F364612

General Info

Members Datasets Scaffolds Average Seq Length
254 167 508 193

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100036255|Ga0070690_1000362554
Length 210
Sequence MADEYEVPVKVVDRRWWARGEDAPGSETSASLKPSYVEELERKLADSEKQAQEYLGKYRQASQEFEVARARMRKELAKDAERSRRDVLASLLEVVDNLDRAIDAARKTTKTPRPDSGQAPRPGSEQVNDAADPLLQGVELVRQQFLSKLEGFGVTRIPTEGAMFDPLVHEAVTTVPGDEAADGRIAGVIAQGYRIGDEVLRPALVAVVKA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
117 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
118 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
148 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
153 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 3.54
Rhizosphere 93.31
Stem 0
Stem Tuber 0
Unclassified 7.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100036255 3300005330 Bacteria 3098
2 JGI24744J21845_10032795 3300002077 Bacteria 990
3 Ga0065712_10069759 3300005290 Bacteria 6752
4 Ga0065712_10229379 3300005290 Bacteria 1016
5 Ga0065715_10093822 3300005293 Bacteria 4540
6 Ga0065715_10172613 3300005293 Bacteria 1534
7 Ga0065707_10107533 3300005295 Bacteria 2550
8 Ga0070676_10011320 3300005328 Bacteria 4849
9 Ga0070670_100039975 3300005331 Bacteria 4034
10 Ga0070670_100056874 3300005331 Bacteria 3358
11 Ga0068868_100232335 3300005338 Bacteria 1547
12 Ga0068868_100568646 3300005338 Bacteria 1001
13 Ga0070660_100487571 3300005339 Bacteria 1025
14 Ga0070691_10189104 3300005341 Bacteria 1076
15 Ga0070687_100010648 3300005343 Bacteria 3989
16 Ga0070668_101172799 3300005347 Bacteria 695
17 Ga0070669_100046221 3300005353 Bacteria 3175
18 Ga0070675_100051512 3300005354 Bacteria 3383
19 Ga0070675_100497958 3300005354 Bacteria 1098
20 Ga0070674_100009531 3300005356 Bacteria 5815
21 Ga0070674_100013264 3300005356 Bacteria 5089
22 Ga0070674_100517572 3300005356 Bacteria 996
23 Ga0070674_100682989 3300005356 Bacteria 876
24 Ga0070673_100002757 3300005364 Bacteria 10793
25 Ga0070673_100958799 3300005364 Bacteria 795
26 Ga0070667_100218852 3300005367 Bacteria 1694
27 Ga0070667_100620650 3300005367 Bacteria 997
28 Ga0070703_10112761 3300005406 Bacteria 975
29 Ga0070701_10245680 3300005438 Bacteria 1078
30 Ga0070700_100038481 3300005441 Bacteria 2915
31 Ga0070663_100638295 3300005455 Bacteria 899
32 Ga0070678_100143669 3300005456 Bacteria 1913
33 Ga0070662_100188929 3300005457 Bacteria 1628
34 Ga0068867_100119357 3300005459 Bacteria 2036
35 Ga0070685_10190889 3300005466 Bacteria 1325
36 Ga0070679_100339218 3300005530 Bacteria 1451
37 Ga0070684_100337556 3300005535 Bacteria 1385
38 Ga0070684_100684019 3300005535 Bacteria 956
39 Ga0070672_100675688 3300005543 Bacteria 903
40 Ga0070695_100101469 3300005545 Bacteria 1939
41 Ga0070696_100581072 3300005546 Bacteria 901
42 Ga0070665_100608344 3300005548 Bacteria 1106
43 Ga0070704_100074918 3300005549 Bacteria 2470
44 Ga0070704_100788096 3300005549 Bacteria 848
45 Ga0068855_100175268 3300005563 Bacteria 2427
46 Ga0068855_101080348 3300005563 Bacteria 840
47 Ga0070664_100057419 3300005564 Bacteria 3308
48 Ga0068854_100058271 3300005578 Bacteria 2787
49 Ga0068856_100289042 3300005614 Bacteria 1656
50 Ga0068852_100124012 3300005616 Bacteria 2369
51 Ga0068852_100830917 3300005616 Bacteria 939
52 Ga0068864_100043610 3300005618 Bacteria 3841
53 Ga0068864_100456782 3300005618 Bacteria 1222
54 Ga0068866_10473027 3300005718 Bacteria 824
55 Ga0068851_10188235 3300005834 Bacteria 1146
56 Ga0068863_100265864 3300005841 Bacteria 1659
57 Ga0075368_10014186 3300006042 Bacteria 2940
58 Ga0075367_10000563 3300006178 Bacteria 14116
59 Ga0075366_10095510 3300006195 Bacteria 1782
60 Ga0068871_100516496 3300006358 Bacteria 1078
61 Ga0075428_100027379 3300006844 Bacteria 6308
62 Ga0075428_100038823 3300006844 Bacteria 5239
63 Ga0075428_100085120 3300006844 Bacteria 3448
64 Ga0075430_100012122 3300006846 Bacteria 7341
65 Ga0075430_100031896 3300006846 Bacteria 4473
66 Ga0075430_100034809 3300006846 Bacteria 4275
67 Ga0075430_101024574 3300006846 Unclassified 680
68 Ga0075431_100004723 3300006847 Bacteria 13385
69 Ga0075431_100006143 3300006847 Bacteria 11917
70 Ga0075431_100011665 3300006847 Bacteria 8866
71 Ga0075431_100065232 3300006847 Bacteria 3760
72 Ga0075431_100314318 3300006847 Bacteria 1581
73 Ga0075431_100322018 3300006847 Bacteria 1559
74 Ga0075431_100575579 3300006847 Bacteria 1112
75 Ga0075431_100754702 3300006847 Bacteria 948
76 Ga0075433_10007619 3300006852 Bacteria 8596
77 Ga0075434_100091527 3300006871 Bacteria 3043
78 Ga0075434_100619638 3300006871 Bacteria 1101
79 Ga0075429_100065528 3300006880 Bacteria 3163
80 Ga0075429_100275749 3300006880 Bacteria 1472
81 Ga0075435_100010398 3300007076 Bacteria 6807
82 Ga0075435_100018663 3300007076 Bacteria 5282
83 Ga0075435_100050623 3300007076 Bacteria 3343
84 Ga0111539_10033464 3300009094 Bacteria 6239
85 Ga0111539_10316165 3300009094 Bacteria 1817
86 Ga0114129_10003220 3300009147 Bacteria 22906
87 Ga0114129_10010479 3300009147 Bacteria 13220
88 Ga0114129_10030757 3300009147 Bacteria 7593
89 Ga0105243_10069959 3300009148 Bacteria 2832
90 Ga0105241_10244325 3300009174 Unclassified 1519
91 Ga0105242_10073969 3300009176 Bacteria 2834
92 Ga0105238_10221724 3300009551 Bacteria 1867
93 Ga0105249_10923230 3300009553 Bacteria 940
94 Ga0105239_10192617 3300010375 Bacteria 2282
95 Ga0105239_11168935 3300010375 Bacteria 886
96 Ga0157370_10631230 3300013104 Bacteria 980
97 Ga0157372_10250629 3300013307 Bacteria 2055
98 Ga0163163_10072895 3300014325 Bacteria 3424
99 Ga0163163_10092046 3300014325 Bacteria 3047
100 Ga0163163_10403291 3300014325 Bacteria 1425
101 Ga0157380_10499557 3300014326 Bacteria 1181
102 Ga0157377_10220242 3300014745 Bacteria 1214
103 Ga0157376_10497807 3300014969 Bacteria 1197
104 Ga0207697_10031619 3300025315 Bacteria 2165
105 Ga0207656_10315353 3300025321 Bacteria 776
106 Ga0207688_10018277 3300025901 Bacteria 3816
107 Ga0207645_10013704 3300025907 Bacteria 5451
108 Ga0207654_10056325 3300025911 Bacteria 2280
109 Ga0207660_10456032 3300025917 Bacteria 1034
110 Ga0207662_10002425 3300025918 Bacteria 9354
111 Ga0207649_10331225 3300025920 Bacteria 1121
112 Ga0207652_10427917 3300025921 Bacteria 1194
113 Ga0207681_10098619 3300025923 Bacteria 2102
114 Ga0207650_10124014 3300025925 Bacteria 2014
115 Ga0207659_10151704 3300025926 Bacteria 1810
116 Ga0207659_10276516 3300025926 Bacteria 1371
117 Ga0207644_10037446 3300025931 Bacteria 3413
118 Ga0207706_10040066 3300025933 Bacteria 4152
119 Ga0207670_10814625 3300025936 Bacteria 778
120 Ga0207669_10633097 3300025937 Bacteria 873
121 Ga0207711_10278489 3300025941 Bacteria 1540
122 Ga0207689_10043484 3300025942 Bacteria 3713
123 Ga0207679_10102027 3300025945 Bacteria 2246
124 Ga0207679_10233024 3300025945 Bacteria 1556
125 Ga0207651_10002084 3300025960 Bacteria 9435
126 Ga0207651_10163789 3300025960 Bacteria 1746
127 Ga0207658_10310991 3300025986 Bacteria 1361
128 Ga0207658_10829719 3300025986 Unclassified 840
129 Ga0207677_10024198 3300026023 Bacteria 3768
130 Ga0207703_10219742 3300026035 Bacteria 1698
131 Ga0207639_10660406 3300026041 Bacteria 968
132 Ga0207678_10406663 3300026067 Bacteria 1179
133 Ga0207708_10008027 3300026075 Bacteria 7824
134 Ga0207708_10479211 3300026075 Bacteria 1040
135 Ga0207702_10399819 3300026078 Bacteria 1325
136 Ga0207648_10115085 3300026089 Bacteria 2363
137 Ga0207676_10322431 3300026095 Bacteria 1419
138 Ga0207676_10424940 3300026095 Bacteria 1247
139 Ga0207676_10903640 3300026095 Bacteria 866
140 Ga0207675_100071042 3300026118 Bacteria 3254
141 Ga0207683_10104700 3300026121 Bacteria 2529
142 Ga0207683_10206157 3300026121 Bacteria 1788
143 Ga0207698_10103583 3300026142 Bacteria 2365
144 Ga0207428_10175414 3300027907 Bacteria 1621
145 Ga0207428_10504846 3300027907 Unclassified 878
146 Ga0268265_10395934 3300028380 Bacteria 1275
147 Ga0307408_100052191 3300031548 Bacteria 2949
148 Ga0307408_100191200 3300031548 Bacteria 1649
149 Ga0307408_100475078 3300031548 Bacteria 1089
150 Ga0307405_10020699 3300031731 Bacteria 3681
151 Ga0307413_10236937 3300031824 Bacteria 1344
152 Ga0307413_10818666 3300031824 Bacteria 784
153 Ga0307410_10234904 3300031852 Bacteria 1418
154 Ga0307410_10860108 3300031852 Unclassified 775
155 Ga0307406_10144907 3300031901 Bacteria 1687
156 Ga0307406_10355206 3300031901 Bacteria 1147
157 Ga0307412_10403503 3300031911 Bacteria 1113
158 Ga0307412_10604530 3300031911 Bacteria 929
159 Ga0307409_100153771 3300031995 Bacteria 2001
160 Ga0307416_100029629 3300032002 Bacteria 4092
161 Ga0307416_100598840 3300032002 Bacteria 1182
162 Ga0307414_10019997 3300032004 Bacteria 4163
163 Ga0307411_10011266 3300032005 Bacteria 4816
164 Ga0373932_0072179 3300035112 Bacteria 1073
165 Ga0373936_0247316 3300035113 Bacteria 796
166 Ga0373942_0037937 3300035207 Bacteria 1305
167 Ga0373935_0282512 3300035692 Bacteria 1169
168 Ga0436365_0454014 3300039437 Unclassified 954
169 Ga0439453_0103801 3300041408 Bacteria 636
170 Ga0439461_0066448 3300041410 Bacteria 828
171 Ga0439446_0007974 3300042156 Bacteria 2798
172 Ga0439446_0101013 3300042156 Bacteria 912
173 Ga0495662_0077676 3300046476 Bacteria 1613
174 Ga0495630_0572847 3300046517 Bacteria 866
175 Ga0496100_0489272 3300048903 Bacteria 947
176 Ga0496101_0206592 3300048904 Bacteria 1520
177 Ga0496102_0434736 3300048905 Bacteria 1232
178 Ga0496102_0703958 3300048905 Bacteria 933
179 Ga0496106_0065973 3300048909 Bacteria 2756
180 Ga0496108_0057468 3300048911 Bacteria 3269
181 Ga0496109_0235213 3300048912 Bacteria 1724
182 Ga0496112_0154265 3300048915 Bacteria 2264
183 Ga0496112_0726523 3300048915 Unclassified 920
184 Ga0501031_0157070 3300049568 Bacteria 1487
185 Ga0501033_0407864 3300049570 Bacteria 947
186 Ga0501033_0606691 3300049570 Unclassified 750
187 Ga0501036_0066122 3300049572 Bacteria 3059
188 Ga0501036_0205377 3300049572 Bacteria 1656
189 Ga0501036_0489848 3300049572 Unclassified 1023
190 Ga0501037_0365142 3300049573 Unclassified 994
191 Ga0501038_0385355 3300049574 Bacteria 1087
192 Ga0501040_0159150 3300049576 Bacteria 1596
193 Ga0501040_0374499 3300049576 Bacteria 1021
194 Ga0501040_0538711 3300049576 Bacteria 842
195 Ga0501041_0147130 3300049577 Bacteria 1470
196 Ga0501042_0065018 3300049578 Bacteria 2607
197 Ga0501042_0169025 3300049578 Bacteria 1578
198 Ga0501043_0692575 3300049579 Unclassified 745
199 Ga0501048_0158558 3300049582 Bacteria 1601
200 Ga0501068_0455167 3300049584 Unclassified 828
201 Ga0501071_0011258 3300049587 Bacteria 6020
202 Ga0501071_0582015 3300049587 Unclassified 860
203 Ga0501072_0034752 3300049588 Bacteria 3950
204 Ga0501072_0048597 3300049588 Bacteria 3341
205 Ga0501073_0145672 3300049589 Bacteria 1641
206 Ga0501074_0062459 3300049590 Bacteria 2683
207 Ga0501075_0041375 3300049591 Bacteria 3453
208 Ga0501075_0574093 3300049591 Unclassified 860
209 Ga0501076_0016279 3300049592 Bacteria 5636
210 Ga0501076_0029583 3300049592 Bacteria 4261
211 Ga0501076_0048493 3300049592 Bacteria 3357
212 Ga0501076_0160038 3300049592 Bacteria 1834
213 Ga0501077_0152034 3300049593 Bacteria 1469
214 Ga0501225_0035196 3300049705 Bacteria 1379
215 Ga0501079_0018964 3300049741 Bacteria 5256
216 Ga0501079_0216658 3300049741 Bacteria 1495
217 Ga0501080_0159612 3300049742 Bacteria 2083
218 Ga0501081_0170286 3300049743 Bacteria 1572
219 Ga0501083_0153970 3300049744 Bacteria 1505
220 Ga0501083_0187324 3300049744 Bacteria 1351
221 Ga0501083_0452207 3300049744 Unclassified 836
222 Ga0501035_0660293 3300049822 Unclassified 847
223 Ga0501045_0019785 3300049824 Bacteria 4804
224 Ga0501045_0041243 3300049824 Bacteria 3359
225 Ga0501045_0223628 3300049824 Bacteria 1401
226 nmdc:mga0k408_11143_c1 3300050493 Bacteria 4887
227 nmdc:mga06z11_31382_c1 3300050494 Bacteria 2581
228 nmdc:mga04h51_32500_c1 3300050495 Bacteria 1655
229 nmdc:mga05p37_2338_c1 3300050507 Bacteria 22051
230 nmdc:mga05p37_272616_c1 3300050507 Bacteria 2021
231 nmdc:mga05p37_28713_c1 3300050507 Bacteria 6786
232 nmdc:mga05p37_63651_c1 3300050507 Bacteria 4539
233 nmdc:mga09592_32228_c1 3300050508 Bacteria 4369
234 nmdc:mga0qj67_112154_c1 3300050509 Bacteria 2202
235 nmdc:mga0qj67_20523_c1 3300050509 Bacteria 5061
236 nmdc:mga06r32_1004895_c1 3300050510 Unclassified 787
237 nmdc:mga06r32_39276_c1 3300050510 Bacteria 4491
238 nmdc:mga06r32_537861_c1 3300050510 Bacteria 1143
239 nmdc:mga06r32_56860_c1 3300050510 Bacteria 3756
240 nmdc:mga08y16_169425_c1 3300050511 Bacteria 2268
241 nmdc:mga08y16_26000_c1 3300050511 Bacteria 6175
242 nmdc:mga0n895_196389_c1 3300050512 Bacteria 2049
243 nmdc:mga0n895_482641_c1 3300050512 Bacteria 1250
244 nmdc:mga0n895_57147_c1 3300050512 Bacteria 3845
245 nmdc:mga0n895_753922_c1 3300050512 Bacteria 966
246 nmdc:mga0rr50_16661_c1 3300050513 Bacteria 4887
247 nmdc:mga0rr50_8307_c1 3300050513 Bacteria 6458
248 nmdc:mga0a205_408923_c1 3300050515 Bacteria 1220
249 nmdc:mga0a205_7877_c1 3300050515 Bacteria 9675
250 Ga0500628_037731 3300053129 Unclassified 1087
251 Ga0501084_0097226 3300054114 Bacteria 2472
252 Ga0501084_0125230 3300054114 Bacteria 2162
253 Ga0501082_1157922 3300060353 Bacteria 676
254 Ga0530510_0195097 3300061734 Bacteria 1503
255 Ga0070690_100036255
256 JGI24744J21845_10032795
257 Ga0065712_10069759
258 Ga0065712_10229379
259 Ga0065715_10093822
260 Ga0065715_10172613
261 Ga0065707_10107533
262 Ga0070676_10011320
263 Ga0070670_100039975
264 Ga0070670_100056874
265 Ga0068868_100232335
266 Ga0068868_100568646
267 Ga0070660_100487571
268 Ga0070691_10189104
269 Ga0070687_100010648
270 Ga0070668_101172799
271 Ga0070669_100046221
272 Ga0070675_100051512
273 Ga0070675_100497958
274 Ga0070674_100009531
275 Ga0070674_100013264
276 Ga0070674_100517572
277 Ga0070674_100682989
278 Ga0070673_100002757
279 Ga0070673_100958799
280 Ga0070667_100218852
281 Ga0070667_100620650
282 Ga0070703_10112761
283 Ga0070701_10245680
284 Ga0070700_100038481
285 Ga0070663_100638295
286 Ga0070678_100143669
287 Ga0070662_100188929
288 Ga0068867_100119357
289 Ga0070685_10190889
290 Ga0070679_100339218
291 Ga0070684_100337556
292 Ga0070684_100684019
293 Ga0070672_100675688
294 Ga0070695_100101469
295 Ga0070696_100581072
296 Ga0070665_100608344
297 Ga0070704_100074918
298 Ga0070704_100788096
299 Ga0068855_100175268
300 Ga0068855_101080348
301 Ga0070664_100057419
302 Ga0068854_100058271
303 Ga0068856_100289042
304 Ga0068852_100124012
305 Ga0068852_100830917
306 Ga0068864_100043610
307 Ga0068864_100456782
308 Ga0068866_10473027
309 Ga0068851_10188235
310 Ga0068863_100265864
311 Ga0075368_10014186
312 Ga0075367_10000563
313 Ga0075366_10095510
314 Ga0068871_100516496
315 Ga0075428_100027379
316 Ga0075428_100038823
317 Ga0075428_100085120
318 Ga0075430_100012122
319 Ga0075430_100031896
320 Ga0075430_100034809
321 Ga0075430_101024574
322 Ga0075431_100004723
323 Ga0075431_100006143
324 Ga0075431_100011665
325 Ga0075431_100065232
326 Ga0075431_100314318
327 Ga0075431_100322018
328 Ga0075431_100575579
329 Ga0075431_100754702
330 Ga0075433_10007619
331 Ga0075434_100091527
332 Ga0075434_100619638
333 Ga0075429_100065528
334 Ga0075429_100275749
335 Ga0075435_100010398
336 Ga0075435_100018663
337 Ga0075435_100050623
338 Ga0111539_10033464
339 Ga0111539_10316165
340 Ga0114129_10003220
341 Ga0114129_10010479
342 Ga0114129_10030757
343 Ga0105243_10069959
344 Ga0105241_10244325
345 Ga0105242_10073969
346 Ga0105238_10221724
347 Ga0105249_10923230
348 Ga0105239_10192617
349 Ga0105239_11168935
350 Ga0157370_10631230
351 Ga0157372_10250629
352 Ga0163163_10072895
353 Ga0163163_10092046
354 Ga0163163_10403291
355 Ga0157380_10499557
356 Ga0157377_10220242
357 Ga0157376_10497807
358 Ga0207697_10031619
359 Ga0207656_10315353
360 Ga0207688_10018277
361 Ga0207645_10013704
362 Ga0207654_10056325
363 Ga0207660_10456032
364 Ga0207662_10002425
365 Ga0207649_10331225
366 Ga0207652_10427917
367 Ga0207681_10098619
368 Ga0207650_10124014
369 Ga0207659_10151704
370 Ga0207659_10276516
371 Ga0207644_10037446
372 Ga0207706_10040066
373 Ga0207670_10814625
374 Ga0207669_10633097
375 Ga0207711_10278489
376 Ga0207689_10043484
377 Ga0207679_10102027
378 Ga0207679_10233024
379 Ga0207651_10002084
380 Ga0207651_10163789
381 Ga0207658_10310991
382 Ga0207658_10829719
383 Ga0207677_10024198
384 Ga0207703_10219742
385 Ga0207639_10660406
386 Ga0207678_10406663
387 Ga0207708_10008027
388 Ga0207708_10479211
389 Ga0207702_10399819
390 Ga0207648_10115085
391 Ga0207676_10322431
392 Ga0207676_10424940
393 Ga0207676_10903640
394 Ga0207675_100071042
395 Ga0207683_10104700
396 Ga0207683_10206157
397 Ga0207698_10103583
398 Ga0207428_10175414
399 Ga0207428_10504846
400 Ga0268265_10395934
401 Ga0307408_100052191
402 Ga0307408_100191200
403 Ga0307408_100475078
404 Ga0307405_10020699
405 Ga0307413_10236937
406 Ga0307413_10818666
407 Ga0307410_10234904
408 Ga0307410_10860108
409 Ga0307406_10144907
410 Ga0307406_10355206
411 Ga0307412_10403503
412 Ga0307412_10604530
413 Ga0307409_100153771
414 Ga0307416_100029629
415 Ga0307416_100598840
416 Ga0307414_10019997
417 Ga0307411_10011266
418 Ga0373932_0072179
419 Ga0373936_0247316
420 Ga0373942_0037937
421 Ga0373935_0282512
422 Ga0436365_0454014
423 Ga0439453_0103801
424 Ga0439461_0066448
425 Ga0439446_0007974
426 Ga0439446_0101013
427 Ga0495662_0077676
428 Ga0495630_0572847
429 Ga0496100_0489272
430 Ga0496101_0206592
431 Ga0496102_0434736
432 Ga0496102_0703958
433 Ga0496106_0065973
434 Ga0496108_0057468
435 Ga0496109_0235213
436 Ga0496112_0154265
437 Ga0496112_0726523
438 Ga0501031_0157070
439 Ga0501033_0407864
440 Ga0501033_0606691
441 Ga0501036_0066122
442 Ga0501036_0205377
443 Ga0501036_0489848
444 Ga0501037_0365142
445 Ga0501038_0385355
446 Ga0501040_0159150
447 Ga0501040_0374499
448 Ga0501040_0538711
449 Ga0501041_0147130
450 Ga0501042_0065018
451 Ga0501042_0169025
452 Ga0501043_0692575
453 Ga0501048_0158558
454 Ga0501068_0455167
455 Ga0501071_0011258
456 Ga0501071_0582015
457 Ga0501072_0034752
458 Ga0501072_0048597
459 Ga0501073_0145672
460 Ga0501074_0062459
461 Ga0501075_0041375
462 Ga0501075_0574093
463 Ga0501076_0016279
464 Ga0501076_0029583
465 Ga0501076_0048493
466 Ga0501076_0160038
467 Ga0501077_0152034
468 Ga0501225_0035196
469 Ga0501079_0018964
470 Ga0501079_0216658
471 Ga0501080_0159612
472 Ga0501081_0170286
473 Ga0501083_0153970
474 Ga0501083_0187324
475 Ga0501083_0452207
476 Ga0501035_0660293
477 Ga0501045_0019785
478 Ga0501045_0041243
479 Ga0501045_0223628
480 nmdc:mga0k408_11143_c1
481 nmdc:mga06z11_31382_c1
482 nmdc:mga04h51_32500_c1
483 nmdc:mga05p37_2338_c1
484 nmdc:mga05p37_272616_c1
485 nmdc:mga05p37_28713_c1
486 nmdc:mga05p37_63651_c1
487 nmdc:mga09592_32228_c1
488 nmdc:mga0qj67_112154_c1
489 nmdc:mga0qj67_20523_c1
490 nmdc:mga06r32_1004895_c1
491 nmdc:mga06r32_39276_c1
492 nmdc:mga06r32_537861_c1
493 nmdc:mga06r32_56860_c1
494 nmdc:mga08y16_169425_c1
495 nmdc:mga08y16_26000_c1
496 nmdc:mga0n895_196389_c1
497 nmdc:mga0n895_482641_c1
498 nmdc:mga0n895_57147_c1
499 nmdc:mga0n895_753922_c1
500 nmdc:mga0rr50_16661_c1
501 nmdc:mga0rr50_8307_c1
502 nmdc:mga0a205_408923_c1
503 nmdc:mga0a205_7877_c1
504 Ga0500628_037731
505 Ga0501084_0097226
506 Ga0501084_0125230
507 Ga0501082_1157922
508 Ga0530510_0195097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

26

209

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8d08-assembly1.cif.gz_B hallucinated c4 protein assembly halc4_135 0.8397 73 134
8d08-assembly1.cif.gz_B hallucinated c4 protein assembly halc4_135 0.785 73 134
3a6m-assembly1.cif.gz_B crystal structure of grpe from thermus thermophilus hb8 0.7692 39 193
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.7448 88 134
8d08-assembly1.cif.gz_C hallucinated c4 protein assembly halc4_135 0.7375 73 132
ID Description Score Start End Superfamily
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.954 135 190 2.30.22.10
af_A0A1D6EAQ0_210_272_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9447 135 191 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9369 135 192 2.30.22.10
3a6mB02 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9232 135 193 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9215 135 190 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A2V8U310-F1-model_v4 Protein GrpE 0.9623 85 192 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A382MKH5-F1-model_v4 Nucleotide exchange factor GrpE 0.9584 71 192 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A645EFG1-F1-model_v4 Protein GrpE 0.9498 117 192 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A7C0U6Y1-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9418 39 192 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A2W4KXV8-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9394 39 192 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Map