3300025917 | Bacteria | 1748 |
| 146 | Ga0207657_10108422 | 3300025919 | Bacteria | 2296 |
| 147 | Ga0207657_10118301 | 3300025919 | Bacteria | 2181 |
| 148 | Ga0207657_10148646 | 3300025919 | Bacteria | 1909 |
| 149 | Ga0207657_10168624 | 3300025919 | Bacteria | 1775 |
| 150 | Ga0207652_10125616 | 3300025921 | Bacteria | 2285 |
| 151 | Ga0207694_10248463 | 3300025924 | Bacteria | 1455 |
| 152 | Ga0207659_10110951 | 3300025926 | Unclassified | 2085 |
| 153 | Ga0207644_10025333 | 3300025931 | Bacteria | 4080 |
| 154 | Ga0207690_10018517 | 3300025932 | Bacteria | 4271 |
| 155 | Ga0207690_10137058 | 3300025932 | Bacteria | 1798 |
| 156 | Ga0207706_10001363 | 3300025933 | Bacteria | 24429 |
| 157 | Ga0207686_10184868 | 3300025934 | Bacteria | 1481 |
| 158 | Ga0207669_10099444 | 3300025937 | Unclassified | 1918 |
| 159 | Ga0207704_10000078 | 3300025938 | Bacteria | 59491 |
| 160 | Ga0207691_10259603 | 3300025940 | Bacteria | 1498 |
| 161 | Ga0207661_10217722 | 3300025944 | Unclassified | 1686 |
| 162 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 163 | Ga0207667_10001584 | 3300025949 | Bacteria | 28609 |
| 164 | Ga0207667_10013812 | 3300025949 | Bacteria | 9224 |
| 165 | Ga0207667_10037382 | 3300025949 | Bacteria | 5190 |
| 166 | Ga0207667_10056234 | 3300025949 | Bacteria | 4134 |
| 167 | Ga0207651_10003963 | 3300025960 | Bacteria | 7353 |
| 168 | Ga0207677_10052982 | 3300026023 | Unclassified | 2759 |
| 169 | Ga0207639_10002536 | 3300026041 | Bacteria | 12254 |
| 170 | Ga0207702_10001984 | 3300026078 | Bacteria | 19874 |
| 171 | Ga0207702_10269877 | 3300026078 | Unclassified | 1604 |
| 172 | Ga0207702_10310910 | 3300026078 | Bacteria | 1498 |
| 173 | Ga0207648_10000472 | 3300026089 | Bacteria | 44933 |
| 174 | Ga0207683_10014226 | 3300026121 | Bacteria | 6778 |
| 175 | Ga0268264_10175717 | 3300028381 | Bacteria | 1941 |
| 176 | Ga0307517_10013049 | 3300028786 | Bacteria | 11328 |
| 177 | Ga0307515_10000280 | 3300028794 | Bacteria | 125330 |
| 178 | Ga0307515_10000353 | 3300028794 | Bacteria | 112876 |
| 179 | Ga0265327_10000527 | 3300031251 | Bacteria | 65908 |
| 180 | Ga0307507_10000345 | 3300033179 | Bacteria | 94462 |
| 181 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 182 | Ga0395899_0000182 | 3300037312 | Bacteria | 92470 |
| 183 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 184 | Ga0395900_0000128 | 3300037418 | Bacteria | 127446 |
| 185 | Ga0395900_0005426 | 3300037418 | Bacteria | 13362 |
| 186 | Ga0395898_0021189 | 3300037466 | Bacteria | 6594 |
| 187 | Ga0395905_0000037 | 3300037471 | Bacteria | 261808 |
| 188 | Ga0395905_0006237 | 3300037471 | Bacteria | 12038 |
| 189 | Ga0395901_0000166 | 3300038443 | Bacteria | 86352 |
| 190 | Ga0395901_0146047 | 3300038443 | Bacteria | 2486 |
| 191 | Ga0395901_0201542 | 3300038443 | Bacteria | 2086 |
| 192 | Ga0436361_0360494 | 3300039447 | Bacteria | 8737 |
| 193 | Ga0439448_0052261 | 3300042005 | Bacteria | 1339 |
| 194 | Ga0451577_0000120 | 3300042876 | Bacteria | 172425 |
| 195 | Ga0451577_0011145 | 3300042876 | Bacteria | 8528 |
| 196 | Ga0451577_0071769 | 3300042876 | Unclassified | 3088 |
| 197 | Ga0466966_0073976 | 3300044684 | Bacteria | 2130 |
| 198 | Ga0453684_0096941 | 3300044712 | Bacteria | 3621 |
| 199 | Ga0466958_0033030 | 3300045836 | Bacteria | 3082 |
| 200 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 201 | Ga0495585_0000167 | 3300046492 | Bacteria | 70874 |
| 202 | Ga0495585_0013561 | 3300046492 | Bacteria | 4763 |
| 203 | Ga0495583_0069507 | 3300046506 | Bacteria | 1551 |
| 204 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 205 | Ga0495606_0008205 | 3300046507 | Bacteria | 9134 |
| 206 | Ga0495606_0012014 | 3300046507 | Bacteria | 6993 |
| 207 | Ga0495606_0026982 | 3300046507 | Bacteria | 4080 |
| 208 | Ga0495610_0001840 | 3300046512 | Bacteria | 18389 |
| 209 | Ga0495610_0064142 | 3300046512 | Bacteria | 1737 |
| 210 | Ga0495616_0002580 | 3300046513 | Bacteria | 11923 |
| 211 | Ga0495616_0005811 | 3300046513 | Bacteria | 7538 |
| 212 | Ga0495648_0005125 | 3300046524 | Bacteria | 10975 |
| 213 | Ga0495654_0034622 | 3300046530 | Bacteria | 2547 |
| 214 | Ga0495609_0016612 | 3300046538 | Bacteria | 3427 |
| 215 | Ga0495633_0000029 | 3300046558 | Bacteria | 200381 |
| 216 | Ga0495633_0021535 | 3300046558 | Bacteria | 3223 |
| 217 | Ga0495668_0000070 | 3300046616 | Bacteria | 174051 |
| 218 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 219 | Ga0495625_0001080 | 3300046660 | Bacteria | 35353 |
| 220 | Ga0495625_0001647 | 3300046660 | Bacteria | 26189 |
| 221 | Ga0495625_0014767 | 3300046660 | Bacteria | 6216 |
| 222 | Ga0495625_0075720 | 3300046660 | Bacteria | 2354 |
| 223 | Ga0495661_0003217 | 3300046665 | Bacteria | 12191 |
| 224 | Ga0495661_0003891 | 3300046665 | Bacteria | 10914 |
| 225 | Ga0495661_0025617 | 3300046665 | Bacteria | 3808 |
| 226 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 227 | Ga0495687_000972 | 3300047443 | Bacteria | 29181 |
| 228 | Ga0495687_001574 | 3300047443 | Bacteria | 20718 |
| 229 | Ga0495677_0021762 | 3300047445 | Bacteria | 2324 |
| 230 | Ga0495679_025297 | 3300047446 | Bacteria | 1987 |
| 231 | Ga0495686_0000052 | 3300047472 | Bacteria | 262622 |
| 232 | Ga0495686_0025603 | 3300047472 | Bacteria | 3867 |
| 233 | Ga0495686_0030076 | 3300047472 | Unclassified | 3530 |
| 234 | Ga0495686_0179862 | 3300047472 | Bacteria | 1226 |
| 235 | Ga0495614_0055830 | 3300048089 | Bacteria | 1694 |
| 236 | nmdc:mga0k408_13355_c1 | 3300050493 | Bacteria | 4502 |
| 237 | nmdc:mga0k408_2290_c1 | 3300050493 | Bacteria | 10217 |
| 238 | nmdc:mga07m45_48083_c1 | 3300050496 | Unclassified | 2398 |
| 239 | nmdc:mga07m45_94502_c2 | 3300050496 | Bacteria | 1355 |
| 240 | Ga0500635_0002470 | 3300053080 | Bacteria | 4588 |
| 241 | Ga0500608_028201 | 3300053122 | Bacteria | 2650 |
| 242 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 243 | Ga0500559_0040246 | 3300053136 | Bacteria | 2035 |
| 244 | Ga0500622_0000891 | 3300053156 | Bacteria | 25423 |
| 245 | Ga0500624_000134 | 3300053157 | Bacteria | 31729 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047472 | Ga0495686_0179862 | Ga0495686_0179862_43_1053 | 320 |
| 2 | 3300053122 | Ga0500608_028201 | Ga0500608_028201_443_1609 | 341 |
| 3 | 3300005614 | Ga0068856_100005531 | Ga0068856_1000055315 | 344 |
| 4 | 3300050496 | nmdc:mga07m45_94502_c2 | nmdc:mga07m45_94502_c2_91_1218 | 344 |
| 5 | 3300047445 | Ga0495677_0021762 | Ga0495677_0021762_970_2133 | 351 |
| 6 | 3300037418 | Ga0395900_0005426 | Ga0395900_0005426_9705_10823 | 352 |
| 7 | 3300037471 | Ga0395905_0006237 | Ga0395905_0006237_10365_11483 | 352 |
| 8 | 3300038443 | Ga0395901_0146047 | Ga0395901_0146047_978_2096 | 352 |
| 9 | 3300046506 | Ga0495583_0069507 | Ga0495583_0069507_192_1358 | 352 |
| 10 | 3300053156 | Ga0500622_0000891 | Ga0500622_0000891_22383_23549 | 353 |
| 11 | 3300047472 | Ga0495686_0025603 | Ga0495686_0025603_1566_2669 | 354 |
| 12 | 3300042876 | Ga0451577_0011145 | Ga0451577_0011145_1712_2848 | 355 |
| 13 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_1306142_1307257 | 356 |
| 14 | 3300006195 | Ga0075366_10002253 | Ga0075366_100022533 | 359 |
| 15 | 3300050493 | nmdc:mga0k408_2290_c1 | nmdc:mga0k408_2290_c1_7372_8544 | 359 |
| 16 | 3300028794 | Ga0307515_10000353 | Ga0307515_1000035335 | 360 |
| 17 | 3300046524 | Ga0495648_0005125 | Ga0495648_0005125_7611_8795 | 360 |
| 18 | 3300046530 | Ga0495654_0034622 | Ga0495654_0034622_952_2136 | 360 |
| 19 | 3300046660 | Ga0495625_0001080 | Ga0495625_0001080_17870_19054 | 360 |
| 20 | 3300025913 | Ga0207695_10205683 | Ga0207695_102056832 | 361 |
| 21 | 3300048089 | Ga0495614_0055830 | Ga0495614_0055830_145_1329 | 361 |
| 22 | 3300005539 | Ga0068853_100049786 | Ga0068853_1000497864 | 362 |
| 23 | 3300006237 | Ga0097621_100000020 | Ga0097621_10000002076 | 362 |
| 24 | 3300006358 | Ga0068871_100000130 | Ga0068871_10000013022 | 362 |
| 25 | 3300006881 | Ga0068865_100000050 | Ga0068865_10000005029 | 362 |
| 26 | 3300025904 | Ga0207647_10002317 | Ga0207647_100023176 | 362 |
| 27 | 3300025907 | Ga0207645_10000082 | Ga0207645_1000008248 | 362 |
| 28 | 3300025913 | Ga0207695_10045184 | Ga0207695_100451843 | 362 |
| 29 | 3300025933 | Ga0207706_10001363 | Ga0207706_1000136314 | 362 |
| 30 | 3300025938 | Ga0207704_10000078 | Ga0207704_1000007831 | 362 |
| 31 | 3300026041 | Ga0207639_10002536 | Ga0207639_1000253610 | 362 |
| 32 | 3300026089 | Ga0207648_10000472 | Ga0207648_1000047223 | 362 |
| 33 | 3300033179 | Ga0307507_10000345 | Ga0307507_1000034583 | 364 |
| 34 | 3300010375 | Ga0105239_10077424 | Ga0105239_100774243 | 365 |
| 35 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_94673_95869 | 366 |
| 36 | iso_pu_bacteria | 2977232053 | 2977234300 | 366 |
| 37 | 3300025261 | Ga0209233_1001304 | Ga0209233_10013046 | 367 |
| 38 | 3300042876 | Ga0451577_0000120 | Ga0451577_0000120_111962_113101 | 368 |
| 39 | 3300046507 | Ga0495606_0008205 | Ga0495606_0008205_6674_7819 | 368 |
| 40 | iso_pu_bacteria | 2739367866 | 2740031916 | 368 |
| 41 | 3300009545 | Ga0105237_10140523 | Ga0105237_101405232 | 369 |
| 42 | 3300009551 | Ga0105238_10208784 | Ga0105238_102087843 | 369 |
| 43 | 3300010375 | Ga0105239_10000012 | Ga0105239_10000012188 | 369 |
| 44 | 3300025914 | Ga0207671_10001801 | Ga0207671_1000180118 | 369 |
| 45 | 3300025924 | Ga0207694_10248463 | Ga0207694_102484632 | 369 |
| 46 | 3300046558 | Ga0495633_0000029 | Ga0495633_0000029_153505_154695 | 369 |
| 47 | iso_pu_bacteria | 2599185184 | 2599478265 | 369 |
| 48 | iso_pu_bacteria | 2852623160 | 2852623772 | 369 |
| 49 | iso_pu_bacteria | 2884933994 | 2884937322 | 369 |
| 50 | iso_pu_bacteria | 2919437846 | 2919438960 | 369 |
| 51 | iso_pu_bacteria | 2928078545 | 2928080685 | 369 |
| 52 | iso_pu_bacteria | 2928147474 | 2928150910 | 369 |
| 53 | iso_pu_bacteria | 2932082852 | 2932082931 | 369 |
| 54 | 3300003320 | rootH2_10215700 | rootH2_102157002 | 370 |
| 55 | 3300006358 | Ga0068871_100203341 | Ga0068871_1002033412 | 370 |
| 56 | 3300010375 | Ga0105239_10363443 | Ga0105239_103634432 | 370 |
| 57 | 3300025940 | Ga0207691_10259603 | Ga0207691_102596032 | 370 |
| 58 | 3300028381 | Ga0268264_10175717 | Ga0268264_101757172 | 370 |
| 59 | 3300001979 | JGI24740J21852_10017665 | JGI24740J21852_100176652 | 371 |
| 60 | 3300003203 | JGI25406J46586_10013358 | JGI25406J46586_100133585 | 371 |
| 61 | 3300003354 | JGI25160J50197_1010557 | JGI25160J50197_10105573 | 371 |
| 62 | 3300005339 | Ga0070660_100014306 | Ga0070660_1000143063 | 371 |
| 63 | 3300005366 | Ga0070659_100038481 | Ga0070659_1000384811 | 371 |
| 64 | 3300005535 | Ga0070684_100121665 | Ga0070684_1001216651 | 371 |
| 65 | 3300005563 | Ga0068855_100208154 | Ga0068855_1002081542 | 371 |
| 66 | 3300005564 | Ga0070664_100104407 | Ga0070664_1001044072 | 371 |
| 67 | 3300005841 | Ga0068863_100250969 | Ga0068863_1002509692 | 371 |
| 68 | 3300005985 | Ga0081539_10001000 | Ga0081539_100010002 | 371 |
| 69 | 3300005985 | Ga0081539_10027743 | Ga0081539_100277432 | 371 |
| 70 | 3300009545 | Ga0105237_10018441 | Ga0105237_100184415 | 371 |
| 71 | 3300010375 | Ga0105239_10081977 | Ga0105239_100819773 | 371 |
| 72 | 3300013102 | Ga0157371_10102234 | Ga0157371_101022342 | 371 |
| 73 | 3300013105 | Ga0157369_10157365 | Ga0157369_101573653 | 371 |
| 74 | 3300013296 | Ga0157374_10032460 | Ga0157374_100324602 | 371 |
| 75 | 3300013307 | Ga0157372_10074598 | Ga0157372_100745981 | 371 |
| 76 | 3300013307 | Ga0157372_10261500 | Ga0157372_102615002 | 371 |
| 77 | 3300025302 | Ga0207426_1000030 | Ga0207426_1000030213 | 371 |
| 78 | 3300025914 | Ga0207671_10062274 | Ga0207671_100622741 | 371 |
| 79 | 3300025917 | Ga0207660_10157758 | Ga0207660_101577582 | 371 |
| 80 | 3300025919 | Ga0207657_10118301 | Ga0207657_101183012 | 371 |
| 81 | 3300025926 | Ga0207659_10110951 | Ga0207659_101109512 | 371 |
| 82 | 3300025932 | Ga0207690_10137058 | Ga0207690_101370582 | 371 |
| 83 | 3300025944 | Ga0207661_10217722 | Ga0207661_102177222 | 371 |
| 84 | 3300025949 | Ga0207667_10056234 | Ga0207667_100562343 | 371 |
| 85 | 3300026023 | Ga0207677_10052982 | Ga0207677_100529822 | 371 |
| 86 | 3300026078 | Ga0207702_10269877 | Ga0207702_102698772 | 371 |
| 87 | 3300053136 | Ga0500559_0040246 | Ga0500559_0040246_718_1857 | 371 |
| 88 | iso_pu_bacteria | 2839989709 | 2839992638 | 371 |
| 89 | 3300003323 | rootH1_10232185 | rootH1_102321852 | 372 |
| 90 | 3300009093 | Ga0105240_10341939 | Ga0105240_103419392 | 372 |
| 91 | 3300013306 | Ga0163162_10005497 | Ga0163162_1000549712 | 372 |
| 92 | 3300025913 | Ga0207695_10169042 | Ga0207695_101690421 | 372 |
| 93 | 3300031251 | Ga0265327_10000527 | Ga0265327_1000052749 | 372 |
| 94 | 3300047472 | Ga0495686_0030076 | Ga0495686_0030076_1260_2423 | 372 |
| 95 | 3300001989 | JGI24739J22299_10004907 | JGI24739J22299_100049072 | 373 |
| 96 | 3300001990 | JGI24737J22298_10003849 | JGI24737J22298_100038494 | 373 |
| 97 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_10000004173 | 373 |
| 98 | 3300002077 | JGI24744J21845_10002604 | JGI24744J21845_100026045 | 373 |
| 99 | 3300002737 | JGI25162J39368_1000017 | JGI25162J39368_100001782 | 373 |
| 100 | 3300002737 | JGI25162J39368_1002129 | JGI25162J39368_10021299 | 373 |
| 101 | 3300002772 | JGI25164J39214_1002241 | JGI25164J39214_10022413 | 373 |
| 102 | 3300003214 | JGI25165J46597_1001445 | JGI25165J46597_10014455 | 373 |
| 103 | 3300003316 | rootH1_10005314 | rootH1_1000531417 | 373 |
| 104 | 3300003316 | rootH1_10108125 | rootH1_101081252 | 373 |
| 105 | 3300003320 | rootH2_10001101 | rootH2_1000110126 | 373 |
| 106 | 3300003320 | rootH2_10043765 | rootH2_1004376510 | 373 |
| 107 | 3300003323 | rootH1_10009528 | rootH1_1000952819 | 373 |
| 108 | 3300003323 | rootH1_10158475 | rootH1_101584752 | 373 |
| 109 | 3300004799 | Ga0058863_11903483 | Ga0058863_119034834 | 373 |
| 110 | 3300005288 | Ga0065714_10006471 | Ga0065714_100064717 | 373 |
| 111 | 3300005327 | Ga0070658_10000011 | Ga0070658_10000011100 | 373 |
| 112 | 3300005327 | Ga0070658_10059182 | Ga0070658_100591822 | 373 |
| 113 | 3300005327 | Ga0070658_10119943 | Ga0070658_101199432 | 373 |
| 114 | 3300005328 | Ga0070676_10000471 | Ga0070676_100004717 | 373 |
| 115 | 3300005355 | Ga0070671_100029755 | Ga0070671_1000297552 | 373 |
| 116 | 3300005356 | Ga0070674_100117968 | Ga0070674_1001179682 | 373 |
| 117 | 3300005364 | Ga0070673_100006304 | Ga0070673_1000063042 | 373 |
| 118 | 3300005366 | Ga0070659_100004095 | Ga0070659_10000409511 | 373 |
| 119 | 3300005456 | Ga0070678_100002096 | Ga0070678_1000020967 | 373 |
| 120 | 3300005459 | Ga0068867_100003012 | Ga0068867_1000030129 | 373 |
| 121 | 3300005530 | Ga0070679_100032826 | Ga0070679_1000328263 | 373 |
| 122 | 3300005563 | Ga0068855_100000070 | Ga0068855_10000007040 | 373 |
| 123 | 3300005563 | Ga0068855_100000388 | Ga0068855_10000038850 | 373 |
| 124 | 3300005563 | Ga0068855_100010991 | Ga0068855_1000109919 | 373 |
| 125 | 3300005563 | Ga0068855_100017518 | Ga0068855_1000175182 | 373 |
| 126 | 3300005577 | Ga0068857_100037446 | Ga0068857_1000374463 | 373 |
| 127 | 3300005616 | Ga0068852_100006806 | Ga0068852_1000068067 | 373 |
| 128 | 3300006195 | Ga0075366_10029400 | Ga0075366_100294003 | 373 |
| 129 | 3300006353 | Ga0075370_10048843 | Ga0075370_100488432 | 373 |
| 130 | 3300009093 | Ga0105240_10000728 | Ga0105240_100007289 | 373 |
| 131 | 3300009093 | Ga0105240_10010235 | Ga0105240_100102359 | 373 |
| 132 | 3300009093 | Ga0105240_10018707 | Ga0105240_100187079 | 373 |
| 133 | 3300009093 | Ga0105240_10035414 | Ga0105240_100354142 | 373 |
| 134 | 3300009093 | Ga0105240_10261596 | Ga0105240_102615962 | 373 |
| 135 | 3300009093 | Ga0105240_10299615 | Ga0105240_102996152 | 373 |
| 136 | 3300009093 | Ga0105240_10320941 | Ga0105240_103209412 | 373 |
| 137 | 3300009093 | Ga0105240_10472095 | Ga0105240_104720952 | 373 |
| 138 | 3300009098 | Ga0105245_10029178 | Ga0105245_100291782 | 373 |
| 139 | 3300009174 | Ga0105241_10000281 | Ga0105241_1000028130 | 373 |
| 140 | 3300009174 | Ga0105241_10009625 | Ga0105241_100096256 | 373 |
| 141 | 3300009174 | Ga0105241_10063493 | Ga0105241_100634933 | 373 |
| 142 | 3300009176 | Ga0105242_10017684 | Ga0105242_100176844 | 373 |
| 143 | 3300009545 | Ga0105237_10000841 | Ga0105237_100008415 | 373 |
| 144 | 3300009545 | Ga0105237_10003737 | Ga0105237_1000373717 | 373 |
| 145 | 3300009545 | Ga0105237_10005432 | Ga0105237_100054327 | 373 |
| 146 | 3300009545 | Ga0105237_10053178 | Ga0105237_100531783 | 373 |
| 147 | 3300009551 | Ga0105238_10018941 | Ga0105238_100189414 | 373 |
| 148 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002266 | 373 |
| 149 | 3300010375 | Ga0105239_10000445 | Ga0105239_1000044530 | 373 |
| 150 | 3300010375 | Ga0105239_10000959 | Ga0105239_1000095920 | 373 |
| 151 | 3300010375 | Ga0105239_10006358 | Ga0105239_100063589 | 373 |
| 152 | 3300010375 | Ga0105239_10008543 | Ga0105239_100085434 | 373 |
| 153 | 3300010375 | Ga0105239_10207639 | Ga0105239_102076392 | 373 |
| 154 | 3300010375 | Ga0105239_10417369 | Ga0105239_104173692 | 373 |
| 155 | 3300011119 | Ga0105246_10012536 | Ga0105246_100125365 | 373 |
| 156 | 3300013102 | Ga0157371_10000269 | Ga0157371_100002693 | 373 |
| 157 | 3300013102 | Ga0157371_10032880 | Ga0157371_100328803 | 373 |
| 158 | 3300013104 | Ga0157370_10083214 | Ga0157370_100832142 | 373 |
| 159 | 3300013105 | Ga0157369_10099032 | Ga0157369_100990323 | 373 |
| 160 | 3300013296 | Ga0157374_10003065 | Ga0157374_100030657 | 373 |
| 161 | 3300013297 | Ga0157378_10011737 | Ga0157378_100117375 | 373 |
| 162 | 3300013297 | Ga0157378_10158271 | Ga0157378_101582711 | 373 |
| 163 | 3300013306 | Ga0163162_10000031 | Ga0163162_1000003122 | 373 |
| 164 | 3300013306 | Ga0163162_10006956 | Ga0163162_100069565 | 373 |
| 165 | 3300013306 | Ga0163162_10360658 | Ga0163162_103606582 | 373 |
| 166 | 3300013307 | Ga0157372_10001534 | Ga0157372_1000153416 | 373 |
| 167 | 3300013307 | Ga0157372_10002075 | Ga0157372_1000207515 | 373 |
| 168 | 3300013308 | Ga0157375_10016536 | Ga0157375_100165362 | 373 |
| 169 | 3300013308 | Ga0157375_10070001 | Ga0157375_100700014 | 373 |
| 170 | 3300014745 | Ga0157377_10120996 | Ga0157377_101209962 | 373 |
| 171 | 3300017792 | Ga0163161_10014065 | Ga0163161_100140655 | 373 |
| 172 | 3300020077 | Ga0206351_10035624 | Ga0206351_100356242 | 373 |
| 173 | 3300021361 | Ga0213872_10008555 | Ga0213872_100085552 | 373 |
| 174 | 3300025230 | Ga0209563_104761 | Ga0209563_1047611 | 373 |
| 175 | 3300025231 | Ga0207427_100766 | Ga0207427_10076612 | 373 |
| 176 | 3300025233 | Ga0209437_100024 | Ga0209437_100024232 | 373 |
| 177 | 3300025233 | Ga0209437_100052 | Ga0209437_100052115 | 373 |
| 178 | 3300025261 | Ga0209233_1000067 | Ga0209233_1000067115 | 373 |
| 179 | 3300025272 | Ga0209455_1004456 | Ga0209455_10044564 | 373 |
| 180 | 3300025904 | Ga0207647_10000463 | Ga0207647_1000046315 | 373 |
| 181 | 3300025909 | Ga0207705_10000015 | Ga0207705_10000015100 | 373 |
| 182 | 3300025911 | Ga0207654_10094726 | Ga0207654_100947262 | 373 |
| 183 | 3300025912 | Ga0207707_10029641 | Ga0207707_100296417 | 373 |
| 184 | 3300025913 | Ga0207695_10000189 | Ga0207695_10000189156 | 373 |
| 185 | 3300025913 | Ga0207695_10010555 | Ga0207695_100105556 | 373 |
| 186 | 3300025913 | Ga0207695_10030752 | Ga0207695_100307527 | 373 |
| 187 | 3300025913 | Ga0207695_10140873 | Ga0207695_101408733 | 373 |
| 188 | 3300025914 | Ga0207671_10002710 | Ga0207671_100027105 | 373 |
| 189 | 3300025914 | Ga0207671_10004889 | Ga0207671_100048896 | 373 |
| 190 | 3300025919 | Ga0207657_10108422 | Ga0207657_101084222 | 373 |
| 191 | 3300025919 | Ga0207657_10148646 | Ga0207657_101486462 | 373 |
| 192 | 3300025921 | Ga0207652_10125616 | Ga0207652_101256162 | 373 |
| 193 | 3300025931 | Ga0207644_10025333 | Ga0207644_100253335 | 373 |
| 194 | 3300025932 | Ga0207690_10018517 | Ga0207690_100185173 | 373 |
| 195 | 3300025934 | Ga0207686_10184868 | Ga0207686_101848682 | 373 |
| 196 | 3300025937 | Ga0207669_10099444 | Ga0207669_100994442 | 373 |
| 197 | 3300025949 | Ga0207667_10000009 | Ga0207667_10000009471 | 373 |
| 198 | 3300025949 | Ga0207667_10001584 | Ga0207667_1000158415 | 373 |
| 199 | 3300025949 | Ga0207667_10013812 | Ga0207667_100138124 | 373 |
| 200 | 3300025949 | Ga0207667_10037382 | Ga0207667_100373825 | 373 |
| 201 | 3300025960 | Ga0207651_10003963 | Ga0207651_100039636 | 373 |
| 202 | 3300026078 | Ga0207702_10001984 | Ga0207702_1000198418 | 373 |
| 203 | 3300026078 | Ga0207702_10310910 | Ga0207702_103109102 | 373 |
| 204 | 3300026121 | Ga0207683_10014226 | Ga0207683_100142266 | 373 |
| 205 | 3300028786 | Ga0307517_10013049 | Ga0307517_1001304910 | 373 |
| 206 | 3300028794 | Ga0307515_10000280 | Ga0307515_1000028041 | 373 |
| 207 | 3300037418 | Ga0395900_0000014 | Ga0395900_0000014_46406_47578 | 373 |
| 208 | 3300037418 | Ga0395900_0000128 | Ga0395900_0000128_91643_92809 | 373 |
| 209 | 3300037466 | Ga0395898_0021189 | Ga0395898_0021189_1647_2819 | 373 |
| 210 | 3300037471 | Ga0395905_0000037 | Ga0395905_0000037_46396_47568 | 373 |
| 211 | 3300038443 | Ga0395901_0000166 | Ga0395901_0000166_46260_47432 | 373 |
| 212 | 3300038443 | Ga0395901_0201542 | Ga0395901_0201542_901_2073 | 373 |
| 213 | 3300039447 | Ga0436361_0360494 | Ga0436361_0360494_5291_6463 | 373 |
| 214 | 3300042005 | Ga0439448_0052261 | Ga0439448_0052261_86_1258 | 373 |
| 215 | 3300046471 | Ga0495650_0000087 | Ga0495650_0000087_88593_89786 | 373 |
| 216 | 3300046492 | Ga0495585_0000167 | Ga0495585_0000167_32560_33753 | 373 |
| 217 | 3300046492 | Ga0495585_0013561 | Ga0495585_0013561_246_1430 | 373 |
| 218 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_104916_106109 | 373 |
| 219 | 3300046507 | Ga0495606_0012014 | Ga0495606_0012014_232_1422 | 373 |
| 220 | 3300046507 | Ga0495606_0026982 | Ga0495606_0026982_147_1340 | 373 |
| 221 | 3300046512 | Ga0495610_0001840 | Ga0495610_0001840_8425_9618 | 373 |
| 222 | 3300046512 | Ga0495610_0064142 | Ga0495610_0064142_512_1705 | 373 |
| 223 | 3300046513 | Ga0495616_0002580 | Ga0495616_0002580_7727_8920 | 373 |
| 224 | 3300046513 | Ga0495616_0005811 | Ga0495616_0005811_4695_5861 | 373 |
| 225 | 3300046538 | Ga0495609_0016612 | Ga0495609_0016612_1270_2463 | 373 |
| 226 | 3300046558 | Ga0495633_0021535 | Ga0495633_0021535_491_1684 | 373 |
| 227 | 3300046616 | Ga0495668_0000070 | Ga0495668_0000070_16418_17602 | 373 |
| 228 | 3300046660 | Ga0495625_0000008 | Ga0495625_0000008_470938_472131 | 373 |
| 229 | 3300046660 | Ga0495625_0001647 | Ga0495625_0001647_16594_17784 | 373 |
| 230 | 3300046660 | Ga0495625_0014767 | Ga0495625_0014767_4011_5177 | 373 |
| 231 | 3300046660 | Ga0495625_0075720 | Ga0495625_0075720_934_2100 | 373 |
| 232 | 3300046665 | Ga0495661_0003217 | Ga0495661_0003217_2756_3949 | 373 |
| 233 | 3300046665 | Ga0495661_0003891 | Ga0495661_0003891_1153_2334 | 373 |
| 234 | 3300046665 | Ga0495661_0025617 | Ga0495661_0025617_495_1688 | 373 |
| 235 | 3300046694 | Ga0495649_0000018 | Ga0495649_0000018_64034_65227 | 373 |
| 236 | 3300047443 | Ga0495687_000972 | Ga0495687_000972_2596_3789 | 373 |
| 237 | 3300047443 | Ga0495687_001574 | Ga0495687_001574_2283_3455 | 373 |
| 238 | 3300047446 | Ga0495679_025297 | Ga0495679_025297_655_1848 | 373 |
| 239 | 3300047472 | Ga0495686_0000052 | Ga0495686_0000052_192496_193662 | 373 |
| 240 | 3300050493 | nmdc:mga0k408_13355_c1 | nmdc:mga0k408_13355_c1_322_1533 | 373 |
| 241 | 3300050496 | nmdc:mga07m45_48083_c1 | nmdc:mga07m45_48083_c1_145_1305 | 373 |
| 242 | 3300053080 | Ga0500635_0002470 | Ga0500635_0002470_945_2111 | 373 |
| 243 | 3300053157 | Ga0500624_000134 | Ga0500624_000134_24442_25629 | 373 |
| 244 | 3300013102 | Ga0157371_10070860 | Ga0157371_100708603 | 375 |
| 245 | 3300013104 | Ga0157370_10132970 | Ga0157370_101329703 | 375 |
| 246 | 3300025919 | Ga0207657_10168624 | Ga0207657_101686242 | 375 |
| 247 | 3300042876 | Ga0451577_0071769 | Ga0451577_0071769_1761_3029 | 375 |
| 248 | 3300044712 | Ga0453684_0096941 | Ga0453684_0096941_2263_3531 | 375 |
| 249 | 3300001979 | JGI24740J21852_10005096 | JGI24740J21852_100050967 | 391 |
| 250 | 3300013102 | Ga0157371_10014776 | Ga0157371_100147767 | 391 |
| 251 | 3300013105 | Ga0157369_10002318 | Ga0157369_100023187 | 391 |
| 252 | 3300013307 | Ga0157372_10000034 | Ga0157372_1000003484 | 391 |
| 253 | 3300037312 | Ga0395899_0000182 | Ga0395899_0000182_9544_10719 | 391 |
| 254 | 3300044684 | Ga0466966_0073976 | Ga0466966_0073976_646_1842 | 391 |
| 255 | 3300045836 | Ga0466958_0033030 | Ga0466958_0033030_1563_2759 | 391 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h4e-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.8354 | 200 | 382 |
| 1hjj-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.8328 | 200 | 382 |
| 1h4c-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.8315 | 200 | 382 |
| 1hjl-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.8312 | 200 | 382 |
| 1h4d-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.8303 | 200 | 382 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVY4_1_197_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8675 | 202 | 383 | 3.90.550.10 |
| af_Q59057_8_204_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8397 | 204 | 380 | 3.90.550.10 |
| 1frwA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8294 | 198 | 381 | 3.90.550.10 |
| af_P9WJQ9_9_197_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8188 | 200 | 380 | 3.90.550.10 |
| 1frwA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8052 | 198 | 381 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2U2PDM4-F1-model_v4 | Molybdenum cofactor guanylyltransferase | 0.9797 | 198 | 385 |
GO:0005525
GO:0006777 GO:0016779 |
| AF-A0A519UI39-F1-model_v4 | MobA-like NTP transferase domain-containing protein | 0.977 | 275 | 385 |
GO:0016779
|
| AF-A0A1G9TBK6-F1-model_v4 | Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) | 0.9754 | 198 | 383 |
GO:0005525
GO:0005737 GO:0006777 GO:0046872 GO:0061603 |
| AF-A0A1I5NZ73-F1-model_v4 | Probable molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) | 0.9703 | 197 | 388 |
GO:0005525
GO:0005737 GO:0006777 GO:0046872 GO:0061603 |
| AF-A0A4Q2ZKG7-F1-model_v4 | deleted | 0.969 | 184 | 386 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar