F364990
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 254 | 159 | 508 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100102326|Ga0307408_1001023262 |
| Length | 266 |
| Sequence | VYGVHLLLLKIGVRRTLVKGCKESGRINGMSSQGTAPRVRLNRDRVLQAAVTLADGIGIGPLSMRRLAQELDVVPMALYKHVANKDELLDGMVDVIITEIDPPATGLGWKDAVRGRILSARSVLQRHQWARQVLETRTNKTPGVLAYMDSFIGMFLDGGFSVDLTHHVMHAIGSRMWGFTQELFDEPANNDDAGVVDAGDAARQAMFQEMATRYPNVLTIAMASAHDPAGVVGQGCDDQFEFEFALDLLLDGIDRLHAQGWTSVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 19 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 20 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 21 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 22 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 23 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 25 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 26 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 27 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 28 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 29 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 30 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 31 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 32 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 64 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 66 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 67 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 68 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 69 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 70 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 71 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 72 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 73 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 74 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 75 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 76 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 77 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 78 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 79 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 80 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 81 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 82 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 83 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 84 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 85 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 86 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 87 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 88 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 89 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 90 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 91 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 92 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 93 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 94 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 110 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 111 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 112 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 113 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 114 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 115 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 116 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 117 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 118 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 119 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 120 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 121 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 122 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 123 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 124 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 125 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 135 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 141 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 143 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 144 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 145 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 146 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 147 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 148 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 149 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 150 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 151 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 152 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 153 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 154 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 155 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 156 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 157 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 158 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 159 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.91 |
| Metatranscriptomes | 0 |
| Isolates | 7.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 10.24 |
| Rhizosphere | 84.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307408_100102326 | 3300031548 | Bacteria | 2184 |
| 2 | JGI25407J50210_10004330 | 3300003373 | Bacteria | 3449 |
| 3 | JGI25407J50210_10029907 | 3300003373 | Bacteria | 1411 |
| 4 | JGI25407J50210_10034674 | 3300003373 | Bacteria | 1301 |
| 5 | Ga0070658_10004441 | 3300005327 | Bacteria | 11423 |
| 6 | Ga0070676_10090930 | 3300005328 | Bacteria | 1869 |
| 7 | Ga0070668_100279538 | 3300005347 | Bacteria | 1394 |
| 8 | Ga0070675_100167757 | 3300005354 | Bacteria | 1892 |
| 9 | Ga0070673_100109898 | 3300005364 | Bacteria | 2285 |
| 10 | Ga0070667_100236887 | 3300005367 | Bacteria | 1629 |
| 11 | Ga0070714_100014324 | 3300005435 | Bacteria | 6368 |
| 12 | Ga0070705_100022652 | 3300005440 | Bacteria | 3360 |
| 13 | Ga0070694_100061419 | 3300005444 | Bacteria | 2564 |
| 14 | Ga0070708_100562837 | 3300005445 | Bacteria | 1075 |
| 15 | Ga0070672_100565209 | 3300005543 | Bacteria | 988 |
| 16 | Ga0070696_100480037 | 3300005546 | Bacteria | 986 |
| 17 | Ga0070704_100093219 | 3300005549 | Bacteria | 2250 |
| 18 | Ga0070664_100848523 | 3300005564 | Bacteria | 855 |
| 19 | Ga0068856_100032275 | 3300005614 | Bacteria | 5126 |
| 20 | Ga0068866_10057533 | 3300005718 | Bacteria | 2004 |
| 21 | Ga0068861_100207976 | 3300005719 | Bacteria | 1647 |
| 22 | Ga0068860_100923029 | 3300005843 | Bacteria | 890 |
| 23 | Ga0081455_10002899 | 3300005937 | Bacteria | 20137 |
| 24 | Ga0081538_10001119 | 3300005981 | Bacteria | 28423 |
| 25 | Ga0081538_10002578 | 3300005981 | Bacteria | 17592 |
| 26 | Ga0081538_10007870 | 3300005981 | Bacteria | 9136 |
| 27 | Ga0081538_10012459 | 3300005981 | Bacteria | 6815 |
| 28 | Ga0081538_10026748 | 3300005981 | Bacteria | 4024 |
| 29 | Ga0081538_10052722 | 3300005981 | Bacteria | 2427 |
| 30 | Ga0081538_10067113 | 3300005981 | Bacteria | 2005 |
| 31 | Ga0081539_10005733 | 3300005985 | Bacteria | 12419 |
| 32 | Ga0075363_100125400 | 3300006048 | Bacteria | 1437 |
| 33 | Ga0075432_10000074 | 3300006058 | Bacteria | 19936 |
| 34 | Ga0075432_10001467 | 3300006058 | Bacteria | 7693 |
| 35 | Ga0075432_10003606 | 3300006058 | Bacteria | 5260 |
| 36 | Ga0075432_10037341 | 3300006058 | Bacteria | 1691 |
| 37 | Ga0075427_10001691 | 3300006194 | Bacteria | 2869 |
| 38 | Ga0075427_10018607 | 3300006194 | Bacteria | 1091 |
| 39 | Ga0075428_100011796 | 3300006844 | Bacteria | 9727 |
| 40 | Ga0075428_100297433 | 3300006844 | Bacteria | 1736 |
| 41 | Ga0075428_100944886 | 3300006844 | Bacteria | 914 |
| 42 | Ga0075430_100001895 | 3300006846 | Bacteria | 17144 |
| 43 | Ga0075430_100445283 | 3300006846 | Bacteria | 1069 |
| 44 | Ga0075431_100007869 | 3300006847 | Bacteria | 10622 |
| 45 | Ga0075433_10017015 | 3300006852 | Bacteria | 6010 |
| 46 | Ga0075433_10029083 | 3300006852 | Bacteria | 4705 |
| 47 | Ga0075434_100208942 | 3300006871 | Bacteria | 1972 |
| 48 | Ga0075429_100202560 | 3300006880 | Bacteria | 1739 |
| 49 | Ga0068865_100087737 | 3300006881 | Bacteria | 2249 |
| 50 | Ga0075436_100111702 | 3300006914 | Bacteria | 1908 |
| 51 | Ga0105251_10079451 | 3300009011 | Bacteria | 1518 |
| 52 | Ga0111539_10003882 | 3300009094 | Bacteria | 19674 |
| 53 | Ga0105245_10288700 | 3300009098 | Bacteria | 1606 |
| 54 | Ga0114129_10001178 | 3300009147 | Bacteria | 34683 |
| 55 | Ga0114129_10022408 | 3300009147 | Bacteria | 8968 |
| 56 | Ga0114129_10036273 | 3300009147 | Bacteria | 6963 |
| 57 | Ga0114129_10089708 | 3300009147 | Bacteria | 4261 |
| 58 | Ga0114129_10099421 | 3300009147 | Bacteria | 4026 |
| 59 | Ga0114129_10618148 | 3300009147 | Bacteria | 1402 |
| 60 | Ga0105243_10034822 | 3300009148 | Bacteria | 3901 |
| 61 | Ga0105243_10054149 | 3300009148 | Bacteria | 3184 |
| 62 | Ga0105243_10242478 | 3300009148 | Bacteria | 1605 |
| 63 | Ga0105242_10001516 | 3300009176 | Bacteria | 18253 |
| 64 | Ga0105242_10552909 | 3300009176 | Bacteria | 1104 |
| 65 | Ga0105249_10128621 | 3300009553 | Bacteria | 2415 |
| 66 | Ga0105246_10358758 | 3300011119 | Bacteria | 1197 |
| 67 | Ga0157378_10030211 | 3300013297 | Bacteria | 4787 |
| 68 | Ga0163162_10117780 | 3300013306 | Bacteria | 2758 |
| 69 | Ga0157375_10192895 | 3300013308 | Bacteria | 2192 |
| 70 | Ga0157375_10228241 | 3300013308 | Unclassified | 2021 |
| 71 | Ga0157377_10401163 | 3300014745 | Bacteria | 934 |
| 72 | Ga0207697_10001545 | 3300025315 | Bacteria | 12463 |
| 73 | Ga0207682_10006618 | 3300025893 | Bacteria | 4660 |
| 74 | Ga0207642_10120311 | 3300025899 | Bacteria | 1353 |
| 75 | Ga0207647_10291833 | 3300025904 | Bacteria | 930 |
| 76 | Ga0207645_10001051 | 3300025907 | Bacteria | 22851 |
| 77 | Ga0207705_10007652 | 3300025909 | Bacteria | 7941 |
| 78 | Ga0207650_10150866 | 3300025925 | Bacteria | 1834 |
| 79 | Ga0207686_10298197 | 3300025934 | Bacteria | 1196 |
| 80 | Ga0207709_10006791 | 3300025935 | Bacteria | 6402 |
| 81 | Ga0207709_10047085 | 3300025935 | Bacteria | 2620 |
| 82 | Ga0207691_10002435 | 3300025940 | Bacteria | 18208 |
| 83 | Ga0207679_10805307 | 3300025945 | Bacteria | 857 |
| 84 | Ga0207712_10087605 | 3300025961 | Bacteria | 2284 |
| 85 | Ga0207677_10482796 | 3300026023 | Bacteria | 1068 |
| 86 | Ga0207674_10353391 | 3300026116 | Bacteria | 1421 |
| 87 | Ga0207675_100073513 | 3300026118 | Bacteria | 3199 |
| 88 | Ga0207683_10011169 | 3300026121 | Bacteria | 7656 |
| 89 | Ga0207428_10002644 | 3300027907 | Bacteria | 17855 |
| 90 | Ga0207428_10028556 | 3300027907 | Bacteria | 4634 |
| 91 | Ga0207428_10044960 | 3300027907 | Bacteria | 3560 |
| 92 | Ga0268266_10325039 | 3300028379 | Bacteria | 1441 |
| 93 | Ga0265327_10181387 | 3300031251 | Bacteria | 963 |
| 94 | Ga0307408_100030011 | 3300031548 | Bacteria | 3772 |
| 95 | Ga0307408_100033182 | 3300031548 | Bacteria | 3604 |
| 96 | Ga0307408_100146631 | 3300031548 | Bacteria | 1858 |
| 97 | Ga0307408_100147573 | 3300031548 | Bacteria | 1853 |
| 98 | Ga0307408_100908420 | 3300031548 | Bacteria | 806 |
| 99 | Ga0307405_10021708 | 3300031731 | Bacteria | 3614 |
| 100 | Ga0307405_10036305 | 3300031731 | Bacteria | 2951 |
| 101 | Ga0307405_10051227 | 3300031731 | Bacteria | 2561 |
| 102 | Ga0307413_10008748 | 3300031824 | Bacteria | 4801 |
| 103 | Ga0307413_10306231 | 3300031824 | Bacteria | 1207 |
| 104 | Ga0307410_10030051 | 3300031852 | Bacteria | 3468 |
| 105 | Ga0307410_10112528 | 3300031852 | Bacteria | 1971 |
| 106 | Ga0307410_10155788 | 3300031852 | Bacteria | 1706 |
| 107 | Ga0307410_10326285 | 3300031852 | Bacteria | 1219 |
| 108 | Ga0307410_10479744 | 3300031852 | Bacteria | 1020 |
| 109 | Ga0307406_10057646 | 3300031901 | Bacteria | 2492 |
| 110 | Ga0307406_10360437 | 3300031901 | Bacteria | 1139 |
| 111 | Ga0307407_10010103 | 3300031903 | Bacteria | 4435 |
| 112 | Ga0307407_10022464 | 3300031903 | Bacteria | 3273 |
| 113 | Ga0307407_10220506 | 3300031903 | Bacteria | 1282 |
| 114 | Ga0307407_10238837 | 3300031903 | Bacteria | 1238 |
| 115 | Ga0307407_10283480 | 3300031903 | Bacteria | 1148 |
| 116 | Ga0307407_10469367 | 3300031903 | Bacteria | 917 |
| 117 | Ga0307412_10001277 | 3300031911 | Bacteria | 14105 |
| 118 | Ga0307412_10027732 | 3300031911 | Bacteria | 3535 |
| 119 | Ga0307412_10066040 | 3300031911 | Bacteria | 2450 |
| 120 | Ga0307412_10077518 | 3300031911 | Bacteria | 2286 |
| 121 | Ga0307412_10079628 | 3300031911 | Bacteria | 2261 |
| 122 | Ga0307412_10349693 | 3300031911 | Bacteria | 1186 |
| 123 | Ga0307409_100108232 | 3300031995 | Bacteria | 2324 |
| 124 | Ga0307409_100122191 | 3300031995 | Bacteria | 2208 |
| 125 | Ga0307409_100190898 | 3300031995 | Bacteria | 1823 |
| 126 | Ga0307409_100281079 | 3300031995 | Bacteria | 1538 |
| 127 | Ga0307409_100375989 | 3300031995 | Bacteria | 1349 |
| 128 | Ga0307409_100446285 | 3300031995 | Bacteria | 1247 |
| 129 | Ga0307416_100033549 | 3300032002 | Bacteria | 3893 |
| 130 | Ga0307416_100038687 | 3300032002 | Bacteria | 3682 |
| 131 | Ga0307416_100065330 | 3300032002 | Bacteria | 2989 |
| 132 | Ga0307416_100102413 | 3300032002 | Bacteria | 2496 |
| 133 | Ga0307416_100401984 | 3300032002 | Bacteria | 1407 |
| 134 | Ga0307414_10014625 | 3300032004 | Bacteria | 4712 |
| 135 | Ga0307414_10301782 | 3300032004 | Bacteria | 1355 |
| 136 | Ga0307411_10000395 | 3300032005 | Bacteria | 14912 |
| 137 | Ga0307411_10227953 | 3300032005 | Bacteria | 1450 |
| 138 | Ga0307415_100136921 | 3300032126 | Bacteria | 1864 |
| 139 | Ga0307415_100229354 | 3300032126 | Bacteria | 1494 |
| 140 | Ga0307415_100385549 | 3300032126 | Bacteria | 1191 |
| 141 | Ga0307415_100423766 | 3300032126 | Bacteria | 1143 |
| 142 | Ga0316580_10086350 | 3300032139 | Bacteria | 960 |
| 143 | Ga0316582_0484113 | 3300036647 | Bacteria | 853 |
| 144 | Ga0316584_0253922 | 3300036712 | Bacteria | 1284 |
| 145 | Ga0395900_0017126 | 3300037418 | Bacteria | 7398 |
| 146 | Ga0395900_0023443 | 3300037418 | Bacteria | 6317 |
| 147 | Ga0395900_0219287 | 3300037418 | Bacteria | 1918 |
| 148 | Ga0395898_0121041 | 3300037466 | Bacteria | 2507 |
| 149 | Ga0395905_0043185 | 3300037471 | Bacteria | 4229 |
| 150 | Ga0395905_0542418 | 3300037471 | Bacteria | 1064 |
| 151 | Ga0395901_0058341 | 3300038443 | Bacteria | 4015 |
| 152 | Ga0395901_0063705 | 3300038443 | Bacteria | 3837 |
| 153 | Ga0395901_0078638 | 3300038443 | Bacteria | 3443 |
| 154 | Ga0439436_0035542 | 3300041404 | Bacteria | 1439 |
| 155 | Ga0439433_0000550 | 3300041999 | Bacteria | 7091 |
| 156 | Ga0439442_000296 | 3300042002 | Bacteria | 12039 |
| 157 | Ga0439442_025695 | 3300042002 | Bacteria | 1225 |
| 158 | Ga0439449_0008149 | 3300042007 | Bacteria | 3982 |
| 159 | Ga0439457_002237 | 3300042014 | Bacteria | 5597 |
| 160 | Ga0439462_0017081 | 3300042015 | Bacteria | 1879 |
| 161 | Ga0439462_0022648 | 3300042015 | Bacteria | 1645 |
| 162 | Ga0450920_001879 | 3300042122 | Bacteria | 3521 |
| 163 | Ga0450907_000652 | 3300042146 | Bacteria | 9128 |
| 164 | Ga0450918_000829 | 3300042531 | Bacteria | 6513 |
| 165 | Ga0439440_0040555 | 3300042993 | Bacteria | 1133 |
| 166 | Ga0495641_0040449 | 3300046461 | Bacteria | 2168 |
| 167 | Ga0495639_0012817 | 3300046475 | Bacteria | 3617 |
| 168 | Ga0495594_0057218 | 3300046499 | Bacteria | 2153 |
| 169 | Ga0495616_0089792 | 3300046513 | Bacteria | 1457 |
| 170 | Ga0495631_0026303 | 3300046518 | Bacteria | 2674 |
| 171 | Ga0495642_0011644 | 3300046528 | Bacteria | 3385 |
| 172 | Ga0495654_0126423 | 3300046530 | Bacteria | 1151 |
| 173 | Ga0495633_0088167 | 3300046558 | Bacteria | 1443 |
| 174 | Ga0495656_0005453 | 3300046615 | Bacteria | 4392 |
| 175 | Ga0495656_0053095 | 3300046615 | Bacteria | 1740 |
| 176 | Ga0495656_0059362 | 3300046615 | Bacteria | 1664 |
| 177 | Ga0495588_0008453 | 3300046674 | Bacteria | 4726 |
| 178 | Ga0495588_0038154 | 3300046674 | Bacteria | 2443 |
| 179 | Ga0495670_0011689 | 3300046691 | Bacteria | 4321 |
| 180 | Ga0495670_0097215 | 3300046691 | Bacteria | 1513 |
| 181 | Ga0495600_0090383 | 3300046809 | Bacteria | 1997 |
| 182 | Ga0495581_0012034 | 3300047315 | Bacteria | 5006 |
| 183 | Ga0495581_0113771 | 3300047315 | Bacteria | 1573 |
| 184 | Ga0495636_0018158 | 3300047318 | Bacteria | 2821 |
| 185 | Ga0495677_0027259 | 3300047445 | Bacteria | 2073 |
| 186 | Ga0496101_0017920 | 3300048904 | Bacteria | 4807 |
| 187 | Ga0496102_0558531 | 3300048905 | Bacteria | 1067 |
| 188 | Ga0496103_0040212 | 3300048906 | Bacteria | 2873 |
| 189 | Ga0496103_0196055 | 3300048906 | Bacteria | 1299 |
| 190 | Ga0496103_0199257 | 3300048906 | Bacteria | 1287 |
| 191 | Ga0496105_0167781 | 3300048908 | Bacteria | 1800 |
| 192 | Ga0496106_0010116 | 3300048909 | Bacteria | 6966 |
| 193 | Ga0496106_0025582 | 3300048909 | Bacteria | 4393 |
| 194 | Ga0496106_0082407 | 3300048909 | Bacteria | 2472 |
| 195 | Ga0496107_0006642 | 3300048910 | Bacteria | 7964 |
| 196 | Ga0496107_0014990 | 3300048910 | Bacteria | 5428 |
| 197 | Ga0496108_0255034 | 3300048911 | Bacteria | 1526 |
| 198 | Ga0496108_0364462 | 3300048911 | Bacteria | 1261 |
| 199 | Ga0496108_0583459 | 3300048911 | Bacteria | 974 |
| 200 | Ga0496109_0179590 | 3300048912 | Bacteria | 1987 |
| 201 | Ga0496109_0352938 | 3300048912 | Bacteria | 1389 |
| 202 | Ga0496110_0165015 | 3300048913 | Bacteria | 2008 |
| 203 | Ga0496111_0073213 | 3300048914 | Bacteria | 2494 |
| 204 | Ga0496111_0081336 | 3300048914 | Bacteria | 2364 |
| 205 | Ga0496111_0146859 | 3300048914 | Bacteria | 1748 |
| 206 | Ga0496111_0168021 | 3300048914 | Bacteria | 1629 |
| 207 | Ga0496111_0306297 | 3300048914 | Bacteria | 1177 |
| 208 | Ga0496111_0354157 | 3300048914 | Bacteria | 1086 |
| 209 | Ga0496112_0046722 | 3300048915 | Bacteria | 4247 |
| 210 | Ga0496113_0155325 | 3300048916 | Bacteria | 1807 |
| 211 | Ga0496114_0259284 | 3300048917 | Bacteria | 1530 |
| 212 | Ga0496124_0074827 | 3300048927 | Bacteria | 2799 |
| 213 | Ga0501031_0001247 | 3300049568 | Bacteria | 15611 |
| 214 | Ga0501043_0576228 | 3300049579 | Bacteria | 834 |
| 215 | Ga0501046_0157356 | 3300049580 | Bacteria | 1711 |
| 216 | Ga0501068_0084547 | 3300049584 | Bacteria | 1952 |
| 217 | Ga0501070_0253362 | 3300049586 | Bacteria | 1440 |
| 218 | Ga0501072_0033675 | 3300049588 | Bacteria | 4015 |
| 219 | Ga0501074_0228512 | 3300049590 | Bacteria | 1325 |
| 220 | Ga0501075_0351557 | 3300049591 | Bacteria | 1123 |
| 221 | Ga0501075_0562191 | 3300049591 | Bacteria | 870 |
| 222 | Ga0501076_0137784 | 3300049592 | Bacteria | 1982 |
| 223 | Ga0501076_0361774 | 3300049592 | Bacteria | 1192 |
| 224 | Ga0501079_0207919 | 3300049741 | Bacteria | 1529 |
| 225 | Ga0501081_0517754 | 3300049743 | Bacteria | 890 |
| 226 | Ga0501279_003613 | 3300049775 | Bacteria | 2017 |
| 227 | Ga0501045_0174087 | 3300049824 | Bacteria | 1603 |
| 228 | nmdc:mga05p37_140960_c1 | 3300050507 | Bacteria | 2954 |
| 229 | nmdc:mga05p37_1842_c1 | 3300050507 | Bacteria | 24712 |
| 230 | nmdc:mga05p37_533304_c1 | 3300050507 | Bacteria | 1340 |
| 231 | nmdc:mga09592_41539_c1 | 3300050508 | Bacteria | 3867 |
| 232 | nmdc:mga0qj67_253147_c1 | 3300050509 | Bacteria | 1429 |
| 233 | nmdc:mga08y16_73398_c1 | 3300050511 | Bacteria | 3565 |
| 234 | Ga0590075_089272 | 3300059424 | Bacteria | 799 |
| 235 | Ga0501082_0169259 | 3300060353 | Bacteria | 1899 |
| 236 | Ga0501082_0410114 | 3300060353 | Bacteria | 1183 |
| 237 | 2501945001 | 2501939600 | Bacteria | 6907073 |
| 238 | 2515722962 | 2515154129 | Bacteria | 5584369 |
| 239 | 2644016784 | 2643221601 | Bacteria | 7493239 |
| 240 | 2644178199 | 2643221631 | Bacteria | 8168043 |
| 241 | 2808893673 | 2808606370 | Bacteria | 4942454 |
| 242 | 2832010655 | 2832004796 | Bacteria | 6538017 |
| 243 | 2855683556 | 2855683550 | Bacteria | 7134265 |
| 244 | 2856860158 | 2856858025 | Bacteria | 7255264 |
| 245 | 2858903271 | 2858902515 | Bacteria | 7086037 |
| 246 | 2862996757 | 2862993130 | Bacteria | 3860849 |
| 247 | 2866068765 | 2866065130 | Bacteria | 6518152 |
| 248 | 2867306674 | 2867302475 | Bacteria | 7087181 |
| 249 | 2939602030 | 2939598168 | Bacteria | 4687164 |
| 250 | 2996225254 | 2996221748 | Bacteria | 6799777 |
| 251 | 649810859 | 649633069 | Bacteria | 6962533 |
| 252 | 8003873576 | 8003870546 | Bacteria | 7396674 |
| 253 | 8016255799 | 8016254467 | Bacteria | 3797036 |
| 254 | 8054111304 | 8054107350 | Bacteria | 5022511 |
| 255 | Ga0307408_100102326 | |||
| 256 | JGI25407J50210_10004330 | |||
| 257 | JGI25407J50210_10029907 | |||
| 258 | JGI25407J50210_10034674 | |||
| 259 | Ga0070658_10004441 | |||
| 260 | Ga0070676_10090930 | |||
| 261 | Ga0070668_100279538 | |||
| 262 | Ga0070675_100167757 | |||
| 263 | Ga0070673_100109898 | |||
| 264 | Ga0070667_100236887 | |||
| 265 | Ga0070714_100014324 | |||
| 266 | Ga0070705_100022652 | |||
| 267 | Ga0070694_100061419 | |||
| 268 | Ga0070708_100562837 | |||
| 269 | Ga0070672_100565209 | |||
| 270 | Ga0070696_100480037 | |||
| 271 | Ga0070704_100093219 | |||
| 272 | Ga0070664_100848523 | |||
| 273 | Ga0068856_100032275 | |||
| 274 | Ga0068866_10057533 | |||
| 275 | Ga0068861_100207976 | |||
| 276 | Ga0068860_100923029 | |||
| 277 | Ga0081455_10002899 | |||
| 278 | Ga0081538_10001119 | |||
| 279 | Ga0081538_10002578 | |||
| 280 | Ga0081538_10007870 | |||
| 281 | Ga0081538_10012459 | |||
| 282 | Ga0081538_10026748 | |||
| 283 | Ga0081538_10052722 | |||
| 284 | Ga0081538_10067113 | |||
| 285 | Ga0081539_10005733 | |||
| 286 | Ga0075363_100125400 | |||
| 287 | Ga0075432_10000074 | |||
| 288 | Ga0075432_10001467 | |||
| 289 | Ga0075432_10003606 | |||
| 290 | Ga0075432_10037341 | |||
| 291 | Ga0075427_10001691 | |||
| 292 | Ga0075427_10018607 | |||
| 293 | Ga0075428_100011796 | |||
| 294 | Ga0075428_100297433 | |||
| 295 | Ga0075428_100944886 | |||
| 296 | Ga0075430_100001895 | |||
| 297 | Ga0075430_100445283 | |||
| 298 | Ga0075431_100007869 | |||
| 299 | Ga0075433_10017015 | |||
| 300 | Ga0075433_10029083 | |||
| 301 | Ga0075434_100208942 | |||
| 302 | Ga0075429_100202560 | |||
| 303 | Ga0068865_100087737 | |||
| 304 | Ga0075436_100111702 | |||
| 305 | Ga0105251_10079451 | |||
| 306 | Ga0111539_10003882 | |||
| 307 | Ga0105245_10288700 | |||
| 308 | Ga0114129_10001178 | |||
| 309 | Ga0114129_10022408 | |||
| 310 | Ga0114129_10036273 | |||
| 311 | Ga0114129_10089708 | |||
| 312 | Ga0114129_10099421 | |||
| 313 | Ga0114129_10618148 | |||
| 314 | Ga0105243_10034822 | |||
| 315 | Ga0105243_10054149 | |||
| 316 | Ga0105243_10242478 | |||
| 317 | Ga0105242_10001516 | |||
| 318 | Ga0105242_10552909 | |||
| 319 | Ga0105249_10128621 | |||
| 320 | Ga0105246_10358758 | |||
| 321 | Ga0157378_10030211 | |||
| 322 | Ga0163162_10117780 | |||
| 323 | Ga0157375_10192895 | |||
| 324 | Ga0157375_10228241 | |||
| 325 | Ga0157377_10401163 | |||
| 326 | Ga0207697_10001545 | |||
| 327 | Ga0207682_10006618 | |||
| 328 | Ga0207642_10120311 | |||
| 329 | Ga0207647_10291833 | |||
| 330 | Ga0207645_10001051 | |||
| 331 | Ga0207705_10007652 | |||
| 332 | Ga0207650_10150866 | |||
| 333 | Ga0207686_10298197 | |||
| 334 | Ga0207709_10006791 | |||
| 335 | Ga0207709_10047085 | |||
| 336 | Ga0207691_10002435 | |||
| 337 | Ga0207679_10805307 | |||
| 338 | Ga0207712_10087605 | |||
| 339 | Ga0207677_10482796 | |||
| 340 | Ga0207674_10353391 | |||
| 341 | Ga0207675_100073513 | |||
| 342 | Ga0207683_10011169 | |||
| 343 | Ga0207428_10002644 | |||
| 344 | Ga0207428_10028556 | |||
| 345 | Ga0207428_10044960 | |||
| 346 | Ga0268266_10325039 | |||
| 347 | Ga0265327_10181387 | |||
| 348 | Ga0307408_100030011 | |||
| 349 | Ga0307408_100033182 | |||
| 350 | Ga0307408_100146631 | |||
| 351 | Ga0307408_100147573 | |||
| 352 | Ga0307408_100908420 | |||
| 353 | Ga0307405_10021708 | |||
| 354 | Ga0307405_10036305 | |||
| 355 | Ga0307405_10051227 | |||
| 356 | Ga0307413_10008748 | |||
| 357 | Ga0307413_10306231 | |||
| 358 | Ga0307410_10030051 | |||
| 359 | Ga0307410_10112528 | |||
| 360 | Ga0307410_10155788 | |||
| 361 | Ga0307410_10326285 | |||
| 362 | Ga0307410_10479744 | |||
| 363 | Ga0307406_10057646 | |||
| 364 | Ga0307406_10360437 | |||
| 365 | Ga0307407_10010103 | |||
| 366 | Ga0307407_10022464 | |||
| 367 | Ga0307407_10220506 | |||
| 368 | Ga0307407_10238837 | |||
| 369 | Ga0307407_10283480 | |||
| 370 | Ga0307407_10469367 | |||
| 371 | Ga0307412_10001277 | |||
| 372 | Ga0307412_10027732 | |||
| 373 | Ga0307412_10066040 | |||
| 374 | Ga0307412_10077518 | |||
| 375 | Ga0307412_10079628 | |||
| 376 | Ga0307412_10349693 | |||
| 377 | Ga0307409_100108232 | |||
| 378 | Ga0307409_100122191 | |||
| 379 | Ga0307409_100190898 | |||
| 380 | Ga0307409_100281079 | |||
| 381 | Ga0307409_100375989 | |||
| 382 | Ga0307409_100446285 | |||
| 383 | Ga0307416_100033549 | |||
| 384 | Ga0307416_100038687 | |||
| 385 | Ga0307416_100065330 | |||
| 386 | Ga0307416_100102413 | |||
| 387 | Ga0307416_100401984 | |||
| 388 | Ga0307414_10014625 | |||
| 389 | Ga0307414_10301782 | |||
| 390 | Ga0307411_10000395 | |||
| 391 | Ga0307411_10227953 | |||
| 392 | Ga0307415_100136921 | |||
| 393 | Ga0307415_100229354 | |||
| 394 | Ga0307415_100385549 | |||
| 395 | Ga0307415_100423766 | |||
| 396 | Ga0316580_10086350 | |||
| 397 | Ga0316582_0484113 | |||
| 398 | Ga0316584_0253922 | |||
| 399 | Ga0395900_0017126 | |||
| 400 | Ga0395900_0023443 | |||
| 401 | Ga0395900_0219287 | |||
| 402 | Ga0395898_0121041 | |||
| 403 | Ga0395905_0043185 | |||
| 404 | Ga0395905_0542418 | |||
| 405 | Ga0395901_0058341 | |||
| 406 | Ga0395901_0063705 | |||
| 407 | Ga0395901_0078638 | |||
| 408 | Ga0439436_0035542 | |||
| 409 | Ga0439433_0000550 | |||
| 410 | Ga0439442_000296 | |||
| 411 | Ga0439442_025695 | |||
| 412 | Ga0439449_0008149 | |||
| 413 | Ga0439457_002237 | |||
| 414 | Ga0439462_0017081 | |||
| 415 | Ga0439462_0022648 | |||
| 416 | Ga0450920_001879 | |||
| 417 | Ga0450907_000652 | |||
| 418 | Ga0450918_000829 | |||
| 419 | Ga0439440_0040555 | |||
| 420 | Ga0495641_0040449 | |||
| 421 | Ga0495639_0012817 | |||
| 422 | Ga0495594_0057218 | |||
| 423 | Ga0495616_0089792 | |||
| 424 | Ga0495631_0026303 | |||
| 425 | Ga0495642_0011644 | |||
| 426 | Ga0495654_0126423 | |||
| 427 | Ga0495633_0088167 | |||
| 428 | Ga0495656_0005453 | |||
| 429 | Ga0495656_0053095 | |||
| 430 | Ga0495656_0059362 | |||
| 431 | Ga0495588_0008453 | |||
| 432 | Ga0495588_0038154 | |||
| 433 | Ga0495670_0011689 | |||
| 434 | Ga0495670_0097215 | |||
| 435 | Ga0495600_0090383 | |||
| 436 | Ga0495581_0012034 | |||
| 437 | Ga0495581_0113771 | |||
| 438 | Ga0495636_0018158 | |||
| 439 | Ga0495677_0027259 | |||
| 440 | Ga0496101_0017920 | |||
| 441 | Ga0496102_0558531 | |||
| 442 | Ga0496103_0040212 | |||
| 443 | Ga0496103_0196055 | |||
| 444 | Ga0496103_0199257 | |||
| 445 | Ga0496105_0167781 | |||
| 446 | Ga0496106_0010116 | |||
| 447 | Ga0496106_0025582 | |||
| 448 | Ga0496106_0082407 | |||
| 449 | Ga0496107_0006642 | |||
| 450 | Ga0496107_0014990 | |||
| 451 | Ga0496108_0255034 | |||
| 452 | Ga0496108_0364462 | |||
| 453 | Ga0496108_0583459 | |||
| 454 | Ga0496109_0179590 | |||
| 455 | Ga0496109_0352938 | |||
| 456 | Ga0496110_0165015 | |||
| 457 | Ga0496111_0073213 | |||
| 458 | Ga0496111_0081336 | |||
| 459 | Ga0496111_0146859 | |||
| 460 | Ga0496111_0168021 | |||
| 461 | Ga0496111_0306297 | |||
| 462 | Ga0496111_0354157 | |||
| 463 | Ga0496112_0046722 | |||
| 464 | Ga0496113_0155325 | |||
| 465 | Ga0496114_0259284 | |||
| 466 | Ga0496124_0074827 | |||
| 467 | Ga0501031_0001247 | |||
| 468 | Ga0501043_0576228 | |||
| 469 | Ga0501046_0157356 | |||
| 470 | Ga0501068_0084547 | |||
| 471 | Ga0501070_0253362 | |||
| 472 | Ga0501072_0033675 | |||
| 473 | Ga0501074_0228512 | |||
| 474 | Ga0501075_0351557 | |||
| 475 | Ga0501075_0562191 | |||
| 476 | Ga0501076_0137784 | |||
| 477 | Ga0501076_0361774 | |||
| 478 | Ga0501079_0207919 | |||
| 479 | Ga0501081_0517754 | |||
| 480 | Ga0501279_003613 | |||
| 481 | Ga0501045_0174087 | |||
| 482 | nmdc:mga05p37_140960_c1 | |||
| 483 | nmdc:mga05p37_1842_c1 | |||
| 484 | nmdc:mga05p37_533304_c1 | |||
| 485 | nmdc:mga09592_41539_c1 | |||
| 486 | nmdc:mga0qj67_253147_c1 | |||
| 487 | nmdc:mga08y16_73398_c1 | |||
| 488 | Ga0590075_089272 | |||
| 489 | Ga0501082_0169259 | |||
| 490 | Ga0501082_0410114 | |||
| 491 | 2501945001 | |||
| 492 | 2515722962 | |||
| 493 | 2644016784 | |||
| 494 | 2644178199 | |||
| 495 | 2808893673 | |||
| 496 | 2832010655 | |||
| 497 | 2855683556 | |||
| 498 | 2856860158 | |||
| 499 | 2858903271 | |||
| 500 | 2862996757 | |||
| 501 | 2866068765 | |||
| 502 | 2867306674 | |||
| 503 | 2939602030 | |||
| 504 | 2996225254 | |||
| 505 | 649810859 | |||
| 506 | 8003873576 | |||
| 507 | 8016255799 | |||
| 508 | 8054111304 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6sy4-assembly1.cif.gz_B | tetr in complex with the tetr-binding rna-aptamer k1 | 0.8033 | 14 | 222 |
| 6sy4-assembly1.cif.gz_B | tetr in complex with the tetr-binding rna-aptamer k1 | 0.7949 | 14 | 222 |
| 5yej-assembly2.cif.gz_B | crystal structure of bioq with its naturel double-stranded dna operator | 0.7882 | 14 | 218 |
| 6sy6-assembly1.cif.gz_A | tetr in complex with the tetr-binding rna-aptamer k2 | 0.7837 | 14 | 223 |
| 2xge-assembly2.cif.gz_B-2 | crystal structure of a designed heterodimeric variant t-a(a)b of the tetracycline repressor | 0.7794 | 13 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2y30B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9819 | 17 | 68 | 1.10.10.60 |
| 1zk8B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.965 | 15 | 58 | 1.10.10.60 |
| 2ns8A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9587 | 19 | 72 | 1.10.10.60 |
| 3fiwB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.9573 | 16 | 63 | 1.10.10.60 |
| 1qpiA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.952 | 15 | 72 | 1.10.10.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Y8JYZ1-F1-model_v4 | TetR family transcriptional regulator | 0.9474 | 10 | 125 |
GO:0000976
GO:0003700 GO:0045892 |
| AF-A0A536HCH6-F1-model_v4 | TetR family transcriptional regulator | 0.9381 | 1 | 162 |
GO:0000976
GO:0003700 GO:0045892 GO:0046677 GO:0046872 |
| AF-A0A4Y8JYZ1-F1-model_v4 | TetR family transcriptional regulator | 0.9245 | 10 | 125 |
GO:0000976
GO:0003700 GO:0045892 |
| AF-A0A536HCH6-F1-model_v4 | TetR family transcriptional regulator | 0.9156 | 1 | 162 |
GO:0000976
GO:0003700 GO:0045892 GO:0046677 GO:0046872 |
| AF-A0A2N1RYJ2-F1-model_v4 | TetR family transcriptional regulator | 0.9093 | 1 | 108 |
GO:0000976
GO:0003700 |