F364986

General Info

Members Datasets Scaffolds Average Seq Length
254 158 508 208

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10006374|Ga0265327_100063747
Length 251
Sequence MRRVRENAPHPPRHKSLPQLTANKARGSLSKFPFNPNPILIMAYELPKLPYAFDALAPHIDAKTMEIHHGKHHQAYITNANNLLKDHPALAALDVNALIADLSKVPEAIRGGVRNNAGGHSNHSFFWTVMGPGKGGAPKGALAAAIDAQLGGFAKFKEDFAKAGATRFGSGWAWLYVGADKKLAIGSTANQDSPLMGKAVAGIEGKPVLGLDVWEHAYYLNYQNRRPDYITAFWNVVNWDAAEANFAAATK

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
38 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
57 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
76 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
77 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
89 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
92 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
145 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
150 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
151 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
157 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
158 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 5.12
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0
Rhizoplane 3.94
Rhizosphere 91.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10006374 3300031251 Bacteria 9453
2 JGI24751J29686_10003175 3300002459 Bacteria 3312
3 rootL2_10245891 3300003322 Bacteria 1329
4 Ga0058863_11618102 3300004799 Bacteria 982
5 Ga0058862_12623714 3300004803 Bacteria 1099
6 Ga0065715_10016542 3300005293 Bacteria 1901
7 Ga0070683_100014090 3300005329 Bacteria 6983
8 Ga0070690_100881900 3300005330 Bacteria 699
9 Ga0070670_100138613 3300005331 Bacteria 2103
10 Ga0070660_100100277 3300005339 Bacteria 2293
11 Ga0070671_100728496 3300005355 Bacteria 861
12 Ga0070659_100315973 3300005366 Bacteria 1305
13 Ga0070713_100090064 3300005436 Bacteria 2637
14 Ga0070711_100970833 3300005439 Bacteria 728
15 Ga0070681_10260536 3300005458 Bacteria 1646
16 Ga0070679_100088409 3300005530 Bacteria 3085
17 Ga0070684_100078223 3300005535 Bacteria 2922
18 Ga0068853_100258755 3300005539 Bacteria 1599
19 Ga0070693_100150655 3300005547 Bacteria 1473
20 Ga0070665_100000481 3300005548 Bacteria 57473
21 Ga0070664_100068792 3300005564 Bacteria 3028
22 Ga0070664_101032322 3300005564 Bacteria 773
23 Ga0068857_100427328 3300005577 Bacteria 1236
24 Ga0068856_100000386 3300005614 Bacteria 48442
25 Ga0068856_100163358 3300005614 Bacteria 2238
26 Ga0068859_100239417 3300005617 Bacteria 1904
27 Ga0068859_100373351 3300005617 Bacteria 1522
28 Ga0068860_100426285 3300005843 Bacteria 1316
29 Ga0070717_10000170 3300006028 Bacteria 48829
30 Ga0075365_10028095 3300006038 Bacteria 3586
31 Ga0075428_100006819 3300006844 Bacteria 12703
32 Ga0075429_100234686 3300006880 Bacteria 1607
33 Ga0097620_100239418 3300006931 Bacteria 1904
34 Ga0097620_100373308 3300006931 Bacteria 1522
35 Ga0075435_100224109 3300007076 Bacteria 1597
36 Ga0105248_10532383 3300009177 Bacteria 1325
37 Ga0157370_10000415 3300013104 Bacteria 53917
38 Ga0163163_10231030 3300014325 Bacteria 1899
39 Ga0157377_10483693 3300014745 Bacteria 862
40 Ga0157376_10951463 3300014969 Bacteria 879
41 Ga0206355_1010418 3300020076 Bacteria 685
42 Ga0206350_10107061 3300020080 Bacteria 678
43 Ga0206353_11681484 3300020082 Bacteria 655
44 Ga0224712_10371681 3300022467 Bacteria 678
45 Ga0209676_1006284 3300025292 Bacteria 5904
46 Ga0207697_10068442 3300025315 Bacteria 1485
47 Ga0207663_10364181 3300025916 Bacteria 1097
48 Ga0207649_10001754 3300025920 Bacteria 12439
49 Ga0207649_10055866 3300025920 Bacteria 2463
50 Ga0207652_10151077 3300025921 Bacteria 2079
51 Ga0207650_10482169 3300025925 Bacteria 1035
52 Ga0207700_10097951 3300025928 Bacteria 2332
53 Ga0207690_10295069 3300025932 Bacteria 1267
54 Ga0207661_10033058 3300025944 Bacteria 4012
55 Ga0207661_10085260 3300025944 Bacteria 2618
56 Ga0207661_10805193 3300025944 Bacteria 865
57 Ga0207679_10048135 3300025945 Bacteria 3102
58 Ga0207667_10664402 3300025949 Bacteria 1047
59 Ga0207639_10228120 3300026041 Bacteria 1613
60 Ga0207702_10001862 3300026078 Bacteria 20732
61 Ga0207702_10800194 3300026078 Bacteria 932
62 Ga0207674_10076962 3300026116 Bacteria 3343
63 Ga0207674_10262987 3300026116 Bacteria 1673
64 Ga0268266_10000579 3300028379 Bacteria 50615
65 Ga0265337_1000422 3300028556 Bacteria 22465
66 Ga0265337_1007617 3300028556 Bacteria 4033
67 Ga0265337_1022773 3300028556 Bacteria 1936
68 Ga0265337_1066582 3300028556 Bacteria 993
69 Ga0265326_10008326 3300028558 Bacteria 3131
70 Ga0265319_1000413 3300028563 Bacteria 30854
71 Ga0265319_1001930 3300028563 Bacteria 11756
72 Ga0265319_1002873 3300028563 Bacteria 9201
73 Ga0265319_1006817 3300028563 Bacteria 5225
74 Ga0265319_1008883 3300028563 Bacteria 4351
75 Ga0265319_1065391 3300028563 Bacteria 1172
76 Ga0265334_10001655 3300028573 Bacteria 10667
77 Ga0265334_10029702 3300028573 Bacteria 2191
78 Ga0265318_10000005 3300028577 Bacteria 303630
79 Ga0265318_10001127 3300028577 Bacteria 16687
80 Ga0265318_10001223 3300028577 Bacteria 15615
81 Ga0265318_10005378 3300028577 Bacteria 6015
82 Ga0265318_10070103 3300028577 Bacteria 1300
83 Ga0265318_10109871 3300028577 Bacteria 1013
84 Ga0265323_10003771 3300028653 Bacteria 6614
85 Ga0265323_10022816 3300028653 Bacteria 2390
86 Ga0265323_10059032 3300028653 Bacteria 1338
87 Ga0265322_10030887 3300028654 Bacteria 1529
88 Ga0265336_10002751 3300028666 Bacteria 7113
89 Ga0265338_10000751 3300028800 Bacteria 55255
90 Ga0265338_10002409 3300028800 Bacteria 28149
91 Ga0265338_10008716 3300028800 Bacteria 12260
92 Ga0265338_10015915 3300028800 Bacteria 8228
93 Ga0265324_10001475 3300029957 Bacteria 13374
94 Ga0265324_10029152 3300029957 Bacteria 1942
95 Ga0265324_10059193 3300029957 Bacteria 1310
96 Ga0265332_10035808 3300031238 Bacteria 2155
97 Ga0265332_10094933 3300031238 Bacteria 1260
98 Ga0265332_10123073 3300031238 Bacteria 1089
99 Ga0265332_10130572 3300031238 Bacteria 1054
100 Ga0265328_10019982 3300031239 Bacteria 2567
101 Ga0265320_10004354 3300031240 Bacteria 9289
102 Ga0265320_10005300 3300031240 Bacteria 8304
103 Ga0265320_10007824 3300031240 Bacteria 6599
104 Ga0265320_10009056 3300031240 Bacteria 6035
105 Ga0265320_10014611 3300031240 Bacteria 4462
106 Ga0265320_10015796 3300031240 Bacteria 4254
107 Ga0265320_10016041 3300031240 Bacteria 4210
108 Ga0265320_10016214 3300031240 Bacteria 4183
109 Ga0265320_10063667 3300031240 Bacteria 1754
110 Ga0265320_10076722 3300031240 Bacteria 1565
111 Ga0265320_10080195 3300031240 Bacteria 1525
112 Ga0265320_10080237 3300031240 Bacteria 1524
113 Ga0265320_10129168 3300031240 Bacteria 1148
114 Ga0265325_10000530 3300031241 Bacteria 27606
115 Ga0265325_10054224 3300031241 Bacteria 2053
116 Ga0265325_10146758 3300031241 Bacteria 1118
117 Ga0265339_10000577 3300031249 Bacteria 28600
118 Ga0265331_10000069 3300031250 Bacteria 157422
119 Ga0265331_10014661 3300031250 Bacteria 4165
120 Ga0265327_10001241 3300031251 Bacteria 34123
121 Ga0265327_10003543 3300031251 Bacteria 14798
122 Ga0265327_10038378 3300031251 Bacteria 2613
123 Ga0265327_10048584 3300031251 Bacteria 2231
124 Ga0265327_10141481 3300031251 Bacteria 1124
125 Ga0265316_10019745 3300031344 Bacteria 5754
126 Ga0265316_10045877 3300031344 Bacteria 3467
127 Ga0307408_100000007 3300031548 Bacteria 463086
128 Ga0307408_100682358 3300031548 Bacteria 921
129 Ga0265313_10001302 3300031595 Bacteria 23534
130 Ga0265313_10002061 3300031595 Bacteria 17995
131 Ga0265313_10002470 3300031595 Bacteria 15931
132 Ga0265313_10003847 3300031595 Bacteria 11850
133 Ga0265313_10004616 3300031595 Bacteria 10448
134 Ga0265313_10013574 3300031595 Bacteria 4878
135 Ga0307508_10000024 3300031616 Bacteria 176806
136 Ga0265314_10000655 3300031711 Bacteria 42384
137 Ga0265314_10001464 3300031711 Bacteria 26327
138 Ga0265314_10010483 3300031711 Bacteria 7726
139 Ga0265314_10058363 3300031711 Bacteria 2644
140 Ga0265314_10131255 3300031711 Bacteria 1563
141 Ga0265314_10146526 3300031711 Bacteria 1453
142 Ga0265314_10237226 3300031711 Bacteria 1054
143 Ga0265314_10403001 3300031711 Bacteria 739
144 Ga0265342_10007520 3300031712 Bacteria 7966
145 Ga0265342_10018965 3300031712 Bacteria 4443
146 Ga0265342_10145440 3300031712 Bacteria 1320
147 Ga0307405_10519760 3300031731 Bacteria 958
148 Ga0307413_10077781 3300031824 Bacteria 2114
149 Ga0307410_10001097 3300031852 Bacteria 11809
150 Ga0307407_10042049 3300031903 Bacteria 2559
151 Ga0307412_10096556 3300031911 Bacteria 2080
152 Ga0307409_100000047 3300031995 Bacteria 42868
153 Ga0307416_100000491 3300032002 Bacteria 20148
154 Ga0307411_10047616 3300032005 Bacteria 2773
155 Ga0316586_1012791 3300033527 Bacteria 1306
156 Ga0316596_1143559 3300033541 Bacteria 654
157 Ga0373951_0030004 3300035091 Bacteria 1278
158 Ga0373941_0123932 3300035115 Bacteria 924
159 Ga0373956_0317744 3300035119 Bacteria 742
160 Ga0373955_0372942 3300035172 Bacteria 866
161 Ga0316574_0017827 3300035398 Bacteria 4163
162 Ga0316574_0563964 3300035398 Bacteria 706
163 Ga0373935_0486807 3300035692 Bacteria 894
164 Ga0373927_0141182 3300035695 Bacteria 1576
165 Ga0373933_0021110 3300035724 Bacteria 3696
166 Ga0373937_0431258 3300036401 Bacteria 1251
167 Ga0373937_0862719 3300036401 Bacteria 854
168 Ga0316584_0522767 3300036712 Bacteria 831
169 Ga0439446_0028603 3300042156 Bacteria 1605
170 Ga0439446_0087967 3300042156 Bacteria 969
171 Ga0451577_0000012 3300042876 Bacteria 575467
172 Ga0451577_0000606 3300042876 Bacteria 57749
173 Ga0451577_0026724 3300042876 Bacteria 5227
174 Ga0451577_0106833 3300042876 Bacteria 2502
175 Ga0451577_0156147 3300042876 Bacteria 2054
176 Ga0451577_0518315 3300042876 Bacteria 1082
177 Ga0453683_0001213 3300044673 Bacteria 23153
178 Ga0453683_0019758 3300044673 Bacteria 4311
179 Ga0453683_0264141 3300044673 Bacteria 1098
180 Ga0453684_0000001 3300044712 Bacteria 2623166
181 Ga0453684_0006911 3300044712 Bacteria 21276
182 Ga0453684_0035196 3300044712 Bacteria 6927
183 Ga0453684_0263869 3300044712 Bacteria 1971
184 Ga0451576_0001422 3300045051 Bacteria 40985
185 Ga0451576_0001452 3300045051 Bacteria 40291
186 Ga0451576_0001806 3300045051 Bacteria 34920
187 Ga0451576_0073317 3300045051 Bacteria 3562
188 Ga0451576_0135757 3300045051 Bacteria 2565
189 Ga0466967_0027687 3300045976 Bacteria 4718
190 Ga0495651_0211841 3300046462 Bacteria 1348
191 Ga0495651_0434699 3300046462 Bacteria 851
192 Ga0495582_0272787 3300046473 Bacteria 971
193 Ga0495628_0271236 3300046516 Bacteria 1262
194 Ga0495630_0846075 3300046517 Bacteria 698
195 Ga0495599_0395236 3300046678 Bacteria 824
196 Ga0495658_0263201 3300046683 Bacteria 1086
197 Ga0495636_0075817 3300047318 Bacteria 1442
198 Ga0496102_0551086 3300048905 Bacteria 1076
199 Ga0496104_0060925 3300048907 Bacteria 3576
200 Ga0496105_0221986 3300048908 Bacteria 1538
201 Ga0496106_0528551 3300048909 Bacteria 947
202 Ga0496109_1404634 3300048912 Bacteria 633
203 Ga0496110_0006759 3300048913 Bacteria 9124
204 Ga0496110_0935001 3300048913 Bacteria 773
205 Ga0496111_0369230 3300048914 Bacteria 1062
206 Ga0496112_0027478 3300048915 Bacteria 5486
207 Ga0496115_0151184 3300048918 Bacteria 1917
208 Ga0496121_0045390 3300048924 Bacteria 3777
209 Ga0501308_035513 3300049128 Bacteria 685
210 Ga0501305_051068 3300049161 Bacteria 694
211 Ga0501314_009853 3300049530 Bacteria 883
212 Ga0501031_0006443 3300049568 Bacteria 7653
213 Ga0501032_0003288 3300049569 Bacteria 12436
214 Ga0501033_0065482 3300049570 Bacteria 2673
215 Ga0501034_0001270 3300049571 Bacteria 34238
216 Ga0501034_0039721 3300049571 Bacteria 4766
217 Ga0501036_0054595 3300049572 Bacteria 3384
218 Ga0501038_0000460 3300049574 Bacteria 35683
219 Ga0501039_0018835 3300049575 Bacteria 5299
220 Ga0501042_0016016 3300049578 Bacteria 5143
221 Ga0501043_0685727 3300049579 Bacteria 749
222 Ga0501046_0005726 3300049580 Bacteria 11089
223 Ga0501046_0153617 3300049580 Bacteria 1735
224 Ga0501047_0029410 3300049581 Bacteria 5298
225 Ga0501047_0051317 3300049581 Bacteria 3985
226 Ga0501047_0340275 3300049581 Bacteria 1338
227 Ga0501048_0023053 3300049582 Bacteria 4550
228 Ga0501068_0294495 3300049584 Bacteria 1038
229 Ga0501070_0306503 3300049586 Bacteria 1293
230 Ga0501071_0561331 3300049587 Bacteria 877
231 Ga0501217_096969 3300049661 Bacteria 834
232 Ga0501080_0030514 3300049742 Bacteria 5022
233 Ga0501080_0150407 3300049742 Bacteria 2152
234 Ga0501083_0005165 3300049744 Bacteria 9237
235 Ga0501083_0114352 3300049744 Bacteria 1772
236 Ga0501035_0014042 3300049822 Bacteria 7389
237 Ga0501044_0019859 3300049823 Bacteria 7176
238 Ga0501044_0128764 3300049823 Bacteria 2526
239 nmdc:mga0yw44_228181_c1 3300050492 Bacteria 1235
240 nmdc:mga09592_186040_c1 3300050508 Bacteria 1797
241 nmdc:mga08y16_1665330_c1 3300050511 Bacteria 594
242 nmdc:mga0n895_387316_c1 3300050512 Bacteria 1414
243 Ga0495601_0715412 3300053077 Bacteria 638
244 Ga0495619_0098131 3300053085 Bacteria 1991
245 Ga0495619_0107401 3300053085 Bacteria 1904
246 Ga0500556_0002670 3300053104 Bacteria 5559
247 Ga0500616_0006771 3300053153 Bacteria 7423
248 Ga0500622_0012818 3300053156 Bacteria 4530
249 Ga0587082_070902 3300059504 Bacteria 708
250 Ga0587072_101649 3300059643 Bacteria 646
251 Ga0501082_0703723 3300060353 Bacteria 884
252 2643832391 2643221563 Bacteria 4726935
253 2644053814 2643221608 Bacteria 4724829
254 2879163219 2879163058 Bacteria 4223965
255 Ga0265327_10006374
256 JGI24751J29686_10003175
257 rootL2_10245891
258 Ga0058863_11618102
259 Ga0058862_12623714
260 Ga0065715_10016542
261 Ga0070683_100014090
262 Ga0070690_100881900
263 Ga0070670_100138613
264 Ga0070660_100100277
265 Ga0070671_100728496
266 Ga0070659_100315973
267 Ga0070713_100090064
268 Ga0070711_100970833
269 Ga0070681_10260536
270 Ga0070679_100088409
271 Ga0070684_100078223
272 Ga0068853_100258755
273 Ga0070693_100150655
274 Ga0070665_100000481
275 Ga0070664_100068792
276 Ga0070664_101032322
277 Ga0068857_100427328
278 Ga0068856_100000386
279 Ga0068856_100163358
280 Ga0068859_100239417
281 Ga0068859_100373351
282 Ga0068860_100426285
283 Ga0070717_10000170
284 Ga0075365_10028095
285 Ga0075428_100006819
286 Ga0075429_100234686
287 Ga0097620_100239418
288 Ga0097620_100373308
289 Ga0075435_100224109
290 Ga0105248_10532383
291 Ga0157370_10000415
292 Ga0163163_10231030
293 Ga0157377_10483693
294 Ga0157376_10951463
295 Ga0206355_1010418
296 Ga0206350_10107061
297 Ga0206353_11681484
298 Ga0224712_10371681
299 Ga0209676_1006284
300 Ga0207697_10068442
301 Ga0207663_10364181
302 Ga0207649_10001754
303 Ga0207649_10055866
304 Ga0207652_10151077
305 Ga0207650_10482169
306 Ga0207700_10097951
307 Ga0207690_10295069
308 Ga0207661_10033058
309 Ga0207661_10085260
310 Ga0207661_10805193
311 Ga0207679_10048135
312 Ga0207667_10664402
313 Ga0207639_10228120
314 Ga0207702_10001862
315 Ga0207702_10800194
316 Ga0207674_10076962
317 Ga0207674_10262987
318 Ga0268266_10000579
319 Ga0265337_1000422
320 Ga0265337_1007617
321 Ga0265337_1022773
322 Ga0265337_1066582
323 Ga0265326_10008326
324 Ga0265319_1000413
325 Ga0265319_1001930
326 Ga0265319_1002873
327 Ga0265319_1006817
328 Ga0265319_1008883
329 Ga0265319_1065391
330 Ga0265334_10001655
331 Ga0265334_10029702
332 Ga0265318_10000005
333 Ga0265318_10001127
334 Ga0265318_10001223
335 Ga0265318_10005378
336 Ga0265318_10070103
337 Ga0265318_10109871
338 Ga0265323_10003771
339 Ga0265323_10022816
340 Ga0265323_10059032
341 Ga0265322_10030887
342 Ga0265336_10002751
343 Ga0265338_10000751
344 Ga0265338_10002409
345 Ga0265338_10008716
346 Ga0265338_10015915
347 Ga0265324_10001475
348 Ga0265324_10029152
349 Ga0265324_10059193
350 Ga0265332_10035808
351 Ga0265332_10094933
352 Ga0265332_10123073
353 Ga0265332_10130572
354 Ga0265328_10019982
355 Ga0265320_10004354
356 Ga0265320_10005300
357 Ga0265320_10007824
358 Ga0265320_10009056
359 Ga0265320_10014611
360 Ga0265320_10015796
361 Ga0265320_10016041
362 Ga0265320_10016214
363 Ga0265320_10063667
364 Ga0265320_10076722
365 Ga0265320_10080195
366 Ga0265320_10080237
367 Ga0265320_10129168
368 Ga0265325_10000530
369 Ga0265325_10054224
370 Ga0265325_10146758
371 Ga0265339_10000577
372 Ga0265331_10000069
373 Ga0265331_10014661
374 Ga0265327_10001241
375 Ga0265327_10003543
376 Ga0265327_10038378
377 Ga0265327_10048584
378 Ga0265327_10141481
379 Ga0265316_10019745
380 Ga0265316_10045877
381 Ga0307408_100000007
382 Ga0307408_100682358
383 Ga0265313_10001302
384 Ga0265313_10002061
385 Ga0265313_10002470
386 Ga0265313_10003847
387 Ga0265313_10004616
388 Ga0265313_10013574
389 Ga0307508_10000024
390 Ga0265314_10000655
391 Ga0265314_10001464
392 Ga0265314_10010483
393 Ga0265314_10058363
394 Ga0265314_10131255
395 Ga0265314_10146526
396 Ga0265314_10237226
397 Ga0265314_10403001
398 Ga0265342_10007520
399 Ga0265342_10018965
400 Ga0265342_10145440
401 Ga0307405_10519760
402 Ga0307413_10077781
403 Ga0307410_10001097
404 Ga0307407_10042049
405 Ga0307412_10096556
406 Ga0307409_100000047
407 Ga0307416_100000491
408 Ga0307411_10047616
409 Ga0316586_1012791
410 Ga0316596_1143559
411 Ga0373951_0030004
412 Ga0373941_0123932
413 Ga0373956_0317744
414 Ga0373955_0372942
415 Ga0316574_0017827
416 Ga0316574_0563964
417 Ga0373935_0486807
418 Ga0373927_0141182
419 Ga0373933_0021110
420 Ga0373937_0431258
421 Ga0373937_0862719
422 Ga0316584_0522767
423 Ga0439446_0028603
424 Ga0439446_0087967
425 Ga0451577_0000012
426 Ga0451577_0000606
427 Ga0451577_0026724
428 Ga0451577_0106833
429 Ga0451577_0156147
430 Ga0451577_0518315
431 Ga0453683_0001213
432 Ga0453683_0019758
433 Ga0453683_0264141
434 Ga0453684_0000001
435 Ga0453684_0006911
436 Ga0453684_0035196
437 Ga0453684_0263869
438 Ga0451576_0001422
439 Ga0451576_0001452
440 Ga0451576_0001806
441 Ga0451576_0073317
442 Ga0451576_0135757
443 Ga0466967_0027687
444 Ga0495651_0211841
445 Ga0495651_0434699
446 Ga0495582_0272787
447 Ga0495628_0271236
448 Ga0495630_0846075
449 Ga0495599_0395236
450 Ga0495658_0263201
451 Ga0495636_0075817
452 Ga0496102_0551086
453 Ga0496104_0060925
454 Ga0496105_0221986
455 Ga0496106_0528551
456 Ga0496109_1404634
457 Ga0496110_0006759
458 Ga0496110_0935001
459 Ga0496111_0369230
460 Ga0496112_0027478
461 Ga0496115_0151184
462 Ga0496121_0045390
463 Ga0501308_035513
464 Ga0501305_051068
465 Ga0501314_009853
466 Ga0501031_0006443
467 Ga0501032_0003288
468 Ga0501033_0065482
469 Ga0501034_0001270
470 Ga0501034_0039721
471 Ga0501036_0054595
472 Ga0501038_0000460
473 Ga0501039_0018835
474 Ga0501042_0016016
475 Ga0501043_0685727
476 Ga0501046_0005726
477 Ga0501046_0153617
478 Ga0501047_0029410
479 Ga0501047_0051317
480 Ga0501047_0340275
481 Ga0501048_0023053
482 Ga0501068_0294495
483 Ga0501070_0306503
484 Ga0501071_0561331
485 Ga0501217_096969
486 Ga0501080_0030514
487 Ga0501080_0150407
488 Ga0501083_0005165
489 Ga0501083_0114352
490 Ga0501035_0014042
491 Ga0501044_0019859
492 Ga0501044_0128764
493 nmdc:mga0yw44_228181_c1
494 nmdc:mga09592_186040_c1
495 nmdc:mga08y16_1665330_c1
496 nmdc:mga0n895_387316_c1
497 Ga0495601_0715412
498 Ga0495619_0098131
499 Ga0495619_0107401
500 Ga0500556_0002670
501 Ga0500616_0006771
502 Ga0500622_0012818
503 Ga0587082_070902
504 Ga0587072_101649
505 Ga0501082_0703723
506 2643832391
507 2644053814
508 2879163219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

138

245

0.95

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

43

131

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xuq-assembly1.cif.gz_B crystal structure of soda-1 (ba4499) from bacillus anthracis at 1.8a resolution. 0.9781 3 197
1xre-assembly1.cif.gz_B crystal structure of soda-2 (ba5696) from bacillus anthracis at 1.8a resolution. 0.9773 3 198
6pro-assembly1.cif.gz_B mnsod from geobacillus stearothermophilus 0.9762 3 197
2rcv-assembly3.cif.gz_D crystal structure of the bacillus subtilis superoxide dismutase 0.9755 2 196
2rcv-assembly4.cif.gz_F crystal structure of the bacillus subtilis superoxide dismutase 0.9752 2 196
ID Description Score Start End Superfamily
1xuqB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9966 20 90 1.10.287.990
1xuqA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.996 20 90 1.10.287.990
2rcvA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9916 20 90 1.10.287.990
2rcvD01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9905 20 90 1.10.287.990
2rcvG01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Fe,Mn superoxide dismutase (SOD) domain 0.9891 20 90 1.10.287.990
ID Description Score Start End GO Terms
AF-A0A3M0Z9H9-F1-model_v4 deleted 0.9981 1 135
AF-A0A2V9MT98-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9977 1 122 GO:0004784
GO:0005737
GO:0046872
AF-A0A3D4FXU5-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9973 1 154 GO:0004784
GO:0005737
GO:0046872
AF-A0A2V9NNS6-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9964 1 91 GO:0004784
GO:0005737
GO:0046872
AF-A0A3D1TZ71-F1-model_v4 superoxide dismutase (EC 1.15.1.1) 0.9939 1 106 GO:0004784
GO:0005737
GO:0046872

Map