F365216

General Info

Members Datasets Scaffolds Average Seq Length
254 140 496 285

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0199538|Ga0501034_0199538_107_1012
Length 301
Sequence VTELSEDVRVGVIPDRTPAEAVADLVAILDLEKIEEDLFRGAPSPNERGRAFGGQVASQSLMAAIRTAGEGFTVHSMHSYFLLPGDPMAPIVYDVQRIRDGRSFQTRRVSARQHGREIFYLTANFQLHEDGFEHQDAMPAALPAEQGIDMRALMAKGGFAEGAALAREWAAVDVRIVGNSLIGLEPNPERPAQQRVWLKIADQLPDDPDIHVAAFTWASDISLLGASLAAHTLDTHKVQMASLDHTIWFHRPFRADEWWLYDQESPSAENGRGLAIGRVFSADGRLVATTAQQGIIRPPRG

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
28 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
29 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
61 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
66 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
81 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
82 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
83 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
84 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
85 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
86 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
116 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
122 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
123 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
124 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
127 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
128 2643221561 Nocardioides sp. Root151 Isolate Unclassified
129 2643221615 Nocardioides sp. Root224 Isolate Unclassified
130 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
131 2643221696 Nocardioides sp. Root140 Isolate Unclassified
132 2739367898 Nocardioides sp. CF479 Isolate Unclassified
133 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
134 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
135 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
136 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
137 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
138 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
139 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
140 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.49
Metatranscriptomes 0
Isolates 5.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.5
Nodule 0.39
Rhizoplane 6.3
Rhizosphere 70.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0199538 3300049571 Bacteria 1959
2 LJQas_1001255 3300000549 Bacteria 3828
3 Ga0070683_100369288 3300005329 Bacteria 1367
4 Ga0070677_10104626 3300005333 Bacteria 1254
5 Ga0070682_100193166 3300005337 Bacteria 1430
6 Ga0070660_100093646 3300005339 Bacteria 2373
7 Ga0070660_100159432 3300005339 Bacteria 1817
8 Ga0070662_100140121 3300005457 Bacteria 1873
9 Ga0070684_100283049 3300005535 Bacteria 1519
10 Ga0070664_100050137 3300005564 Bacteria 3532
11 Ga0070664_100422124 3300005564 Bacteria 1222
12 Ga0068860_100000334 3300005843 Bacteria 63958
13 Ga0081539_10043441 3300005985 Bacteria 2605
14 Ga0075365_10000543 3300006038 Bacteria 14519
15 Ga0075365_10001240 3300006038 Bacteria 11300
16 Ga0075365_10001497 3300006038 Bacteria 10659
17 Ga0075365_10042786 3300006038 Bacteria 2963
18 Ga0075365_10048110 3300006038 Bacteria 2806
19 Ga0075365_10050134 3300006038 Bacteria 2753
20 Ga0075365_10076344 3300006038 Bacteria 2262
21 Ga0075365_10130822 3300006038 Bacteria 1737
22 Ga0075365_10173729 3300006038 Bacteria 1504
23 Ga0075368_10000592 3300006042 Bacteria 10936
24 Ga0075368_10001120 3300006042 Bacteria 8444
25 Ga0075368_10019938 3300006042 Bacteria 2535
26 Ga0075363_100011501 3300006048 Bacteria 4239
27 Ga0075363_100017469 3300006048 Bacteria 3558
28 Ga0075363_100021450 3300006048 Bacteria 3254
29 Ga0075363_100115898 3300006048 Bacteria 1492
30 Ga0075364_10006986 3300006051 Bacteria 6667
31 Ga0075364_10027254 3300006051 Bacteria 3648
32 Ga0075364_10056482 3300006051 Bacteria 2570
33 Ga0075367_10021353 3300006178 Bacteria 3617
34 Ga0075370_10004600 3300006353 Bacteria 6729
35 Ga0075370_10160928 3300006353 Bacteria 1317
36 Ga0111539_10271083 3300009094 Bacteria 1975
37 Ga0105245_10022297 3300009098 Bacteria 5558
38 Ga0105245_10116248 3300009098 Bacteria 2494
39 Ga0105245_10809593 3300009098 Bacteria 975
40 Ga0105243_10133777 3300009148 Bacteria 2107
41 Ga0105238_10416152 3300009551 Bacteria 1338
42 Ga0105239_10026120 3300010375 Bacteria 6428
43 Ga0105239_10029022 3300010375 Bacteria 6081
44 Ga0163162_10268358 3300013306 Bacteria 1838
45 Ga0157372_10550269 3300013307 Bacteria 1345
46 Ga0157375_10089046 3300013308 Bacteria 3142
47 Ga0157380_10298916 3300014326 Bacteria 1482
48 Ga0157380_10326740 3300014326 Bacteria 1425
49 Ga0157380_10363988 3300014326 Bacteria 1358
50 Ga0157380_10687940 3300014326 Bacteria 1026
51 Ga0157377_10152652 3300014745 Bacteria 1429
52 Ga0163161_10029084 3300017792 Bacteria 3927
53 Ga0207682_10070374 3300025893 Bacteria 1481
54 Ga0207688_10299920 3300025901 Bacteria 982
55 Ga0207643_10073799 3300025908 Bacteria 1967
56 Ga0207657_10013630 3300025919 Bacteria 7970
57 Ga0207657_10111919 3300025919 Bacteria 2254
58 Ga0207650_10220339 3300025925 Bacteria 1527
59 Ga0207659_10457326 3300025926 Bacteria 1076
60 Ga0207687_10130355 3300025927 Bacteria 1894
61 Ga0207687_10301939 3300025927 Bacteria 1290
62 Ga0207690_10013295 3300025932 Bacteria 4944
63 Ga0207706_10168274 3300025933 Bacteria 1926
64 Ga0207704_10298267 3300025938 Bacteria 1233
65 Ga0207691_10071220 3300025940 Bacteria 3138
66 Ga0207661_10279370 3300025944 Bacteria 1492
67 Ga0207679_10035998 3300025945 Bacteria 3507
68 Ga0207658_10029858 3300025986 Bacteria 3855
69 Ga0207639_10443972 3300026041 Bacteria 1177
70 Ga0207678_10532586 3300026067 Bacteria 1026
71 Ga0207708_10065334 3300026075 Bacteria 2780
72 Ga0207708_10154564 3300026075 Bacteria 1808
73 Ga0207674_10255109 3300026116 Bacteria 1701
74 Ga0207675_100019913 3300026118 Bacteria 6262
75 Ga0207683_10024032 3300026121 Bacteria 5245
76 Ga0207698_10533974 3300026142 Bacteria 1147
77 Ga0209813_10004526 3300027866 Bacteria 3326
78 Ga0209813_10005295 3300027866 Bacteria 3122
79 Ga0268264_10014754 3300028381 Bacteria 6418
80 Ga0268264_10750522 3300028381 Bacteria 972
81 Ga0307408_100352837 3300031548 Bacteria 1249
82 Ga0307413_10146760 3300031824 Bacteria 1638
83 Ga0307406_10145451 3300031901 Bacteria 1684
84 Ga0307406_10358327 3300031901 Bacteria 1142
85 Ga0307407_10073641 3300031903 Bacteria 2042
86 Ga0307407_10093833 3300031903 Bacteria 1846
87 Ga0307407_10100662 3300031903 Bacteria 1793
88 Ga0307412_10107350 3300031911 Bacteria 1987
89 Ga0307409_100044936 3300031995 Bacteria 3331
90 Ga0307409_100070594 3300031995 Bacteria 2773
91 Ga0307409_100072000 3300031995 Bacteria 2751
92 Ga0307409_100630607 3300031995 Bacteria 1063
93 Ga0307416_100148788 3300032002 Bacteria 2143
94 Ga0307416_100362974 3300032002 Bacteria 1471
95 Ga0307416_100846722 3300032002 Bacteria 1012
96 Ga0307415_100115253 3300032126 Bacteria 2002
97 Ga0395899_0090984 3300037312 Bacteria 2211
98 Ga0395899_0375431 3300037312 Bacteria 946
99 Ga0395900_0479040 3300037418 Bacteria 1197
100 Ga0395898_0083834 3300037466 Bacteria 3072
101 Ga0395898_0182608 3300037466 Bacteria 2005
102 Ga0395905_0009140 3300037471 Bacteria 9710
103 Ga0395901_0124478 3300038443 Bacteria 2709
104 Ga0451791_1375559 3300041451 Bacteria 3227
105 Ga0451797_1134759 3300041453 Bacteria 1402
106 Ga0466972_0014294 3300044658 Bacteria 3977
107 Ga0466965_0013434 3300044683 Bacteria 3864
108 Ga0466965_0021812 3300044683 Bacteria 3086
109 Ga0466965_0045099 3300044683 Bacteria 2180
110 Ga0466965_0103660 3300044683 Bacteria 1457
111 Ga0466966_0057008 3300044684 Bacteria 2470
112 Ga0466966_0252750 3300044684 Bacteria 1061
113 Ga0466966_0316392 3300044684 Bacteria 938
114 Ga0466961_0010466 3300044693 Bacteria 5917
115 Ga0466961_0038589 3300044693 Bacteria 3064
116 Ga0466961_0082667 3300044693 Bacteria 2031
117 Ga0466961_0106259 3300044693 Bacteria 1767
118 Ga0466964_0003527 3300044706 Bacteria 5715
119 Ga0466971_0011260 3300044719 Bacteria 3918
120 Ga0466971_0203759 3300044719 Bacteria 934
121 Ga0466970_0009252 3300044765 Bacteria 4973
122 Ga0466970_0070066 3300044765 Bacteria 1885
123 Ga0466970_0097713 3300044765 Bacteria 1598
124 Ga0466970_0106011 3300044765 Bacteria 1533
125 Ga0466957_0006605 3300044842 Bacteria 6560
126 Ga0466957_0060120 3300044842 Bacteria 2330
127 Ga0466957_0074241 3300044842 Bacteria 2108
128 Ga0466960_0018848 3300044901 Bacteria 3030
129 Ga0466960_0076745 3300044901 Bacteria 1674
130 Ga0466959_0025151 3300045049 Bacteria 4410
131 Ga0466959_0138981 3300045049 Bacteria 1718
132 Ga0466959_0159373 3300045049 Bacteria 1587
133 Ga0466958_0071252 3300045836 Bacteria 2128
134 Ga0466967_0042097 3300045976 Bacteria 3944
135 Ga0466967_0135934 3300045976 Bacteria 2286
136 Ga0496102_0099623 3300048905 Bacteria 2698
137 Ga0496106_0005176 3300048909 Bacteria 9661
138 Ga0496106_0308417 3300048909 Bacteria 1270
139 Ga0496108_0391282 3300048911 Bacteria 1214
140 Ga0496110_0235485 3300048913 Bacteria 1666
141 Ga0496111_0176795 3300048914 Bacteria 1587
142 Ga0496111_0475732 3300048914 Bacteria 921
143 Ga0496111_0511895 3300048914 Bacteria 883
144 Ga0496112_0394776 3300048915 Bacteria 1323
145 Ga0496114_0177469 3300048917 Bacteria 1859
146 Ga0496114_0297938 3300048917 Bacteria 1424
147 Ga0496114_0388812 3300048917 Bacteria 1235
148 Ga0496114_0541964 3300048917 Bacteria 1028
149 Ga0496115_0056492 3300048918 Bacteria 3155
150 Ga0501031_0032059 3300049568 Bacteria 3426
151 Ga0501031_0058592 3300049568 Bacteria 2509
152 Ga0501032_0003539 3300049569 Bacteria 11917
153 Ga0501032_0180567 3300049569 Bacteria 1382
154 Ga0501032_0245431 3300049569 Bacteria 1163
155 Ga0501033_0009971 3300049570 Bacteria 7294
156 Ga0501033_0219825 3300049570 Bacteria 1353
157 Ga0501034_0132361 3300049571 Bacteria 2477
158 Ga0501034_0187407 3300049571 Bacteria 2032
159 Ga0501034_0467213 3300049571 Bacteria 1178
160 Ga0501036_0002703 3300049572 Bacteria 14003
161 Ga0501036_0005447 3300049572 Bacteria 10311
162 Ga0501037_0001474 3300049573 Bacteria 17236
163 Ga0501038_0004848 3300049574 Bacteria 12502
164 Ga0501038_0005127 3300049574 Bacteria 12169
165 Ga0501038_0014278 3300049574 Bacteria 7236
166 Ga0501038_0229476 3300049574 Bacteria 1478
167 Ga0501039_0010398 3300049575 Bacteria 7092
168 Ga0501039_0023887 3300049575 Bacteria 4694
169 Ga0501039_0057185 3300049575 Bacteria 3021
170 Ga0501039_0063141 3300049575 Bacteria 2870
171 Ga0501039_0093517 3300049575 Bacteria 2343
172 Ga0501039_0315848 3300049575 Bacteria 1228
173 Ga0501040_0401905 3300049576 Bacteria 984
174 Ga0501041_0016882 3300049577 Bacteria 4343
175 Ga0501042_0010410 3300049578 Bacteria 6236
176 Ga0501042_0018395 3300049578 Bacteria 4836
177 Ga0501043_0001478 3300049579 Bacteria 20554
178 Ga0501043_0032090 3300049579 Bacteria 4128
179 Ga0501043_0113856 3300049579 Bacteria 2124
180 Ga0501046_0000617 3300049580 Bacteria 34979
181 Ga0501046_0002401 3300049580 Bacteria 17573
182 Ga0501047_0093697 3300049581 Bacteria 2882
183 Ga0501047_0189192 3300049581 Bacteria 1922
184 Ga0501048_0010816 3300049582 Bacteria 6804
185 Ga0501048_0012557 3300049582 Bacteria 6301
186 Ga0501048_0087372 3300049582 Bacteria 2200
187 Ga0501067_0082721 3300049583 Bacteria 1780
188 Ga0501067_0123853 3300049583 Bacteria 1439
189 Ga0501067_0142640 3300049583 Bacteria 1334
190 Ga0501069_0006211 3300049585 Bacteria 6243
191 Ga0501069_0051705 3300049585 Bacteria 2287
192 Ga0501070_0018939 3300049586 Bacteria 5774
193 Ga0501070_0023092 3300049586 Bacteria 5209
194 Ga0501070_0095650 3300049586 Bacteria 2457
195 Ga0501071_0008329 3300049587 Bacteria 6849
196 Ga0501071_0028902 3300049587 Bacteria 3909
197 Ga0501072_0038895 3300049588 Bacteria 3734
198 Ga0501072_0487674 3300049588 Bacteria 975
199 Ga0501074_0066177 3300049590 Bacteria 2599
200 Ga0501076_0343844 3300049592 Bacteria 1225
201 Ga0501209_045449 3300049656 Bacteria 1179
202 Ga0501079_0029409 3300049741 Bacteria 4218
203 Ga0501079_0126978 3300049741 Bacteria 1984
204 Ga0501079_0299205 3300049741 Bacteria 1259
205 Ga0501083_0243518 3300049744 Bacteria 1171
206 Ga0501035_0014912 3300049822 Bacteria 7170
207 Ga0501044_0031491 3300049823 Bacteria 5582
208 Ga0501044_0191964 3300049823 Bacteria 2005
209 Ga0501045_0070408 3300049824 Bacteria 2573
210 nmdc:mga03n38_134490_c1 3300050490 Bacteria 1229
211 nmdc:mga03n38_20028_c1 3300050490 Bacteria 2670
212 nmdc:mga03n38_71078_c1 3300050490 Bacteria 1611
213 nmdc:mga00v17_102831_c1 3300050491 Bacteria 1805
214 nmdc:mga00v17_156707_c1 3300050491 Bacteria 1464
215 nmdc:mga00v17_43120_c1 3300050491 Bacteria 2716
216 nmdc:mga00v17_9777_c1 3300050491 Bacteria 5209
217 nmdc:mga0yw44_117718_c1 3300050492 Bacteria 1709
218 nmdc:mga0yw44_164314_c1 3300050492 Bacteria 1455
219 nmdc:mga0yw44_316_c1 3300050492 Bacteria 16854
220 nmdc:mga0yw44_82773_c1 3300050492 Bacteria 2014
221 nmdc:mga06z11_19549_c1 3300050494 Bacteria 3117
222 nmdc:mga06z11_20870_c1 3300050494 Bacteria 3034
223 nmdc:mga06z11_31535_c1 3300050494 Bacteria 2577
224 nmdc:mga04h51_5141_c1 3300050495 Bacteria 3317
225 nmdc:mga07m45_787_c2 3300050496 Bacteria 11594
226 Ga0500644_0000014 3300053088 Bacteria 109650
227 Ga0500554_008591 3300053102 Bacteria 2408
228 Ga0500556_0002437 3300053104 Bacteria 5958
229 Ga0500593_006798 3300053117 Bacteria 4602
230 Ga0500573_0045598 3300053140 Bacteria 2527
231 Ga0501084_0400514 3300054114 Bacteria 1160
232 Ga0501082_0110933 3300060353 Bacteria 2374
233 Ga0466962_0031143 3300061719 Bacteria 2554
234 Ga0466962_0151321 3300061719 Bacteria 1126
235 2643825733 2643221561 Bacteria 4984412
236 2644089381 2643221615 Bacteria 5487866
237 2644319225 2643221657 Bacteria 5490246
238 2644319226 2643221657 Bacteria 5490246
239 2644531725 2643221696 Bacteria 5431823
240 2740169000 2739367898 Bacteria 4367674
241 2774392452 2773857762 Bacteria 5971770
242 2809196232 2808606439 Bacteria 5952208
243 2812351603 2811994878 Bacteria 5992952
244 2857484832 2857481737 Bacteria 4761446
245 2891970791 2891968417 Bacteria 5821697
246 2956940263 2956939328 Bacteria 3474458
247 3001121683 3001119090 Bacteria 3449530
248 8054611168 8054609563 Bacteria 5170090
249 Ga0501034_0199538
250 LJQas_1001255
251 Ga0070683_100369288
252 Ga0070677_10104626
253 Ga0070682_100193166
254 Ga0070660_100093646
255 Ga0070660_100159432
256 Ga0070662_100140121
257 Ga0070684_100283049
258 Ga0070664_100050137
259 Ga0070664_100422124
260 Ga0068860_100000334
261 Ga0081539_10043441
262 Ga0075365_10000543
263 Ga0075365_10001240
264 Ga0075365_10001497
265 Ga0075365_10042786
266 Ga0075365_10048110
267 Ga0075365_10050134
268 Ga0075365_10076344
269 Ga0075365_10130822
270 Ga0075365_10173729
271 Ga0075368_10000592
272 Ga0075368_10001120
273 Ga0075368_10019938
274 Ga0075363_100011501
275 Ga0075363_100017469
276 Ga0075363_100021450
277 Ga0075363_100115898
278 Ga0075364_10006986
279 Ga0075364_10027254
280 Ga0075364_10056482
281 Ga0075367_10021353
282 Ga0075370_10004600
283 Ga0075370_10160928
284 Ga0111539_10271083
285 Ga0105245_10022297
286 Ga0105245_10116248
287 Ga0105245_10809593
288 Ga0105243_10133777
289 Ga0105238_10416152
290 Ga0105239_10026120
291 Ga0105239_10029022
292 Ga0163162_10268358
293 Ga0157372_10550269
294 Ga0157375_10089046
295 Ga0157380_10298916
296 Ga0157380_10326740
297 Ga0157380_10363988
298 Ga0157380_10687940
299 Ga0157377_10152652
300 Ga0163161_10029084
301 Ga0207682_10070374
302 Ga0207688_10299920
303 Ga0207643_10073799
304 Ga0207657_10013630
305 Ga0207657_10111919
306 Ga0207650_10220339
307 Ga0207659_10457326
308 Ga0207687_10130355
309 Ga0207687_10301939
310 Ga0207690_10013295
311 Ga0207706_10168274
312 Ga0207704_10298267
313 Ga0207691_10071220
314 Ga0207661_10279370
315 Ga0207679_10035998
316 Ga0207658_10029858
317 Ga0207639_10443972
318 Ga0207678_10532586
319 Ga0207708_10065334
320 Ga0207708_10154564
321 Ga0207674_10255109
322 Ga0207675_100019913
323 Ga0207683_10024032
324 Ga0207698_10533974
325 Ga0209813_10004526
326 Ga0209813_10005295
327 Ga0268264_10014754
328 Ga0268264_10750522
329 Ga0307408_100352837
330 Ga0307413_10146760
331 Ga0307406_10145451
332 Ga0307406_10358327
333 Ga0307407_10073641
334 Ga0307407_10093833
335 Ga0307407_10100662
336 Ga0307412_10107350
337 Ga0307409_100044936
338 Ga0307409_100070594
339 Ga0307409_100072000
340 Ga0307409_100630607
341 Ga0307416_100148788
342 Ga0307416_100362974
343 Ga0307416_100846722
344 Ga0307415_100115253
345 Ga0395899_0090984
346 Ga0395899_0375431
347 Ga0395900_0479040
348 Ga0395898_0083834
349 Ga0395898_0182608
350 Ga0395905_0009140
351 Ga0395901_0124478
352 Ga0451791_1375559
353 Ga0451797_1134759
354 Ga0466972_0014294
355 Ga0466965_0013434
356 Ga0466965_0021812
357 Ga0466965_0045099
358 Ga0466965_0103660
359 Ga0466966_0057008
360 Ga0466966_0252750
361 Ga0466966_0316392
362 Ga0466961_0010466
363 Ga0466961_0038589
364 Ga0466961_0082667
365 Ga0466961_0106259
366 Ga0466964_0003527
367 Ga0466971_0011260
368 Ga0466971_0203759
369 Ga0466970_0009252
370 Ga0466970_0070066
371 Ga0466970_0097713
372 Ga0466970_0106011
373 Ga0466957_0006605
374 Ga0466957_0060120
375 Ga0466957_0074241
376 Ga0466960_0018848
377 Ga0466960_0076745
378 Ga0466959_0025151
379 Ga0466959_0138981
380 Ga0466959_0159373
381 Ga0466958_0071252
382 Ga0466967_0042097
383 Ga0466967_0135934
384 Ga0496102_0099623
385 Ga0496106_0005176
386 Ga0496106_0308417
387 Ga0496108_0391282
388 Ga0496110_0235485
389 Ga0496111_0176795
390 Ga0496111_0475732
391 Ga0496111_0511895
392 Ga0496112_0394776
393 Ga0496114_0177469
394 Ga0496114_0297938
395 Ga0496114_0388812
396 Ga0496114_0541964
397 Ga0496115_0056492
398 Ga0501031_0032059
399 Ga0501031_0058592
400 Ga0501032_0003539
401 Ga0501032_0180567
402 Ga0501032_0245431
403 Ga0501033_0009971
404 Ga0501033_0219825
405 Ga0501034_0132361
406 Ga0501034_0187407
407 Ga0501034_0467213
408 Ga0501036_0002703
409 Ga0501036_0005447
410 Ga0501037_0001474
411 Ga0501038_0004848
412 Ga0501038_0005127
413 Ga0501038_0014278
414 Ga0501038_0229476
415 Ga0501039_0010398
416 Ga0501039_0023887
417 Ga0501039_0057185
418 Ga0501039_0063141
419 Ga0501039_0093517
420 Ga0501039_0315848
421 Ga0501040_0401905
422 Ga0501041_0016882
423 Ga0501042_0010410
424 Ga0501042_0018395
425 Ga0501043_0001478
426 Ga0501043_0032090
427 Ga0501043_0113856
428 Ga0501046_0000617
429 Ga0501046_0002401
430 Ga0501047_0093697
431 Ga0501047_0189192
432 Ga0501048_0010816
433 Ga0501048_0012557
434 Ga0501048_0087372
435 Ga0501067_0082721
436 Ga0501067_0123853
437 Ga0501067_0142640
438 Ga0501069_0006211
439 Ga0501069_0051705
440 Ga0501070_0018939
441 Ga0501070_0023092
442 Ga0501070_0095650
443 Ga0501071_0008329
444 Ga0501071_0028902
445 Ga0501072_0038895
446 Ga0501072_0487674
447 Ga0501074_0066177
448 Ga0501076_0343844
449 Ga0501209_045449
450 Ga0501079_0029409
451 Ga0501079_0126978
452 Ga0501079_0299205
453 Ga0501083_0243518
454 Ga0501035_0014912
455 Ga0501044_0031491
456 Ga0501044_0191964
457 Ga0501045_0070408
458 nmdc:mga03n38_134490_c1
459 nmdc:mga03n38_20028_c1
460 nmdc:mga03n38_71078_c1
461 nmdc:mga00v17_102831_c1
462 nmdc:mga00v17_156707_c1
463 nmdc:mga00v17_43120_c1
464 nmdc:mga00v17_9777_c1
465 nmdc:mga0yw44_117718_c1
466 nmdc:mga0yw44_164314_c1
467 nmdc:mga0yw44_316_c1
468 nmdc:mga0yw44_82773_c1
469 nmdc:mga06z11_19549_c1
470 nmdc:mga06z11_20870_c1
471 nmdc:mga06z11_31535_c1
472 nmdc:mga04h51_5141_c1
473 nmdc:mga07m45_787_c2
474 Ga0500644_0000014
475 Ga0500554_008591
476 Ga0500556_0002437
477 Ga0500593_006798
478 Ga0500573_0045598
479 Ga0501084_0400514
480 Ga0501082_0110933
481 Ga0466962_0031143
482 Ga0466962_0151321
483 2643825733
484 2644089381
485 2644319225
486 2644319226
487 2644531725
488 2740169000
489 2774392452
490 2809196232
491 2812351603
492 2857484832
493 2891970791
494 2956940263
495 3001121683
496 8054611168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

168

295

0.96

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

42

126

0.93

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

139

296

0.87

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

32

131

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u0a-assembly1.cif.gz_A crystal structure of an acyl-coa thioesterase ii tesb2 from mycobacterium marinum 0.9505 8 283
3u0a-assembly1.cif.gz_A crystal structure of an acyl-coa thioesterase ii tesb2 from mycobacterium marinum 0.9362 8 283
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.9338 12 112
3u0a-assembly1.cif.gz_B crystal structure of an acyl-coa thioesterase ii tesb2 from mycobacterium marinum 0.9323 8 286
4r9z-assembly1.cif.gz_B mycobacterium avium subs paratuberculosis tesb protein map1729c 0.9314 4 281
ID Description Score Start End Superfamily
1c8uB02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9541 8 116 3.10.129.10
4r9zA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9313 7 281 2.40.160.210
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9256 12 111 3.10.129.10
4r9zA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9168 7 281 2.40.160.210
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9068 12 111 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A453CNU5-F1-model_v4 palmitoyl-CoA hydrolase (EC 3.1.2.2) 0.9397 11 138 GO:0006637
GO:0009062
GO:0047617
AF-A0A6H1C1T0-F1-model_v4 Acyl-CoA thioesterase II 0.9373 8 283 GO:0006637
GO:0009062
GO:0047617
AF-X8BBS4-F1-model_v4 deleted 0.9369 5 113
AF-A0A5A9ZR48-F1-model_v4 Acyl-CoA thioesterase II 0.9296 8 286 GO:0006637
GO:0009062
GO:0047617
AF-A0A4V5TMN3-F1-model_v4 Acyl-CoA thioesterase II 0.9256 4 281 GO:0006637
GO:0009062
GO:0047617

Map