F364990

General Info

Members Datasets Scaffolds Average Seq Length
254 159 508 234

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100102326|Ga0307408_1001023262
Length 266
Sequence VYGVHLLLLKIGVRRTLVKGCKESGRINGMSSQGTAPRVRLNRDRVLQAAVTLADGIGIGPLSMRRLAQELDVVPMALYKHVANKDELLDGMVDVIITEIDPPATGLGWKDAVRGRILSARSVLQRHQWARQVLETRTNKTPGVLAYMDSFIGMFLDGGFSVDLTHHVMHAIGSRMWGFTQELFDEPANNDDAGVVDAGDAARQAMFQEMATRYPNVLTIAMASAHDPAGVVGQGCDDQFEFEFALDLLLDGIDRLHAQGWTSVRA

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
26 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
85 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
86 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
87 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
90 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
91 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
92 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
93 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
94 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
97 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
100 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
101 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 2501939600 Micromonospora sp. L5 Isolate Unclassified
143 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
144 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
145 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
146 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
147 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
148 2855683550 Micromonospora sp. RP3T Isolate Unclassified
149 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
150 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
151 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
152 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
153 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
154 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
155 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
156 649633069 Micromonospora sp. L5 Isolate Unclassified
157 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
158 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
159 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.91
Metatranscriptomes 0
Isolates 7.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 10.24
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 0.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100102326 3300031548 Bacteria 2184
2 JGI25407J50210_10004330 3300003373 Bacteria 3449
3 JGI25407J50210_10029907 3300003373 Bacteria 1411
4 JGI25407J50210_10034674 3300003373 Bacteria 1301
5 Ga0070658_10004441 3300005327 Bacteria 11423
6 Ga0070676_10090930 3300005328 Bacteria 1869
7 Ga0070668_100279538 3300005347 Bacteria 1394
8 Ga0070675_100167757 3300005354 Bacteria 1892
9 Ga0070673_100109898 3300005364 Bacteria 2285
10 Ga0070667_100236887 3300005367 Bacteria 1629
11 Ga0070714_100014324 3300005435 Bacteria 6368
12 Ga0070705_100022652 3300005440 Bacteria 3360
13 Ga0070694_100061419 3300005444 Bacteria 2564
14 Ga0070708_100562837 3300005445 Bacteria 1075
15 Ga0070672_100565209 3300005543 Bacteria 988
16 Ga0070696_100480037 3300005546 Bacteria 986
17 Ga0070704_100093219 3300005549 Bacteria 2250
18 Ga0070664_100848523 3300005564 Bacteria 855
19 Ga0068856_100032275 3300005614 Bacteria 5126
20 Ga0068866_10057533 3300005718 Bacteria 2004
21 Ga0068861_100207976 3300005719 Bacteria 1647
22 Ga0068860_100923029 3300005843 Bacteria 890
23 Ga0081455_10002899 3300005937 Bacteria 20137
24 Ga0081538_10001119 3300005981 Bacteria 28423
25 Ga0081538_10002578 3300005981 Bacteria 17592
26 Ga0081538_10007870 3300005981 Bacteria 9136
27 Ga0081538_10012459 3300005981 Bacteria 6815
28 Ga0081538_10026748 3300005981 Bacteria 4024
29 Ga0081538_10052722 3300005981 Bacteria 2427
30 Ga0081538_10067113 3300005981 Bacteria 2005
31 Ga0081539_10005733 3300005985 Bacteria 12419
32 Ga0075363_100125400 3300006048 Bacteria 1437
33 Ga0075432_10000074 3300006058 Bacteria 19936
34 Ga0075432_10001467 3300006058 Bacteria 7693
35 Ga0075432_10003606 3300006058 Bacteria 5260
36 Ga0075432_10037341 3300006058 Bacteria 1691
37 Ga0075427_10001691 3300006194 Bacteria 2869
38 Ga0075427_10018607 3300006194 Bacteria 1091
39 Ga0075428_100011796 3300006844 Bacteria 9727
40 Ga0075428_100297433 3300006844 Bacteria 1736
41 Ga0075428_100944886 3300006844 Bacteria 914
42 Ga0075430_100001895 3300006846 Bacteria 17144
43 Ga0075430_100445283 3300006846 Bacteria 1069
44 Ga0075431_100007869 3300006847 Bacteria 10622
45 Ga0075433_10017015 3300006852 Bacteria 6010
46 Ga0075433_10029083 3300006852 Bacteria 4705
47 Ga0075434_100208942 3300006871 Bacteria 1972
48 Ga0075429_100202560 3300006880 Bacteria 1739
49 Ga0068865_100087737 3300006881 Bacteria 2249
50 Ga0075436_100111702 3300006914 Bacteria 1908
51 Ga0105251_10079451 3300009011 Bacteria 1518
52 Ga0111539_10003882 3300009094 Bacteria 19674
53 Ga0105245_10288700 3300009098 Bacteria 1606
54 Ga0114129_10001178 3300009147 Bacteria 34683
55 Ga0114129_10022408 3300009147 Bacteria 8968
56 Ga0114129_10036273 3300009147 Bacteria 6963
57 Ga0114129_10089708 3300009147 Bacteria 4261
58 Ga0114129_10099421 3300009147 Bacteria 4026
59 Ga0114129_10618148 3300009147 Bacteria 1402
60 Ga0105243_10034822 3300009148 Bacteria 3901
61 Ga0105243_10054149 3300009148 Bacteria 3184
62 Ga0105243_10242478 3300009148 Bacteria 1605
63 Ga0105242_10001516 3300009176 Bacteria 18253
64 Ga0105242_10552909 3300009176 Bacteria 1104
65 Ga0105249_10128621 3300009553 Bacteria 2415
66 Ga0105246_10358758 3300011119 Bacteria 1197
67 Ga0157378_10030211 3300013297 Bacteria 4787
68 Ga0163162_10117780 3300013306 Bacteria 2758
69 Ga0157375_10192895 3300013308 Bacteria 2192
70 Ga0157375_10228241 3300013308 Unclassified 2021
71 Ga0157377_10401163 3300014745 Bacteria 934
72 Ga0207697_10001545 3300025315 Bacteria 12463
73 Ga0207682_10006618 3300025893 Bacteria 4660
74 Ga0207642_10120311 3300025899 Bacteria 1353
75 Ga0207647_10291833 3300025904 Bacteria 930
76 Ga0207645_10001051 3300025907 Bacteria 22851
77 Ga0207705_10007652 3300025909 Bacteria 7941
78 Ga0207650_10150866 3300025925 Bacteria 1834
79 Ga0207686_10298197 3300025934 Bacteria 1196
80 Ga0207709_10006791 3300025935 Bacteria 6402
81 Ga0207709_10047085 3300025935 Bacteria 2620
82 Ga0207691_10002435 3300025940 Bacteria 18208
83 Ga0207679_10805307 3300025945 Bacteria 857
84 Ga0207712_10087605 3300025961 Bacteria 2284
85 Ga0207677_10482796 3300026023 Bacteria 1068
86 Ga0207674_10353391 3300026116 Bacteria 1421
87 Ga0207675_100073513 3300026118 Bacteria 3199
88 Ga0207683_10011169 3300026121 Bacteria 7656
89 Ga0207428_10002644 3300027907 Bacteria 17855
90 Ga0207428_10028556 3300027907 Bacteria 4634
91 Ga0207428_10044960 3300027907 Bacteria 3560
92 Ga0268266_10325039 3300028379 Bacteria 1441
93 Ga0265327_10181387 3300031251 Bacteria 963
94 Ga0307408_100030011 3300031548 Bacteria 3772
95 Ga0307408_100033182 3300031548 Bacteria 3604
96 Ga0307408_100146631 3300031548 Bacteria 1858
97 Ga0307408_100147573 3300031548 Bacteria 1853
98 Ga0307408_100908420 3300031548 Bacteria 806
99 Ga0307405_10021708 3300031731 Bacteria 3614
100 Ga0307405_10036305 3300031731 Bacteria 2951
101 Ga0307405_10051227 3300031731 Bacteria 2561
102 Ga0307413_10008748 3300031824 Bacteria 4801
103 Ga0307413_10306231 3300031824 Bacteria 1207
104 Ga0307410_10030051 3300031852 Bacteria 3468
105 Ga0307410_10112528 3300031852 Bacteria 1971
106 Ga0307410_10155788 3300031852 Bacteria 1706
107 Ga0307410_10326285 3300031852 Bacteria 1219
108 Ga0307410_10479744 3300031852 Bacteria 1020
109 Ga0307406_10057646 3300031901 Bacteria 2492
110 Ga0307406_10360437 3300031901 Bacteria 1139
111 Ga0307407_10010103 3300031903 Bacteria 4435
112 Ga0307407_10022464 3300031903 Bacteria 3273
113 Ga0307407_10220506 3300031903 Bacteria 1282
114 Ga0307407_10238837 3300031903 Bacteria 1238
115 Ga0307407_10283480 3300031903 Bacteria 1148
116 Ga0307407_10469367 3300031903 Bacteria 917
117 Ga0307412_10001277 3300031911 Bacteria 14105
118 Ga0307412_10027732 3300031911 Bacteria 3535
119 Ga0307412_10066040 3300031911 Bacteria 2450
120 Ga0307412_10077518 3300031911 Bacteria 2286
121 Ga0307412_10079628 3300031911 Bacteria 2261
122 Ga0307412_10349693 3300031911 Bacteria 1186
123 Ga0307409_100108232 3300031995 Bacteria 2324
124 Ga0307409_100122191 3300031995 Bacteria 2208
125 Ga0307409_100190898 3300031995 Bacteria 1823
126 Ga0307409_100281079 3300031995 Bacteria 1538
127 Ga0307409_100375989 3300031995 Bacteria 1349
128 Ga0307409_100446285 3300031995 Bacteria 1247
129 Ga0307416_100033549 3300032002 Bacteria 3893
130 Ga0307416_100038687 3300032002 Bacteria 3682
131 Ga0307416_100065330 3300032002 Bacteria 2989
132 Ga0307416_100102413 3300032002 Bacteria 2496
133 Ga0307416_100401984 3300032002 Bacteria 1407
134 Ga0307414_10014625 3300032004 Bacteria 4712
135 Ga0307414_10301782 3300032004 Bacteria 1355
136 Ga0307411_10000395 3300032005 Bacteria 14912
137 Ga0307411_10227953 3300032005 Bacteria 1450
138 Ga0307415_100136921 3300032126 Bacteria 1864
139 Ga0307415_100229354 3300032126 Bacteria 1494
140 Ga0307415_100385549 3300032126 Bacteria 1191
141 Ga0307415_100423766 3300032126 Bacteria 1143
142 Ga0316580_10086350 3300032139 Bacteria 960
143 Ga0316582_0484113 3300036647 Bacteria 853
144 Ga0316584_0253922 3300036712 Bacteria 1284
145 Ga0395900_0017126 3300037418 Bacteria 7398
146 Ga0395900_0023443 3300037418 Bacteria 6317
147 Ga0395900_0219287 3300037418 Bacteria 1918
148 Ga0395898_0121041 3300037466 Bacteria 2507
149 Ga0395905_0043185 3300037471 Bacteria 4229
150 Ga0395905_0542418 3300037471 Bacteria 1064
151 Ga0395901_0058341 3300038443 Bacteria 4015
152 Ga0395901_0063705 3300038443 Bacteria 3837
153 Ga0395901_0078638 3300038443 Bacteria 3443
154 Ga0439436_0035542 3300041404 Bacteria 1439
155 Ga0439433_0000550 3300041999 Bacteria 7091
156 Ga0439442_000296 3300042002 Bacteria 12039
157 Ga0439442_025695 3300042002 Bacteria 1225
158 Ga0439449_0008149 3300042007 Bacteria 3982
159 Ga0439457_002237 3300042014 Bacteria 5597
160 Ga0439462_0017081 3300042015 Bacteria 1879
161 Ga0439462_0022648 3300042015 Bacteria 1645
162 Ga0450920_001879 3300042122 Bacteria 3521
163 Ga0450907_000652 3300042146 Bacteria 9128
164 Ga0450918_000829 3300042531 Bacteria 6513
165 Ga0439440_0040555 3300042993 Bacteria 1133
166 Ga0495641_0040449 3300046461 Bacteria 2168
167 Ga0495639_0012817 3300046475 Bacteria 3617
168 Ga0495594_0057218 3300046499 Bacteria 2153
169 Ga0495616_0089792 3300046513 Bacteria 1457
170 Ga0495631_0026303 3300046518 Bacteria 2674
171 Ga0495642_0011644 3300046528 Bacteria 3385
172 Ga0495654_0126423 3300046530 Bacteria 1151
173 Ga0495633_0088167 3300046558 Bacteria 1443
174 Ga0495656_0005453 3300046615 Bacteria 4392
175 Ga0495656_0053095 3300046615 Bacteria 1740
176 Ga0495656_0059362 3300046615 Bacteria 1664
177 Ga0495588_0008453 3300046674 Bacteria 4726
178 Ga0495588_0038154 3300046674 Bacteria 2443
179 Ga0495670_0011689 3300046691 Bacteria 4321
180 Ga0495670_0097215 3300046691 Bacteria 1513
181 Ga0495600_0090383 3300046809 Bacteria 1997
182 Ga0495581_0012034 3300047315 Bacteria 5006
183 Ga0495581_0113771 3300047315 Bacteria 1573
184 Ga0495636_0018158 3300047318 Bacteria 2821
185 Ga0495677_0027259 3300047445 Bacteria 2073
186 Ga0496101_0017920 3300048904 Bacteria 4807
187 Ga0496102_0558531 3300048905 Bacteria 1067
188 Ga0496103_0040212 3300048906 Bacteria 2873
189 Ga0496103_0196055 3300048906 Bacteria 1299
190 Ga0496103_0199257 3300048906 Bacteria 1287
191 Ga0496105_0167781 3300048908 Bacteria 1800
192 Ga0496106_0010116 3300048909 Bacteria 6966
193 Ga0496106_0025582 3300048909 Bacteria 4393
194 Ga0496106_0082407 3300048909 Bacteria 2472
195 Ga0496107_0006642 3300048910 Bacteria 7964
196 Ga0496107_0014990 3300048910 Bacteria 5428
197 Ga0496108_0255034 3300048911 Bacteria 1526
198 Ga0496108_0364462 3300048911 Bacteria 1261
199 Ga0496108_0583459 3300048911 Bacteria 974
200 Ga0496109_0179590 3300048912 Bacteria 1987
201 Ga0496109_0352938 3300048912 Bacteria 1389
202 Ga0496110_0165015 3300048913 Bacteria 2008
203 Ga0496111_0073213 3300048914 Bacteria 2494
204 Ga0496111_0081336 3300048914 Bacteria 2364
205 Ga0496111_0146859 3300048914 Bacteria 1748
206 Ga0496111_0168021 3300048914 Bacteria 1629
207 Ga0496111_0306297 3300048914 Bacteria 1177
208 Ga0496111_0354157 3300048914 Bacteria 1086
209 Ga0496112_0046722 3300048915 Bacteria 4247
210 Ga0496113_0155325 3300048916 Bacteria 1807
211 Ga0496114_0259284 3300048917 Bacteria 1530
212 Ga0496124_0074827 3300048927 Bacteria 2799
213 Ga0501031_0001247 3300049568 Bacteria 15611
214 Ga0501043_0576228 3300049579 Bacteria 834
215 Ga0501046_0157356 3300049580 Bacteria 1711
216 Ga0501068_0084547 3300049584 Bacteria 1952
217 Ga0501070_0253362 3300049586 Bacteria 1440
218 Ga0501072_0033675 3300049588 Bacteria 4015
219 Ga0501074_0228512 3300049590 Bacteria 1325
220 Ga0501075_0351557 3300049591 Bacteria 1123
221 Ga0501075_0562191 3300049591 Bacteria 870
222 Ga0501076_0137784 3300049592 Bacteria 1982
223 Ga0501076_0361774 3300049592 Bacteria 1192
224 Ga0501079_0207919 3300049741 Bacteria 1529
225 Ga0501081_0517754 3300049743 Bacteria 890
226 Ga0501279_003613 3300049775 Bacteria 2017
227 Ga0501045_0174087 3300049824 Bacteria 1603
228 nmdc:mga05p37_140960_c1 3300050507 Bacteria 2954
229 nmdc:mga05p37_1842_c1 3300050507 Bacteria 24712
230 nmdc:mga05p37_533304_c1 3300050507 Bacteria 1340
231 nmdc:mga09592_41539_c1 3300050508 Bacteria 3867
232 nmdc:mga0qj67_253147_c1 3300050509 Bacteria 1429
233 nmdc:mga08y16_73398_c1 3300050511 Bacteria 3565
234 Ga0590075_089272 3300059424 Bacteria 799
235 Ga0501082_0169259 3300060353 Bacteria 1899
236 Ga0501082_0410114 3300060353 Bacteria 1183
237 2501945001 2501939600 Bacteria 6907073
238 2515722962 2515154129 Bacteria 5584369
239 2644016784 2643221601 Bacteria 7493239
240 2644178199 2643221631 Bacteria 8168043
241 2808893673 2808606370 Bacteria 4942454
242 2832010655 2832004796 Bacteria 6538017
243 2855683556 2855683550 Bacteria 7134265
244 2856860158 2856858025 Bacteria 7255264
245 2858903271 2858902515 Bacteria 7086037
246 2862996757 2862993130 Bacteria 3860849
247 2866068765 2866065130 Bacteria 6518152
248 2867306674 2867302475 Bacteria 7087181
249 2939602030 2939598168 Bacteria 4687164
250 2996225254 2996221748 Bacteria 6799777
251 649810859 649633069 Bacteria 6962533
252 8003873576 8003870546 Bacteria 7396674
253 8016255799 8016254467 Bacteria 3797036
254 8054111304 8054107350 Bacteria 5022511
255 Ga0307408_100102326
256 JGI25407J50210_10004330
257 JGI25407J50210_10029907
258 JGI25407J50210_10034674
259 Ga0070658_10004441
260 Ga0070676_10090930
261 Ga0070668_100279538
262 Ga0070675_100167757
263 Ga0070673_100109898
264 Ga0070667_100236887
265 Ga0070714_100014324
266 Ga0070705_100022652
267 Ga0070694_100061419
268 Ga0070708_100562837
269 Ga0070672_100565209
270 Ga0070696_100480037
271 Ga0070704_100093219
272 Ga0070664_100848523
273 Ga0068856_100032275
274 Ga0068866_10057533
275 Ga0068861_100207976
276 Ga0068860_100923029
277 Ga0081455_10002899
278 Ga0081538_10001119
279 Ga0081538_10002578
280 Ga0081538_10007870
281 Ga0081538_10012459
282 Ga0081538_10026748
283 Ga0081538_10052722
284 Ga0081538_10067113
285 Ga0081539_10005733
286 Ga0075363_100125400
287 Ga0075432_10000074
288 Ga0075432_10001467
289 Ga0075432_10003606
290 Ga0075432_10037341
291 Ga0075427_10001691
292 Ga0075427_10018607
293 Ga0075428_100011796
294 Ga0075428_100297433
295 Ga0075428_100944886
296 Ga0075430_100001895
297 Ga0075430_100445283
298 Ga0075431_100007869
299 Ga0075433_10017015
300 Ga0075433_10029083
301 Ga0075434_100208942
302 Ga0075429_100202560
303 Ga0068865_100087737
304 Ga0075436_100111702
305 Ga0105251_10079451
306 Ga0111539_10003882
307 Ga0105245_10288700
308 Ga0114129_10001178
309 Ga0114129_10022408
310 Ga0114129_10036273
311 Ga0114129_10089708
312 Ga0114129_10099421
313 Ga0114129_10618148
314 Ga0105243_10034822
315 Ga0105243_10054149
316 Ga0105243_10242478
317 Ga0105242_10001516
318 Ga0105242_10552909
319 Ga0105249_10128621
320 Ga0105246_10358758
321 Ga0157378_10030211
322 Ga0163162_10117780
323 Ga0157375_10192895
324 Ga0157375_10228241
325 Ga0157377_10401163
326 Ga0207697_10001545
327 Ga0207682_10006618
328 Ga0207642_10120311
329 Ga0207647_10291833
330 Ga0207645_10001051
331 Ga0207705_10007652
332 Ga0207650_10150866
333 Ga0207686_10298197
334 Ga0207709_10006791
335 Ga0207709_10047085
336 Ga0207691_10002435
337 Ga0207679_10805307
338 Ga0207712_10087605
339 Ga0207677_10482796
340 Ga0207674_10353391
341 Ga0207675_100073513
342 Ga0207683_10011169
343 Ga0207428_10002644
344 Ga0207428_10028556
345 Ga0207428_10044960
346 Ga0268266_10325039
347 Ga0265327_10181387
348 Ga0307408_100030011
349 Ga0307408_100033182
350 Ga0307408_100146631
351 Ga0307408_100147573
352 Ga0307408_100908420
353 Ga0307405_10021708
354 Ga0307405_10036305
355 Ga0307405_10051227
356 Ga0307413_10008748
357 Ga0307413_10306231
358 Ga0307410_10030051
359 Ga0307410_10112528
360 Ga0307410_10155788
361 Ga0307410_10326285
362 Ga0307410_10479744
363 Ga0307406_10057646
364 Ga0307406_10360437
365 Ga0307407_10010103
366 Ga0307407_10022464
367 Ga0307407_10220506
368 Ga0307407_10238837
369 Ga0307407_10283480
370 Ga0307407_10469367
371 Ga0307412_10001277
372 Ga0307412_10027732
373 Ga0307412_10066040
374 Ga0307412_10077518
375 Ga0307412_10079628
376 Ga0307412_10349693
377 Ga0307409_100108232
378 Ga0307409_100122191
379 Ga0307409_100190898
380 Ga0307409_100281079
381 Ga0307409_100375989
382 Ga0307409_100446285
383 Ga0307416_100033549
384 Ga0307416_100038687
385 Ga0307416_100065330
386 Ga0307416_100102413
387 Ga0307416_100401984
388 Ga0307414_10014625
389 Ga0307414_10301782
390 Ga0307411_10000395
391 Ga0307411_10227953
392 Ga0307415_100136921
393 Ga0307415_100229354
394 Ga0307415_100385549
395 Ga0307415_100423766
396 Ga0316580_10086350
397 Ga0316582_0484113
398 Ga0316584_0253922
399 Ga0395900_0017126
400 Ga0395900_0023443
401 Ga0395900_0219287
402 Ga0395898_0121041
403 Ga0395905_0043185
404 Ga0395905_0542418
405 Ga0395901_0058341
406 Ga0395901_0063705
407 Ga0395901_0078638
408 Ga0439436_0035542
409 Ga0439433_0000550
410 Ga0439442_000296
411 Ga0439442_025695
412 Ga0439449_0008149
413 Ga0439457_002237
414 Ga0439462_0017081
415 Ga0439462_0022648
416 Ga0450920_001879
417 Ga0450907_000652
418 Ga0450918_000829
419 Ga0439440_0040555
420 Ga0495641_0040449
421 Ga0495639_0012817
422 Ga0495594_0057218
423 Ga0495616_0089792
424 Ga0495631_0026303
425 Ga0495642_0011644
426 Ga0495654_0126423
427 Ga0495633_0088167
428 Ga0495656_0005453
429 Ga0495656_0053095
430 Ga0495656_0059362
431 Ga0495588_0008453
432 Ga0495588_0038154
433 Ga0495670_0011689
434 Ga0495670_0097215
435 Ga0495600_0090383
436 Ga0495581_0012034
437 Ga0495581_0113771
438 Ga0495636_0018158
439 Ga0495677_0027259
440 Ga0496101_0017920
441 Ga0496102_0558531
442 Ga0496103_0040212
443 Ga0496103_0196055
444 Ga0496103_0199257
445 Ga0496105_0167781
446 Ga0496106_0010116
447 Ga0496106_0025582
448 Ga0496106_0082407
449 Ga0496107_0006642
450 Ga0496107_0014990
451 Ga0496108_0255034
452 Ga0496108_0364462
453 Ga0496108_0583459
454 Ga0496109_0179590
455 Ga0496109_0352938
456 Ga0496110_0165015
457 Ga0496111_0073213
458 Ga0496111_0081336
459 Ga0496111_0146859
460 Ga0496111_0168021
461 Ga0496111_0306297
462 Ga0496111_0354157
463 Ga0496112_0046722
464 Ga0496113_0155325
465 Ga0496114_0259284
466 Ga0496124_0074827
467 Ga0501031_0001247
468 Ga0501043_0576228
469 Ga0501046_0157356
470 Ga0501068_0084547
471 Ga0501070_0253362
472 Ga0501072_0033675
473 Ga0501074_0228512
474 Ga0501075_0351557
475 Ga0501075_0562191
476 Ga0501076_0137784
477 Ga0501076_0361774
478 Ga0501079_0207919
479 Ga0501081_0517754
480 Ga0501279_003613
481 Ga0501045_0174087
482 nmdc:mga05p37_140960_c1
483 nmdc:mga05p37_1842_c1
484 nmdc:mga05p37_533304_c1
485 nmdc:mga09592_41539_c1
486 nmdc:mga0qj67_253147_c1
487 nmdc:mga08y16_73398_c1
488 Ga0590075_089272
489 Ga0501082_0169259
490 Ga0501082_0410114
491 2501945001
492 2515722962
493 2644016784
494 2644178199
495 2808893673
496 2832010655
497 2855683556
498 2856860158
499 2858903271
500 2862996757
501 2866068765
502 2867306674
503 2939602030
504 2996225254
505 649810859
506 8003873576
507 8016255799
508 8054111304

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

46

92

0.96

PF02909

TetR_C_1

Tetracyclin repressor-like, C-terminal domain

102

256

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sy4-assembly1.cif.gz_B tetr in complex with the tetr-binding rna-aptamer k1 0.8033 14 222
6sy4-assembly1.cif.gz_B tetr in complex with the tetr-binding rna-aptamer k1 0.7949 14 222
5yej-assembly2.cif.gz_B crystal structure of bioq with its naturel double-stranded dna operator 0.7882 14 218
6sy6-assembly1.cif.gz_A tetr in complex with the tetr-binding rna-aptamer k2 0.7837 14 223
2xge-assembly2.cif.gz_B-2 crystal structure of a designed heterodimeric variant t-a(a)b of the tetracycline repressor 0.7794 13 223
ID Description Score Start End Superfamily
2y30B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9819 17 68 1.10.10.60
1zk8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.965 15 58 1.10.10.60
2ns8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9587 19 72 1.10.10.60
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9573 16 63 1.10.10.60
1qpiA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.952 15 72 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A4Y8JYZ1-F1-model_v4 TetR family transcriptional regulator 0.9474 10 125 GO:0000976
GO:0003700
GO:0045892
AF-A0A536HCH6-F1-model_v4 TetR family transcriptional regulator 0.9381 1 162 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A4Y8JYZ1-F1-model_v4 TetR family transcriptional regulator 0.9245 10 125 GO:0000976
GO:0003700
GO:0045892
AF-A0A536HCH6-F1-model_v4 TetR family transcriptional regulator 0.9156 1 162 GO:0000976
GO:0003700
GO:0045892
GO:0046677
GO:0046872
AF-A0A2N1RYJ2-F1-model_v4 TetR family transcriptional regulator 0.9093 1 108 GO:0000976
GO:0003700

Map