F365192

General Info

Members Datasets Scaffolds Average Seq Length
254 153 508 476

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0002411|Ga0496115_0002411_729_2291
Length 520
Sequence MASSDTTDLRADSNTSPGSGPAATATTAAQGPGAAALDHGPDVHDRIEPYVWKIAGVVILGMIMSILDTTIVNVALRTLGHDLHSSISQIQWVVTGYLLSLAAVIPVTGWAARRFGAKRVYMTSLVLFTVGSGLCAVAASTTSLVVFRVLQGAGGGMIMPVGQLIMAQVAGPKRMGRVMGIVSMPAMLAPIXXXXVGGTILQNLHWSWIFLVNLPIGAIAFALAWRMLPHTDSGEAGPLDVLGLALLSTASTALVYGLSQLGTHSSLTAPVVVWPIAIAIVLSGVFIWHALRVERPLLDVRLYTNRVFGAASLTTFGLGAALFGAMILVPLYYQEVRHESVIVTGLLVGPQGLGMLLVMPLTSRLTQRFGGGRVALGGVLLLSLSSIPLAFVGASTSIAYISVVLLLRGVGIGFSFMPAMTAAFSALRPDQLSDATPQLNVLQRIGGAIGTAVLAVVLQRATGHALTKPASAFQDAYWWSVGICVLSLIPCVVLLRAENPRARLSKAAASAEASAEPLGV

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
70 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 12.6
Rhizosphere 76.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0002411 3300048918 Bacteria 13419
2 Ga0070683_100086543 3300005329 Bacteria 2938
3 Ga0070683_100086681 3300005329 Bacteria 2935
4 Ga0070682_100026765 3300005337 Bacteria 3455
5 Ga0070660_100074519 3300005339 Bacteria 2656
6 Ga0070675_100122539 3300005354 Bacteria 2210
7 Ga0070667_100017868 3300005367 Bacteria 5878
8 Ga0070714_100021758 3300005435 Bacteria 5249
9 Ga0070713_100205183 3300005436 Bacteria 1782
10 Ga0070711_100001729 3300005439 Bacteria 12118
11 Ga0070711_100041585 3300005439 Bacteria 3105
12 Ga0070700_100043335 3300005441 Bacteria 2768
13 Ga0070663_100003878 3300005455 Bacteria 8714
14 Ga0070681_10178693 3300005458 Bacteria 2044
15 Ga0070679_100000243 3300005530 Bacteria 45435
16 Ga0070679_100006787 3300005530 Bacteria 10676
17 Ga0070684_100012546 3300005535 Bacteria 6798
18 Ga0070684_100097694 3300005535 Bacteria 2619
19 Ga0070665_100000138 3300005548 Bacteria 136562
20 Ga0070704_100076945 3300005549 Bacteria 2442
21 Ga0070664_100018089 3300005564 Bacteria 5786
22 Ga0070664_100152691 3300005564 Bacteria 2039
23 Ga0068854_100032535 3300005578 Bacteria 3630
24 Ga0068856_100020774 3300005614 Bacteria 6381
25 Ga0068864_100010499 3300005618 Bacteria 7652
26 Ga0068863_100091003 3300005841 Bacteria 2893
27 Ga0068858_100000002 3300005842 Bacteria 351633
28 Ga0068858_100000009 3300005842 Bacteria 237748
29 Ga0081455_10004359 3300005937 Bacteria 15931
30 Ga0081455_10009157 3300005937 Bacteria 10211
31 Ga0081455_10052779 3300005937 Bacteria 3477
32 Ga0081455_10108537 3300005937 Bacteria 2210
33 Ga0081540_1000804 3300005983 Bacteria 28834
34 Ga0070712_100011125 3300006175 Bacteria 5696
35 Ga0070712_100011163 3300006175 Bacteria 5686
36 Ga0105240_10017191 3300009093 Bacteria 9759
37 Ga0105240_10218667 3300009093 Bacteria 2221
38 Ga0105245_10043634 3300009098 Bacteria 4000
39 Ga0105248_10001054 3300009177 Bacteria 30541
40 Ga0105237_10225289 3300009545 Bacteria 1875
41 Ga0105238_10234343 3300009551 Bacteria 1813
42 Ga0105239_10033876 3300010375 Bacteria 5607
43 Ga0105239_10104107 3300010375 Bacteria 3142
44 Ga0105246_10053127 3300011119 Bacteria 2787
45 Ga0163163_10003316 3300014325 Bacteria 13654
46 Ga0157379_10000003 3300014968 Bacteria 174612
47 Ga0157379_10002514 3300014968 Bacteria 15350
48 Ga0157376_10207395 3300014969 Bacteria 1807
49 Ga0213876_10020804 3300021384 Bacteria 3469
50 Ga0207692_10053671 3300025898 Bacteria 2054
51 Ga0207688_10003265 3300025901 Bacteria 8860
52 Ga0207707_10005406 3300025912 Bacteria 11169
53 Ga0207695_10036667 3300025913 Bacteria 5297
54 Ga0207693_10017072 3300025915 Bacteria 5793
55 Ga0207663_10001488 3300025916 Bacteria 10922
56 Ga0207663_10032095 3300025916 Bacteria 3115
57 Ga0207652_10000907 3300025921 Bacteria 27991
58 Ga0207652_10017381 3300025921 Bacteria 5886
59 Ga0207659_10160347 3300025926 Bacteria 1765
60 Ga0207700_10078378 3300025928 Bacteria 2570
61 Ga0207664_10122535 3300025929 Bacteria 2178
62 Ga0207706_10015563 3300025933 Bacteria 6872
63 Ga0207665_10043010 3300025939 Bacteria 3019
64 Ga0207711_10000727 3300025941 Bacteria 32434
65 Ga0207661_10062200 3300025944 Bacteria 3019
66 Ga0207661_10067917 3300025944 Bacteria 2901
67 Ga0207679_10019519 3300025945 Bacteria 4555
68 Ga0207679_10087211 3300025945 Bacteria 2403
69 Ga0207640_10089389 3300025981 Bacteria 2129
70 Ga0207658_10001313 3300025986 Bacteria 19550
71 Ga0207658_10012666 3300025986 Bacteria 5760
72 Ga0207703_10000001 3300026035 Bacteria 822925
73 Ga0207703_10000023 3300026035 Bacteria 222018
74 Ga0207678_10004827 3300026067 Bacteria 12106
75 Ga0207678_10215605 3300026067 Bacteria 1642
76 Ga0207708_10003829 3300026075 Bacteria 11088
77 Ga0207702_10165732 3300026078 Bacteria 2021
78 Ga0207641_10078614 3300026088 Bacteria 2858
79 Ga0207641_10162629 3300026088 Bacteria 2031
80 Ga0207641_10217990 3300026088 Bacteria 1768
81 Ga0207676_10115811 3300026095 Bacteria 2251
82 Ga0268266_10000047 3300028379 Bacteria 310996
83 Ga0268266_10000160 3300028379 Bacteria 125999
84 Ga0268266_10000336 3300028379 Bacteria 73612
85 Ga0268266_10000775 3300028379 Bacteria 42696
86 Ga0268266_10061842 3300028379 Bacteria 3230
87 Ga0265337_1004107 3300028556 Bacteria 6114
88 Ga0265319_1000035 3300028563 Bacteria 117269
89 Ga0265318_10000275 3300028577 Bacteria 43186
90 Ga0265336_10000043 3300028666 Bacteria 132135
91 Ga0265336_10014104 3300028666 Bacteria 2653
92 Ga0265338_10000142 3300028800 Bacteria 132135
93 Ga0265338_10000171 3300028800 Bacteria 120054
94 Ga0265338_10100975 3300028800 Bacteria 2350
95 Ga0265324_10004048 3300029957 Bacteria 6739
96 Ga0265325_10056748 3300031241 Bacteria 1999
97 Ga0265340_10000006 3300031247 Bacteria 132135
98 Ga0265327_10012675 3300031251 Bacteria 5667
99 Ga0265316_10020644 3300031344 Bacteria 5601
100 Ga0307415_100157373 3300032126 Bacteria 1756
101 Ga0373937_0029090 3300036401 Bacteria 5003
102 Ga0373937_0271780 3300036401 Bacteria 1600
103 Ga0395900_0037611 3300037418 Bacteria 4989
104 Ga0395898_0000942 3300037466 Bacteria 46333
105 Ga0395898_0052094 3300037466 Bacteria 3999
106 Ga0395905_0151587 3300037471 Bacteria 2181
107 Ga0466965_0063503 3300044683 Bacteria 1848
108 Ga0466965_0089124 3300044683 Bacteria 1568
109 Ga0466961_0117737 3300044693 Bacteria 1669
110 Ga0466957_0061846 3300044842 Bacteria 2299
111 Ga0466959_0002586 3300045049 Bacteria 11620
112 Ga0466967_0001274 3300045976 Bacteria 14307
113 Ga0466967_0001467 3300045976 Bacteria 13726
114 Ga0466967_0029663 3300045976 Bacteria 4581
115 Ga0466967_0033122 3300045976 Bacteria 4373
116 Ga0495641_0000105 3300046461 Bacteria 59170
117 Ga0495653_0004713 3300046463 Bacteria 11039
118 Ga0495664_0000007 3300046477 Bacteria 386710
119 Ga0495618_0000035 3300046514 Bacteria 102739
120 Ga0495628_0114392 3300046516 Bacteria 2073
121 Ga0495652_0039046 3300046529 Bacteria 4107
122 Ga0495640_0004167 3300046533 Bacteria 11564
123 Ga0495645_0000033 3300046543 Bacteria 105930
124 Ga0495645_0000159 3300046543 Bacteria 46648
125 Ga0495645_0017195 3300046543 Bacteria 5180
126 Ga0495634_0006643 3300046642 Bacteria 8777
127 Ga0495646_0019669 3300046680 Bacteria 4272
128 Ga0495624_0087525 3300046690 Bacteria 1924
129 Ga0495649_0001983 3300046694 Bacteria 14839
130 Ga0495604_0012500 3300047317 Bacteria 6753
131 Ga0495674_0000027 3300047319 Bacteria 132744
132 Ga0495672_0024658 3300047320 Bacteria 3870
133 Ga0495676_0000106 3300047321 Bacteria 62878
134 Ga0495680_0003409 3300047322 Bacteria 15679
135 Ga0496100_0004684 3300048903 Bacteria 7291
136 Ga0496100_0009129 3300048903 Bacteria 5563
137 Ga0496100_0101213 3300048903 Bacteria 1986
138 Ga0496101_0010157 3300048904 Bacteria 6210
139 Ga0496102_0030800 3300048905 Bacteria 4804
140 Ga0496102_0049446 3300048905 Bacteria 3825
141 Ga0496103_0038034 3300048906 Bacteria 2951
142 Ga0496104_0000001 3300048907 Bacteria 711867
143 Ga0496104_0023342 3300048907 Bacteria 5686
144 Ga0496104_0023833 3300048907 Bacteria 5628
145 Ga0496104_0091565 3300048907 Bacteria 2907
146 Ga0496104_0146166 3300048907 Bacteria 2270
147 Ga0496105_0023650 3300048908 Bacteria 4986
148 Ga0496105_0023687 3300048908 Bacteria 4983
149 Ga0496105_0184175 3300048908 Bacteria 1709
150 Ga0496106_0003754 3300048909 Bacteria 11328
151 Ga0496107_0006802 3300048910 Bacteria 7876
152 Ga0496108_0012707 3300048911 Bacteria 6858
153 Ga0496108_0119790 3300048911 Bacteria 2256
154 Ga0496109_0052476 3300048912 Bacteria 3716
155 Ga0496109_0114256 3300048912 Bacteria 2512
156 Ga0496110_0000152 3300048913 Bacteria 41561
157 Ga0496110_0010707 3300048913 Bacteria 7470
158 Ga0496110_0143291 3300048913 Bacteria 2160
159 Ga0496111_0000123 3300048914 Bacteria 33765
160 Ga0496112_0145487 3300048915 Bacteria 2339
161 Ga0496113_0061906 3300048916 Bacteria 2825
162 Ga0496113_0095758 3300048916 Bacteria 2294
163 Ga0496114_0041049 3300048917 Bacteria 3834
164 Ga0496115_0003262 3300048918 Bacteria 11632
165 Ga0496115_0078369 3300048918 Bacteria 2688
166 Ga0496116_0000331 3300048919 Bacteria 76536
167 Ga0496116_0004397 3300048919 Bacteria 13479
168 Ga0496117_0001154 3300048920 Bacteria 39767
169 Ga0496117_0008314 3300048920 Bacteria 9875
170 Ga0496118_0001155 3300048921 Bacteria 40723
171 Ga0496118_0016131 3300048921 Bacteria 6870
172 Ga0496118_0096021 3300048921 Bacteria 2021
173 Ga0496119_0000641 3300048922 Bacteria 47158
174 Ga0496119_0002829 3300048922 Bacteria 18552
175 Ga0496119_0004993 3300048922 Bacteria 12953
176 Ga0496119_0013285 3300048922 Bacteria 6579
177 Ga0496119_0072711 3300048922 Bacteria 2008
178 Ga0496120_0008665 3300048923 Bacteria 7338
179 Ga0496120_0010519 3300048923 Bacteria 6448
180 Ga0496121_0019417 3300048924 Bacteria 6795
181 Ga0496121_0020425 3300048924 Bacteria 6558
182 Ga0496121_0033972 3300048924 Bacteria 4601
183 Ga0496121_0056683 3300048924 Bacteria 3252
184 Ga0496124_0031157 3300048927 Bacteria 4724
185 Ga0496124_0086950 3300048927 Bacteria 2557
186 Ga0496125_0018691 3300048928 Bacteria 6573
187 Ga0496125_0022241 3300048928 Bacteria 5893
188 Ga0496126_0101378 3300048929 Bacteria 2518
189 Ga0496126_0120272 3300048929 Bacteria 2278
190 Ga0501031_0000735 3300049568 Bacteria 19649
191 Ga0501031_0001469 3300049568 Bacteria 14632
192 Ga0501032_0001337 3300049569 Bacteria 19648
193 Ga0501032_0001897 3300049569 Bacteria 16499
194 Ga0501033_0000261 3300049570 Bacteria 50442
195 Ga0501033_0002157 3300049570 Bacteria 17023
196 Ga0501034_0005330 3300049571 Bacteria 14088
197 Ga0501034_0025608 3300049571 Bacteria 6007
198 Ga0501034_0146897 3300049571 Bacteria 2335
199 Ga0501036_0000063 3300049572 Bacteria 69495
200 Ga0501036_0002292 3300049572 Bacteria 14969
201 Ga0501037_0000221 3300049573 Bacteria 49689
202 Ga0501037_0004176 3300049573 Bacteria 10472
203 Ga0501038_0002521 3300049574 Bacteria 17065
204 Ga0501039_0057701 3300049575 Bacteria 3006
205 Ga0501039_0061341 3300049575 Bacteria 2912
206 Ga0501040_0036592 3300049576 Bacteria 3332
207 Ga0501042_0014545 3300049578 Bacteria 5374
208 Ga0501043_0000237 3300049579 Bacteria 49809
209 Ga0501043_0001413 3300049579 Bacteria 20985
210 Ga0501046_0001941 3300049580 Bacteria 19630
211 Ga0501046_0002692 3300049580 Bacteria 16551
212 Ga0501047_0000376 3300049581 Bacteria 50385
213 Ga0501047_0001903 3300049581 Bacteria 20069
214 Ga0501047_0013822 3300049581 Bacteria 7665
215 Ga0501047_0086030 3300049581 Bacteria 3020
216 Ga0501047_0182532 3300049581 Bacteria 1964
217 Ga0501047_0226780 3300049581 Bacteria 1723
218 Ga0501048_0001675 3300049582 Bacteria 16878
219 Ga0501048_0002330 3300049582 Bacteria 14491
220 Ga0501068_0032145 3300049584 Bacteria 3119
221 Ga0501069_0004575 3300049585 Bacteria 7153
222 Ga0501069_0030184 3300049585 Bacteria 2976
223 Ga0501070_0000178 3300049586 Bacteria 59157
224 Ga0501070_0000179 3300049586 Bacteria 59086
225 Ga0501070_0001297 3300049586 Bacteria 22435
226 Ga0501070_0027541 3300049586 Bacteria 4767
227 Ga0501070_0043715 3300049586 Bacteria 3728
228 Ga0501070_0154933 3300049586 Bacteria 1890
229 Ga0501073_0004413 3300049589 Bacteria 10573
230 Ga0501073_0006910 3300049589 Bacteria 8447
231 Ga0501074_0016994 3300049590 Bacteria 5277
232 Ga0501079_0002628 3300049741 Bacteria 13067
233 Ga0501079_0078498 3300049741 Bacteria 2553
234 Ga0501080_0013513 3300049742 Bacteria 7513
235 Ga0501080_0110774 3300049742 Bacteria 2544
236 Ga0501083_0001923 3300049744 Bacteria 14284
237 Ga0501083_0003781 3300049744 Bacteria 10629
238 Ga0501083_0036506 3300049744 Bacteria 3352
239 Ga0501083_0056633 3300049744 Bacteria 2626
240 Ga0501035_0000616 3300049822 Bacteria 39216
241 Ga0501035_0003882 3300049822 Bacteria 14263
242 Ga0501035_0089708 3300049822 Bacteria 2707
243 Ga0501044_0000416 3300049823 Bacteria 52684
244 Ga0501044_0002885 3300049823 Bacteria 19571
245 Ga0501044_0052055 3300049823 Bacteria 4221
246 Ga0501045_0075811 3300049824 Bacteria 2477
247 Ga0495601_0000035 3300053077 Bacteria 92903
248 Ga0495601_0028871 3300053077 Bacteria 3438
249 Ga0495612_0000369 3300053078 Bacteria 18070
250 Ga0500614_000032 3300053123 Bacteria 31310
251 Ga0500658_0012003 3300053134 Bacteria 3194
252 Ga0501084_0140658 3300054114 Bacteria 2032
253 Ga0501082_0010745 3300060353 Bacteria 7880
254 2552111254 2551306166 Bacteria 9731570
255 Ga0496115_0002411
256 Ga0070683_100086543
257 Ga0070683_100086681
258 Ga0070682_100026765
259 Ga0070660_100074519
260 Ga0070675_100122539
261 Ga0070667_100017868
262 Ga0070714_100021758
263 Ga0070713_100205183
264 Ga0070711_100001729
265 Ga0070711_100041585
266 Ga0070700_100043335
267 Ga0070663_100003878
268 Ga0070681_10178693
269 Ga0070679_100000243
270 Ga0070679_100006787
271 Ga0070684_100012546
272 Ga0070684_100097694
273 Ga0070665_100000138
274 Ga0070704_100076945
275 Ga0070664_100018089
276 Ga0070664_100152691
277 Ga0068854_100032535
278 Ga0068856_100020774
279 Ga0068864_100010499
280 Ga0068863_100091003
281 Ga0068858_100000002
282 Ga0068858_100000009
283 Ga0081455_10004359
284 Ga0081455_10009157
285 Ga0081455_10052779
286 Ga0081455_10108537
287 Ga0081540_1000804
288 Ga0070712_100011125
289 Ga0070712_100011163
290 Ga0105240_10017191
291 Ga0105240_10218667
292 Ga0105245_10043634
293 Ga0105248_10001054
294 Ga0105237_10225289
295 Ga0105238_10234343
296 Ga0105239_10033876
297 Ga0105239_10104107
298 Ga0105246_10053127
299 Ga0163163_10003316
300 Ga0157379_10000003
301 Ga0157379_10002514
302 Ga0157376_10207395
303 Ga0213876_10020804
304 Ga0207692_10053671
305 Ga0207688_10003265
306 Ga0207707_10005406
307 Ga0207695_10036667
308 Ga0207693_10017072
309 Ga0207663_10001488
310 Ga0207663_10032095
311 Ga0207652_10000907
312 Ga0207652_10017381
313 Ga0207659_10160347
314 Ga0207700_10078378
315 Ga0207664_10122535
316 Ga0207706_10015563
317 Ga0207665_10043010
318 Ga0207711_10000727
319 Ga0207661_10062200
320 Ga0207661_10067917
321 Ga0207679_10019519
322 Ga0207679_10087211
323 Ga0207640_10089389
324 Ga0207658_10001313
325 Ga0207658_10012666
326 Ga0207703_10000001
327 Ga0207703_10000023
328 Ga0207678_10004827
329 Ga0207678_10215605
330 Ga0207708_10003829
331 Ga0207702_10165732
332 Ga0207641_10078614
333 Ga0207641_10162629
334 Ga0207641_10217990
335 Ga0207676_10115811
336 Ga0268266_10000047
337 Ga0268266_10000160
338 Ga0268266_10000336
339 Ga0268266_10000775
340 Ga0268266_10061842
341 Ga0265337_1004107
342 Ga0265319_1000035
343 Ga0265318_10000275
344 Ga0265336_10000043
345 Ga0265336_10014104
346 Ga0265338_10000142
347 Ga0265338_10000171
348 Ga0265338_10100975
349 Ga0265324_10004048
350 Ga0265325_10056748
351 Ga0265340_10000006
352 Ga0265327_10012675
353 Ga0265316_10020644
354 Ga0307415_100157373
355 Ga0373937_0029090
356 Ga0373937_0271780
357 Ga0395900_0037611
358 Ga0395898_0000942
359 Ga0395898_0052094
360 Ga0395905_0151587
361 Ga0466965_0063503
362 Ga0466965_0089124
363 Ga0466961_0117737
364 Ga0466957_0061846
365 Ga0466959_0002586
366 Ga0466967_0001274
367 Ga0466967_0001467
368 Ga0466967_0029663
369 Ga0466967_0033122
370 Ga0495641_0000105
371 Ga0495653_0004713
372 Ga0495664_0000007
373 Ga0495618_0000035
374 Ga0495628_0114392
375 Ga0495652_0039046
376 Ga0495640_0004167
377 Ga0495645_0000033
378 Ga0495645_0000159
379 Ga0495645_0017195
380 Ga0495634_0006643
381 Ga0495646_0019669
382 Ga0495624_0087525
383 Ga0495649_0001983
384 Ga0495604_0012500
385 Ga0495674_0000027
386 Ga0495672_0024658
387 Ga0495676_0000106
388 Ga0495680_0003409
389 Ga0496100_0004684
390 Ga0496100_0009129
391 Ga0496100_0101213
392 Ga0496101_0010157
393 Ga0496102_0030800
394 Ga0496102_0049446
395 Ga0496103_0038034
396 Ga0496104_0000001
397 Ga0496104_0023342
398 Ga0496104_0023833
399 Ga0496104_0091565
400 Ga0496104_0146166
401 Ga0496105_0023650
402 Ga0496105_0023687
403 Ga0496105_0184175
404 Ga0496106_0003754
405 Ga0496107_0006802
406 Ga0496108_0012707
407 Ga0496108_0119790
408 Ga0496109_0052476
409 Ga0496109_0114256
410 Ga0496110_0000152
411 Ga0496110_0010707
412 Ga0496110_0143291
413 Ga0496111_0000123
414 Ga0496112_0145487
415 Ga0496113_0061906
416 Ga0496113_0095758
417 Ga0496114_0041049
418 Ga0496115_0003262
419 Ga0496115_0078369
420 Ga0496116_0000331
421 Ga0496116_0004397
422 Ga0496117_0001154
423 Ga0496117_0008314
424 Ga0496118_0001155
425 Ga0496118_0016131
426 Ga0496118_0096021
427 Ga0496119_0000641
428 Ga0496119_0002829
429 Ga0496119_0004993
430 Ga0496119_0013285
431 Ga0496119_0072711
432 Ga0496120_0008665
433 Ga0496120_0010519
434 Ga0496121_0019417
435 Ga0496121_0020425
436 Ga0496121_0033972
437 Ga0496121_0056683
438 Ga0496124_0031157
439 Ga0496124_0086950
440 Ga0496125_0018691
441 Ga0496125_0022241
442 Ga0496126_0101378
443 Ga0496126_0120272
444 Ga0501031_0000735
445 Ga0501031_0001469
446 Ga0501032_0001337
447 Ga0501032_0001897
448 Ga0501033_0000261
449 Ga0501033_0002157
450 Ga0501034_0005330
451 Ga0501034_0025608
452 Ga0501034_0146897
453 Ga0501036_0000063
454 Ga0501036_0002292
455 Ga0501037_0000221
456 Ga0501037_0004176
457 Ga0501038_0002521
458 Ga0501039_0057701
459 Ga0501039_0061341
460 Ga0501040_0036592
461 Ga0501042_0014545
462 Ga0501043_0000237
463 Ga0501043_0001413
464 Ga0501046_0001941
465 Ga0501046_0002692
466 Ga0501047_0000376
467 Ga0501047_0001903
468 Ga0501047_0013822
469 Ga0501047_0086030
470 Ga0501047_0182532
471 Ga0501047_0226780
472 Ga0501048_0001675
473 Ga0501048_0002330
474 Ga0501068_0032145
475 Ga0501069_0004575
476 Ga0501069_0030184
477 Ga0501070_0000178
478 Ga0501070_0000179
479 Ga0501070_0001297
480 Ga0501070_0027541
481 Ga0501070_0043715
482 Ga0501070_0154933
483 Ga0501073_0004413
484 Ga0501073_0006910
485 Ga0501074_0016994
486 Ga0501079_0002628
487 Ga0501079_0078498
488 Ga0501080_0013513
489 Ga0501080_0110774
490 Ga0501083_0001923
491 Ga0501083_0003781
492 Ga0501083_0036506
493 Ga0501083_0056633
494 Ga0501035_0000616
495 Ga0501035_0003882
496 Ga0501035_0089708
497 Ga0501044_0000416
498 Ga0501044_0002885
499 Ga0501044_0052055
500 Ga0501045_0075811
501 Ga0495601_0000035
502 Ga0495601_0028871
503 Ga0495612_0000369
504 Ga0500614_000032
505 Ga0500658_0012003
506 Ga0501084_0140658
507 Ga0501082_0010745
508 2552111254

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

58

451

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8307 11 440
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7842 11 440
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7579 14 431
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.7478 14 431
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.7337 12 434
ID Description Score Start End Superfamily
af_A0A1D6E9C8_1_113_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9382 53 125 1.20.1250.20
af_Q2FVL1_227_449_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9137 235 429 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9125 17 170 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9106 20 175 1.20.1250.20
af_O69695_290_487_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8926 239 429 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A535C655-F1-model_v4 MFS transporter 0.9653 16 130 GO:0016020
GO:0022857
AF-A0A535C655-F1-model_v4 MFS transporter 0.8972 16 130 GO:0016020
GO:0022857
AF-A0A7S0E354-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.8765 9 175 GO:0016020
GO:0022857
AF-A0A353DBH9-F1-model_v4 MFS transporter 0.8662 10 190 GO:0016020
GO:0022857
AF-A0A7J5T7M2-F1-model_v4 deleted 0.8657 17 239

Map