F365304

General Info

Members Datasets Scaffolds Average Seq Length
254 186 508 307

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2863404153|2863406955
Length 349
Sequence RERLTDGLYGLGWSTVKKLPEPAAVRLGLTIADATWKRRGPLVRRLEANYARVVPDAGPERLAELSRAGMRSYLRYWMESFRLPAWSEERIRTGFAGQDLHHLTEGLAAGRGVVLALPHLANWDLAGAWVTTELKTPFTTVAERLKPETLYDRFVAYREGLGMEVLPHSGGSAFGTLARRLRDGGLVCLVADRDLSASGVEVDFFGEPTRMPAGPALLAQQTGALLLPVTLWYDDSPVMRGRVHPPIEVPGTGTRAEKTSVMTQALADAFATGIADHPEDWHMLQRLWLADLDPAKSPGGPTPPAPRPATDPAPSSAADAATDAGRGPQTGAARDPLPDAATDSEKGRP

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
4 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
8 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
9 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
10 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
12 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
13 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
14 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
15 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
16 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
17 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
18 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
19 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
20 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
21 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
22 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
23 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
24 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
25 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
28 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
31 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
32 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
33 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
34 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
35 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
36 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
37 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
38 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
39 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
40 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
41 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
42 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
43 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
44 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
45 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
46 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
47 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
48 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
49 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
50 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
53 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
57 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
58 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
59 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
63 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
68 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
69 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
70 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
71 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
72 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
79 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
82 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
83 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
118 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
119 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
120 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
121 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
123 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
124 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
125 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
126 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
127 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
128 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
129 2643221548 Streptomyces sp. Root55 Isolate Unclassified
130 2643221578 Streptomyces sp. Root63 Isolate Unclassified
131 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
132 2643221670 Streptomyces sp. Root431 Isolate Unclassified
133 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
134 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
135 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
136 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
137 2643221714 Streptomyces sp. Root264 Isolate Unclassified
138 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
139 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
140 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
141 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
142 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
143 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
144 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
145 2808606448 Streptomyces sp. 193411 Isolate Unclassified
146 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
147 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
148 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
149 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
150 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
151 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
152 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
153 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
154 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
155 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
156 2862574272 Streptomyces sp. AcE210 Isolate Nodule
157 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
158 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
159 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
160 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
161 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
162 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
163 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
164 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
165 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
166 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
167 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
168 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
169 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
170 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
171 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
172 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
173 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
174 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
175 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
176 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
177 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
178 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
179 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
180 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
181 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
182 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
183 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
184 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
185 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
186 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.23
Metatranscriptomes 1.57
Isolates 25.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.51
Nodule 1.18
Rhizoplane 0
Rhizosphere 72.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1029861 3300003354 Bacteria 1432
2 Ga0006562J51391_1051720 3300003578 Bacteria 5130
3 Ga0006562J51391_1051725 3300003578 Bacteria 1160
4 Ga0006562J51391_1055698 3300003578 Bacteria 2470
5 Ga0006562J51391_1055699 3300003578 Bacteria 1760
6 Ga0070685_10107944 3300005466 Bacteria 1710
7 Ga0081455_10115781 3300005937 Bacteria 2121
8 Ga0075363_100010625 3300006048 Bacteria 4381
9 Ga0075367_10015719 3300006178 Bacteria 4119
10 Ga0075367_10226010 3300006178 Bacteria 1172
11 Ga0183367_1010 3300015688 Bacteria 416164
12 Ga0209758_1007491 3300025297 Bacteria 7404
13 Ga0207426_1010049 3300025302 Bacteria 3700
14 Ga0207426_1018518 3300025302 Bacteria 2452
15 Ga0207639_10037198 3300026041 Bacteria 3614
16 Ga0307517_10044018 3300028786 Bacteria 4734
17 Ga0307515_10004214 3300028794 Bacteria 29935
18 Ga0307511_10011833 3300030521 Bacteria 8584
19 Ga0307511_10153154 3300030521 Bacteria 1317
20 Ga0265327_10022806 3300031251 Bacteria 3728
21 Ga0307513_10109875 3300031456 Bacteria 2754
22 Ga0307509_10118819 3300031507 Bacteria 2626
23 Ga0307509_10172288 3300031507 Bacteria 2041
24 Ga0307509_10172300 3300031507 Bacteria 2041
25 Ga0307508_10002415 3300031616 Bacteria 19712
26 Ga0307508_10014449 3300031616 Bacteria 7201
27 Ga0307508_10017604 3300031616 Bacteria 6498
28 Ga0307514_10002429 3300031649 Bacteria 19428
29 Ga0307516_10002870 3300031730 Bacteria 22676
30 Ga0307516_10190832 3300031730 Bacteria 1775
31 Ga0307518_10100548 3300031838 Bacteria 2070
32 Ga0307409_100019145 3300031995 Bacteria 4626
33 Ga0307409_100054940 3300031995 Bacteria 3071
34 Ga0307416_100051594 3300032002 Bacteria 3287
35 Ga0307416_100433967 3300032002 Bacteria 1362
36 Ga0307507_10022197 3300033179 Bacteria 7025
37 Ga0307507_10155455 3300033179 Bacteria 1706
38 Ga0307510_10070510 3300033180 Bacteria 3489
39 Ga0307510_10127140 3300033180 Bacteria 2234
40 Ga0395900_0055924 3300037418 Bacteria 4062
41 Ga0395898_0002411 3300037466 Bacteria 22161
42 Ga0395901_0065372 3300038443 Bacteria 3787
43 Ga0439436_0004068 3300041404 Bacteria 4485
44 Ga0451853_0425813 3300041512 Bacteria 1599
45 Ga0451853_2478122 3300041512 Bacteria 6598
46 Ga0439433_0011812 3300041999 Bacteria 1914
47 Ga0439449_0012083 3300042007 Bacteria 3245
48 Ga0439449_0033933 3300042007 Bacteria 1900
49 Ga0439457_001079 3300042014 Bacteria 8249
50 Ga0450898_003359 3300042134 Bacteria 2295
51 Ga0450903_000630 3300042138 Bacteria 7129
52 Ga0450906_000078 3300042145 Bacteria 15822
53 Ga0439458_0004023 3300042157 Bacteria 3393
54 Ga0450901_009219 3300042533 Bacteria 1020
55 Ga0466969_0004863 3300044656 Bacteria 7155
56 Ga0466969_0035554 3300044656 Bacteria 2519
57 Ga0466972_0007874 3300044658 Bacteria 5343
58 Ga0466972_0009403 3300044658 Bacteria 4911
59 Ga0466965_0000737 3300044683 Bacteria 12239
60 Ga0466965_0013592 3300044683 Bacteria 3844
61 Ga0466966_0002885 3300044684 Bacteria 11331
62 Ga0466966_0004399 3300044684 Bacteria 9291
63 Ga0466966_0092390 3300044684 Bacteria 1878
64 Ga0466961_0075534 3300044693 Bacteria 2136
65 Ga0466961_0102885 3300044693 Bacteria 1798
66 Ga0466961_0197932 3300044693 Bacteria 1243
67 Ga0466963_0000076 3300044694 Bacteria 34056
68 Ga0466964_0004528 3300044706 Bacteria 5134
69 Ga0466964_0028623 3300044706 Bacteria 2196
70 Ga0466971_0019556 3300044719 Bacteria 3008
71 Ga0466970_0003246 3300044765 Bacteria 7906
72 Ga0466970_0021606 3300044765 Bacteria 3353
73 Ga0466970_0083406 3300044765 Bacteria 1729
74 Ga0466957_0000061 3300044842 Bacteria 40928
75 Ga0466957_0004322 3300044842 Bacteria 7887
76 Ga0466960_0134671 3300044901 Bacteria 1307
77 Ga0466959_0008126 3300045049 Bacteria 7403
78 Ga0466959_0030368 3300045049 Bacteria 4001
79 Ga0466959_0033978 3300045049 Bacteria 3773
80 Ga0466958_0000414 3300045836 Bacteria 17588
81 Ga0466958_0011661 3300045836 Bacteria 4956
82 Ga0466958_0012334 3300045836 Bacteria 4840
83 Ga0466967_0011089 3300045976 Bacteria 6806
84 Ga0466967_0073652 3300045976 Bacteria 3065
85 Ga0466967_0327697 3300045976 Bacteria 1478
86 Ga0495603_0002100 3300046455 Bacteria 11725
87 Ga0495603_0009324 3300046455 Bacteria 5934
88 Ga0495590_0021274 3300046457 Bacteria 2300
89 Ga0495629_0000657 3300046459 Bacteria 27953
90 Ga0495629_0004346 3300046459 Bacteria 10624
91 Ga0495629_0147041 3300046459 Bacteria 1638
92 Ga0495651_0006519 3300046462 Bacteria 8916
93 Ga0495582_0084418 3300046473 Bacteria 1765
94 Ga0495639_0021820 3300046475 Bacteria 2805
95 Ga0495662_0000540 3300046476 Bacteria 17361
96 Ga0495662_0053031 3300046476 Bacteria 1958
97 Ga0495664_0000766 3300046477 Bacteria 16471
98 Ga0495585_0051827 3300046492 Bacteria 2273
99 Ga0495585_0153995 3300046492 Bacteria 1197
100 Ga0495594_0006988 3300046499 Bacteria 5801
101 Ga0495594_0022888 3300046499 Bacteria 3345
102 Ga0495583_0015115 3300046506 Bacteria 4214
103 Ga0495620_0004319 3300046515 Bacteria 8033
104 Ga0495620_0034060 3300046515 Bacteria 2305
105 Ga0495628_0039515 3300046516 Bacteria 3774
106 Ga0495630_0265057 3300046517 Bacteria 1312
107 Ga0495643_0006605 3300046522 Bacteria 7619
108 Ga0495642_0068295 3300046528 Bacteria 1483
109 Ga0495652_0039267 3300046529 Bacteria 4093
110 Ga0495652_0070744 3300046529 Bacteria 2915
111 Ga0495640_0033541 3300046533 Bacteria 3646
112 Ga0495586_0089906 3300046535 Bacteria 1695
113 Ga0495587_0004085 3300046536 Bacteria 9663
114 Ga0495609_0019562 3300046538 Bacteria 3131
115 Ga0495645_0011686 3300046543 Bacteria 6181
116 Ga0495645_0018729 3300046543 Bacteria 4978
117 Ga0495622_0029886 3300046557 Bacteria 2545
118 Ga0495622_0041990 3300046557 Bacteria 2127
119 Ga0495634_0083769 3300046642 Bacteria 2080
120 Ga0495611_0009135 3300046648 Bacteria 4190
121 Ga0495611_0017348 3300046648 Bacteria 3079
122 Ga0495611_0171717 3300046648 Bacteria 1013
123 Ga0495625_0023348 3300046660 Bacteria 4725
124 Ga0495635_0009528 3300046663 Bacteria 6790
125 Ga0495635_0073682 3300046663 Bacteria 2339
126 Ga0495588_0084756 3300046674 Bacteria 1656
127 Ga0495657_0005560 3300046675 Bacteria 9949
128 Ga0495657_0013690 3300046675 Bacteria 5974
129 Ga0495657_0048221 3300046675 Bacteria 2874
130 Ga0495623_0026876 3300046679 Bacteria 3703
131 Ga0495646_0004764 3300046680 Bacteria 8568
132 Ga0495658_0015518 3300046683 Bacteria 3909
133 Ga0495613_0000407 3300046689 Bacteria 36936
134 Ga0495613_0003204 3300046689 Bacteria 12249
135 Ga0495613_0127801 3300046689 Bacteria 1821
136 Ga0495624_0087358 3300046690 Bacteria 1925
137 Ga0495671_0064367 3300046692 Bacteria 1805
138 Ga0495649_0023469 3300046694 Bacteria 3446
139 Ga0495649_0139612 3300046694 Bacteria 1276
140 Ga0495589_0006555 3300046794 Bacteria 6136
141 Ga0495589_0030017 3300046794 Bacteria 2739
142 Ga0495589_0065290 3300046794 Bacteria 1784
143 Ga0495600_0090394 3300046809 Bacteria 1997
144 Ga0495581_0058690 3300047315 Bacteria 2222
145 Ga0495581_0094193 3300047315 Bacteria 1738
146 Ga0495581_0146768 3300047315 Bacteria 1377
147 Ga0495604_0001034 3300047317 Bacteria 23216
148 Ga0495674_0098623 3300047319 Bacteria 2488
149 Ga0495676_0005468 3300047321 Bacteria 11644
150 Ga0495676_0016685 3300047321 Bacteria 6505
151 Ga0495676_0174090 3300047321 Bacteria 1512
152 Ga0495680_0045883 3300047322 Bacteria 3448
153 Ga0495687_009797 3300047443 Bacteria 5321
154 Ga0495687_040030 3300047443 Bacteria 2068
155 Ga0495675_0003070 3300047444 Bacteria 10037
156 Ga0495677_0030897 3300047445 Bacteria 1950
157 Ga0495685_011298 3300047447 Bacteria 3009
158 Ga0495685_015615 3300047447 Bacteria 2591
159 Ga0495681_0009113 3300047470 Bacteria 6145
160 Ga0495681_0016735 3300047470 Bacteria 4097
161 Ga0495686_0133961 3300047472 Bacteria 1467
162 Ga0495686_0180658 3300047472 Bacteria 1222
163 Ga0495593_0033320 3300047673 Bacteria 2805
164 Ga0495602_0032877 3300048088 Bacteria 4876
165 Ga0495614_0000149 3300048089 Bacteria 25442
166 Ga0501031_0017273 3300049568 Bacteria 4688
167 Ga0501033_0003046 3300049570 Bacteria 13939
168 Ga0501036_0160640 3300049572 Bacteria 1894
169 Ga0501039_0024685 3300049575 Bacteria 4617
170 Ga0501043_0009218 3300049579 Bacteria 7756
171 Ga0501046_0089710 3300049580 Bacteria 2366
172 Ga0501047_0000089 3300049581 Bacteria 117033
173 Ga0501047_0031613 3300049581 Bacteria 5107
174 Ga0501070_0001065 3300049586 Bacteria 24645
175 Ga0501074_0001255 3300049590 Bacteria 16758
176 Ga0501035_0018028 3300049822 Bacteria 6507
177 Ga0501035_0247326 3300049822 Bacteria 1515
178 Ga0501044_0008471 3300049823 Bacteria 11269
179 Ga0501044_0025612 3300049823 Bacteria 6254
180 Ga0501044_0073829 3300049823 Bacteria 3466
181 nmdc:mga0yw44_22913_c1 3300050492 Bacteria 3510
182 nmdc:mga07m45_75345_c1 3300050496 Bacteria 1922
183 Ga0500640_080401 3300053095 Bacteria 1383
184 Ga0500560_007833 3300053107 Bacteria 2539
185 Ga0500572_008475 3300053111 Bacteria 2405
186 Ga0500573_0049520 3300053140 Bacteria 2418
187 Ga0500600_0085063 3300053149 Bacteria 1701
188 Ga0466962_0001863 3300061719 Bacteria 9910
189 Ga0466962_0018477 3300061719 Bacteria 3353
190 Ga0466962_0030613 3300061719 Bacteria 2578
191 2863406955 2863404153 Bacteria 9672205
192 2547406553 2547132111 Bacteria 8013147
193 2554259525 2554235005 Bacteria 6457341
194 2585300411 2582581312 Bacteria 7308206
195 2585317033 2582581314 Bacteria 11452267
196 2616900805 2616644941 Bacteria 8510691
197 2643760196 2643221548 Bacteria 8053412
198 2643904506 2643221578 Bacteria 9213798
199 2643946533 2643221587 Bacteria 7586415
200 2644389118 2643221670 Bacteria 6497041
201 2644406226 2643221673 Bacteria 9196637
202 2644434337 2643221677 Bacteria 7584031
203 2644443711 2643221678 Bacteria 9540101
204 2644460108 2643221682 Bacteria 6743283
205 2644629641 2643221714 Bacteria 9015452
206 2729904855 2728369276 Bacteria 5610032
207 2784586766 2784132148 Bacteria 8627943
208 2785345718 2784746763 Bacteria 9783172
209 2786668221 2786546132 Bacteria 10419719
210 2799184018 2799112218 Bacteria 4315149
211 2808847673 2808606359 Bacteria 9866990
212 2808918413 2808606375 Bacteria 9466072
213 2809230333 2808606448 Bacteria 8656184
214 2811846989 2808606982 Bacteria 7791042
215 2812360293 2811994879 Bacteria 9313447
216 2812482401 2811994917 Bacteria 7761064
217 2819696386 2818991463 Bacteria 7948711
218 2835191661 2835188231 Bacteria 3476928
219 2852637734 2852635781 Bacteria 8251373
220 2862186230 2862178590 Bacteria 8583590
221 2862289641 2862281513 Bacteria 9621493
222 2862392082 2862382967 Bacteria 10317375
223 2862510434 2862507626 Bacteria 9425308
224 2862583703 2862574272 Bacteria 10567477
225 2873157664 2873151551 Bacteria 8625867
226 2875392710 2875391855 Bacteria 7600475
227 2912722387 2912715099 Bacteria 9460473
228 2912726089 2912723979 Bacteria 8557534
229 2912758910 2912757875 Bacteria 7940295
230 2919472178 2919468124 Bacteria 9133025
231 2946052004 2946045630 Bacteria 8527308
232 2946065596 2946064051 Bacteria 8957905
233 2946073947 2946072368 Bacteria 8999607
234 2947231817 2947224130 Bacteria 9938529
235 2954011055 2954002825 Bacteria 9173742
236 2954388622 2954380949 Bacteria 10050426
237 2966604397 2966598605 Bacteria 7676064
238 2990059557 2990059506 Bacteria 9321252
239 2997605654 2997600082 Bacteria 9896405
240 3001891384 3001889506 Bacteria 2975194
241 3006327995 3006321560 Bacteria 8247479
242 3006395368 3006393351 Bacteria 6615579
243 3006488303 3006486233 Bacteria 8157040
244 3006495168 3006493962 Bacteria 8825450
245 8008561328 8008558824 Bacteria 10610750
246 8008580733 8008574985 Bacteria 7815457
247 8023625044 8023623736 Bacteria 8593882
248 8025414794 8025413630 Bacteria 7014048
249 8025534134 8025530807 Bacteria 8495698
250 8048130424 8048127548 Bacteria 11053136
251 8048408183 8048406513 Bacteria 8936924
252 8054166893 8054160619 Bacteria 7783213
253 8056447978 8056447290 Bacteria 7680491
254 8056835684 8056829672 Bacteria 9045328
255 JGI25160J50197_1029861
256 Ga0006562J51391_1051720
257 Ga0006562J51391_1051725
258 Ga0006562J51391_1055698
259 Ga0006562J51391_1055699
260 Ga0070685_10107944
261 Ga0081455_10115781
262 Ga0075363_100010625
263 Ga0075367_10015719
264 Ga0075367_10226010
265 Ga0183367_1010
266 Ga0209758_1007491
267 Ga0207426_1010049
268 Ga0207426_1018518
269 Ga0207639_10037198
270 Ga0307517_10044018
271 Ga0307515_10004214
272 Ga0307511_10011833
273 Ga0307511_10153154
274 Ga0265327_10022806
275 Ga0307513_10109875
276 Ga0307509_10118819
277 Ga0307509_10172288
278 Ga0307509_10172300
279 Ga0307508_10002415
280 Ga0307508_10014449
281 Ga0307508_10017604
282 Ga0307514_10002429
283 Ga0307516_10002870
284 Ga0307516_10190832
285 Ga0307518_10100548
286 Ga0307409_100019145
287 Ga0307409_100054940
288 Ga0307416_100051594
289 Ga0307416_100433967
290 Ga0307507_10022197
291 Ga0307507_10155455
292 Ga0307510_10070510
293 Ga0307510_10127140
294 Ga0395900_0055924
295 Ga0395898_0002411
296 Ga0395901_0065372
297 Ga0439436_0004068
298 Ga0451853_0425813
299 Ga0451853_2478122
300 Ga0439433_0011812
301 Ga0439449_0012083
302 Ga0439449_0033933
303 Ga0439457_001079
304 Ga0450898_003359
305 Ga0450903_000630
306 Ga0450906_000078
307 Ga0439458_0004023
308 Ga0450901_009219
309 Ga0466969_0004863
310 Ga0466969_0035554
311 Ga0466972_0007874
312 Ga0466972_0009403
313 Ga0466965_0000737
314 Ga0466965_0013592
315 Ga0466966_0002885
316 Ga0466966_0004399
317 Ga0466966_0092390
318 Ga0466961_0075534
319 Ga0466961_0102885
320 Ga0466961_0197932
321 Ga0466963_0000076
322 Ga0466964_0004528
323 Ga0466964_0028623
324 Ga0466971_0019556
325 Ga0466970_0003246
326 Ga0466970_0021606
327 Ga0466970_0083406
328 Ga0466957_0000061
329 Ga0466957_0004322
330 Ga0466960_0134671
331 Ga0466959_0008126
332 Ga0466959_0030368
333 Ga0466959_0033978
334 Ga0466958_0000414
335 Ga0466958_0011661
336 Ga0466958_0012334
337 Ga0466967_0011089
338 Ga0466967_0073652
339 Ga0466967_0327697
340 Ga0495603_0002100
341 Ga0495603_0009324
342 Ga0495590_0021274
343 Ga0495629_0000657
344 Ga0495629_0004346
345 Ga0495629_0147041
346 Ga0495651_0006519
347 Ga0495582_0084418
348 Ga0495639_0021820
349 Ga0495662_0000540
350 Ga0495662_0053031
351 Ga0495664_0000766
352 Ga0495585_0051827
353 Ga0495585_0153995
354 Ga0495594_0006988
355 Ga0495594_0022888
356 Ga0495583_0015115
357 Ga0495620_0004319
358 Ga0495620_0034060
359 Ga0495628_0039515
360 Ga0495630_0265057
361 Ga0495643_0006605
362 Ga0495642_0068295
363 Ga0495652_0039267
364 Ga0495652_0070744
365 Ga0495640_0033541
366 Ga0495586_0089906
367 Ga0495587_0004085
368 Ga0495609_0019562
369 Ga0495645_0011686
370 Ga0495645_0018729
371 Ga0495622_0029886
372 Ga0495622_0041990
373 Ga0495634_0083769
374 Ga0495611_0009135
375 Ga0495611_0017348
376 Ga0495611_0171717
377 Ga0495625_0023348
378 Ga0495635_0009528
379 Ga0495635_0073682
380 Ga0495588_0084756
381 Ga0495657_0005560
382 Ga0495657_0013690
383 Ga0495657_0048221
384 Ga0495623_0026876
385 Ga0495646_0004764
386 Ga0495658_0015518
387 Ga0495613_0000407
388 Ga0495613_0003204
389 Ga0495613_0127801
390 Ga0495624_0087358
391 Ga0495671_0064367
392 Ga0495649_0023469
393 Ga0495649_0139612
394 Ga0495589_0006555
395 Ga0495589_0030017
396 Ga0495589_0065290
397 Ga0495600_0090394
398 Ga0495581_0058690
399 Ga0495581_0094193
400 Ga0495581_0146768
401 Ga0495604_0001034
402 Ga0495674_0098623
403 Ga0495676_0005468
404 Ga0495676_0016685
405 Ga0495676_0174090
406 Ga0495680_0045883
407 Ga0495687_009797
408 Ga0495687_040030
409 Ga0495675_0003070
410 Ga0495677_0030897
411 Ga0495685_011298
412 Ga0495685_015615
413 Ga0495681_0009113
414 Ga0495681_0016735
415 Ga0495686_0133961
416 Ga0495686_0180658
417 Ga0495593_0033320
418 Ga0495602_0032877
419 Ga0495614_0000149
420 Ga0501031_0017273
421 Ga0501033_0003046
422 Ga0501036_0160640
423 Ga0501039_0024685
424 Ga0501043_0009218
425 Ga0501046_0089710
426 Ga0501047_0000089
427 Ga0501047_0031613
428 Ga0501070_0001065
429 Ga0501074_0001255
430 Ga0501035_0018028
431 Ga0501035_0247326
432 Ga0501044_0008471
433 Ga0501044_0025612
434 Ga0501044_0073829
435 nmdc:mga0yw44_22913_c1
436 nmdc:mga07m45_75345_c1
437 Ga0500640_080401
438 Ga0500560_007833
439 Ga0500572_008475
440 Ga0500573_0049520
441 Ga0500600_0085063
442 Ga0466962_0001863
443 Ga0466962_0018477
444 Ga0466962_0030613
445 2863406955
446 2547406553
447 2554259525
448 2585300411
449 2585317033
450 2616900805
451 2643760196
452 2643904506
453 2643946533
454 2644389118
455 2644406226
456 2644434337
457 2644443711
458 2644460108
459 2644629641
460 2729904855
461 2784586766
462 2785345718
463 2786668221
464 2799184018
465 2808847673
466 2808918413
467 2809230333
468 2811846989
469 2812360293
470 2812482401
471 2819696386
472 2835191661
473 2852637734
474 2862186230
475 2862289641
476 2862392082
477 2862510434
478 2862583703
479 2873157664
480 2875392710
481 2912722387
482 2912726089
483 2912758910
484 2919472178
485 2946052004
486 2946065596
487 2946073947
488 2947231817
489 2954011055
490 2954388622
491 2966604397
492 2990059557
493 2997605654
494 3001891384
495 3006327995
496 3006395368
497 3006488303
498 3006495168
499 8008561328
500 8008580733
501 8023625044
502 8025414794
503 8025534134
504 8048130424
505 8048408183
506 8054166893
507 8056447978
508 8056835684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03279

Lip_A_acyltrans

Bacterial lipid A biosynthesis acyltransferase

2

290

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.9183 57 306
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.8867 57 306
5kn7-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii 0.7879 21 294
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.7692 5 300
5knk-assembly1.cif.gz_B-2 lipid a secondary acyltransferase lpxm from acinetobacter baumannii with catalytic residue substitution (e127a) 0.6893 5 300
ID Description Score Start End Superfamily
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.7019 118 244 3.40.1010.10
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.679 118 244 3.40.50.2000
af_Q9W1H9_56_173_3.40.1230.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.6735 148 200 3.40.1230.10
af_P31119_15_138_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.6536 118 244 3.40.1010.10
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.651 118 244 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A6B1PB55-F1-model_v4 deleted 0.9879 10 299
AF-A0A1I1RUB4-F1-model_v4 KDO2-lipid IV(A) lauroyltransferase 0.9866 14 308 GO:0005886
GO:0009247
GO:0016746
AF-A0A6B1PB55-F1-model_v4 deleted 0.9846 10 299
AF-A0A6I3H7H8-F1-model_v4 Phosphatidylinositol mannoside acyltransferase 0.9801 18 305 GO:0005886
GO:0009247
GO:0016746
AF-A0A1X4H3D2-F1-model_v4 deleted 0.9778 10 311

Map