F364423

General Info

Members Datasets Scaffolds Average Seq Length
253 190 506 292

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0098495|Ga0501083_0098495_225_1217
Length 330
Sequence MPGLVPGIHAFLKSLQSDVDGRDKPGHDEHHVRFDQGISRVTAPLTEIAYAKINLTLRVVGRRADGYHDLESLVVFADLADTLTLQPGPISSLDVAGPFARASGDPSDNLVLKAQRLLAESIGDLKGGRFLLDKQIPVAAGIGGGSADAAAALRLLARLNGLAADDARLMLAALRAGADVPVCLSLSPCIMTGVGERLSPPLDLPPLHAVLVNPRVPLATRDVFAAYAGRSAASTPLPHEVPWDPSALIAFLRANGNDLTDAAIQRAPVVAEVLDALRMAPGALLARMSGSGSTCFGLFAAASEAQAAAARLAATQNEWWVTPAVFGDRS

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
80 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
81 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
98 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
122 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
166 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
167 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
168 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
169 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
170 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
171 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
172 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
173 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
174 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
175 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
176 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
179 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
180 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
181 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
182 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
183 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
184 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
185 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
186 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
187 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
188 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
189 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
190 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.86
Metatranscriptomes 0
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 3.16
Rhizoplane 3.95
Rhizosphere 78.66
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0098495 3300049744 Bacteria 1929
2 LJQas_1004486 3300000549 Bacteria 1816
3 JGI25406J46586_10001380 3300003203 Bacteria 11459
4 JGI25153J46596_10002124 3300003215 Bacteria 11600
5 JGI25153J46596_10005484 3300003215 Bacteria 6643
6 JGI25153J46596_10006612 3300003215 Bacteria 5838
7 JGI25160J50197_1000468 3300003354 Bacteria 24863
8 JGI25404J52841_10016851 3300003659 Bacteria 1585
9 Ga0070690_100364441 3300005330 Bacteria 1052
10 Ga0070670_100390198 3300005331 Bacteria 1227
11 Ga0068869_100138637 3300005334 Bacteria 1876
12 Ga0070666_10071179 3300005335 Bacteria 2366
13 Ga0070680_100018583 3300005336 Bacteria 5495
14 Ga0068868_100035675 3300005338 Bacteria 3846
15 Ga0070689_100065967 3300005340 Bacteria 2820
16 Ga0070668_100205946 3300005347 Bacteria 1616
17 Ga0070671_100190625 3300005355 Bacteria 1737
18 Ga0070667_100118918 3300005367 Bacteria 2297
19 Ga0070714_100105470 3300005435 Bacteria 2489
20 Ga0070714_100410476 3300005435 Bacteria 1282
21 Ga0070713_100001192 3300005436 Bacteria 16609
22 Ga0070713_100102987 3300005436 Bacteria 2477
23 Ga0070710_10007572 3300005437 Bacteria 5260
24 Ga0070711_100016389 3300005439 Bacteria 4706
25 Ga0070663_100105232 3300005455 Bacteria 2112
26 Ga0070698_100414082 3300005471 Bacteria 1282
27 Ga0070684_100082485 3300005535 Bacteria 2847
28 Ga0068853_100001044 3300005539 Bacteria 19587
29 Ga0068853_100137698 3300005539 Bacteria 2190
30 Ga0070686_100191702 3300005544 Bacteria 1459
31 Ga0070704_100013413 3300005549 Bacteria 5085
32 Ga0068855_100071225 3300005563 Bacteria 4043
33 Ga0068857_100003596 3300005577 Bacteria 12974
34 Ga0068856_100001713 3300005614 Bacteria 22930
35 Ga0068856_100156806 3300005614 Bacteria 2286
36 Ga0068852_100457780 3300005616 Bacteria 1264
37 Ga0068859_100396800 3300005617 Bacteria 1475
38 Ga0068861_100209509 3300005719 Bacteria 1641
39 Ga0068851_10004580 3300005834 Bacteria 6236
40 Ga0068858_100021035 3300005842 Bacteria 6095
41 Ga0081455_10072980 3300005937 Bacteria 2839
42 Ga0081455_10218205 3300005937 Bacteria 1416
43 Ga0081540_1012931 3300005983 Bacteria 5454
44 Ga0081540_1017427 3300005983 Bacteria 4449
45 Ga0081540_1024482 3300005983 Bacteria 3502
46 Ga0081539_10000306 3300005985 Bacteria 110402
47 Ga0070717_10029209 3300006028 Bacteria 4420
48 Ga0070717_10323693 3300006028 Bacteria 1374
49 Ga0075365_10008902 3300006038 Bacteria 5730
50 Ga0070715_10101958 3300006163 Bacteria 1340
51 Ga0070716_100023019 3300006173 Bacteria 3299
52 Ga0097621_100007709 3300006237 Bacteria 7718
53 Ga0075428_100000740 3300006844 Bacteria 33927
54 Ga0075428_100005056 3300006844 Bacteria 14667
55 Ga0075430_100001054 3300006846 Bacteria 21797
56 Ga0075431_100001076 3300006847 Bacteria 24422
57 Ga0075431_100022310 3300006847 Bacteria 6471
58 Ga0075431_100052546 3300006847 Bacteria 4202
59 Ga0075433_10009722 3300006852 Bacteria 7703
60 Ga0075434_100003201 3300006871 Bacteria 14596
61 Ga0075434_100121719 3300006871 Bacteria 2625
62 Ga0075429_100000098 3300006880 Bacteria 47888
63 Ga0075429_100002876 3300006880 Bacteria 14584
64 Ga0075429_100064883 3300006880 Bacteria 3179
65 Ga0075436_100265843 3300006914 Bacteria 1224
66 Ga0097620_100396790 3300006931 Bacteria 1475
67 Ga0075435_100011835 3300007076 Bacteria 6440
68 Ga0075435_100027047 3300007076 Bacteria 4483
69 Ga0075435_100265612 3300007076 Bacteria 1463
70 Ga0105240_10061474 3300009093 Bacteria 4681
71 Ga0111539_10001453 3300009094 Bacteria 31639
72 Ga0111539_10001671 3300009094 Bacteria 29561
73 Ga0105245_10006447 3300009098 Bacteria 10332
74 Ga0114129_10000025 3300009147 Bacteria 116480
75 Ga0114129_10008949 3300009147 Bacteria 14268
76 Ga0114129_10017470 3300009147 Bacteria 10214
77 Ga0114129_10051974 3300009147 Bacteria 5752
78 Ga0114129_10338370 3300009147 Bacteria 1997
79 Ga0105242_10098903 3300009176 Bacteria 2468
80 Ga0105237_10005466 3300009545 Bacteria 14335
81 Ga0105238_10011272 3300009551 Bacteria 8997
82 Ga0157369_10005875 3300013105 Bacteria 14258
83 Ga0213874_10042619 3300021377 Bacteria 1364
84 Ga0209233_1001599 3300025261 Bacteria 8847
85 Ga0209564_1001218 3300025295 Bacteria 29178
86 Ga0209758_1002794 3300025297 Bacteria 17072
87 Ga0207656_10004372 3300025321 Bacteria 4929
88 Ga0207707_10004226 3300025912 Bacteria 12715
89 Ga0207707_10346309 3300025912 Bacteria 1281
90 Ga0207671_10028875 3300025914 Bacteria 4143
91 Ga0207660_10004976 3300025917 Bacteria 8663
92 Ga0207657_10019260 3300025919 Bacteria 6485
93 Ga0207652_10006366 3300025921 Bacteria 9535
94 Ga0207694_10022474 3300025924 Bacteria 4785
95 Ga0207687_10021457 3300025927 Bacteria 4292
96 Ga0207700_10106863 3300025928 Bacteria 2244
97 Ga0207690_10101589 3300025932 Bacteria 2055
98 Ga0207711_10059609 3300025941 Bacteria 3287
99 Ga0207661_10070477 3300025944 Bacteria 2854
100 Ga0207667_10010402 3300025949 Bacteria 10877
101 Ga0207674_10012857 3300026116 Bacteria 9343
102 Ga0207698_10123971 3300026142 Bacteria 2193
103 Ga0209389_1000009 3300027296 Bacteria 226873
104 Ga0209489_100050 3300027361 Bacteria 154669
105 Ga0209700_100016 3300027363 Bacteria 252567
106 Ga0207428_10000137 3300027907 Bacteria 98535
107 Ga0207428_10001840 3300027907 Bacteria 21679
108 Ga0307515_10076036 3300028794 Bacteria 4463
109 Ga0265325_10007291 3300031241 Bacteria 6639
110 Ga0265325_10014117 3300031241 Bacteria 4524
111 Ga0265339_10007480 3300031249 Bacteria 7056
112 Ga0265316_10061027 3300031344 Bacteria 2929
113 Ga0265313_10102723 3300031595 Bacteria 1267
114 Ga0316583_10002894 3300032133 Bacteria 6026
115 Ga0373954_0018512 3300035118 Bacteria 3136
116 Ga0373927_0041247 3300035695 Bacteria 2994
117 Ga0395899_0038268 3300037312 Bacteria 3593
118 Ga0395900_0001040 3300037418 Bacteria 35567
119 Ga0395900_0019647 3300037418 Bacteria 6888
120 Ga0395898_0019812 3300037466 Bacteria 6841
121 Ga0395898_0071648 3300037466 Bacteria 3348
122 Ga0395898_0248027 3300037466 Bacteria 1698
123 Ga0395898_0451812 3300037466 Bacteria 1224
124 Ga0395901_0031178 3300038443 Bacteria 5496
125 Ga0395901_0056946 3300038443 Bacteria 4066
126 Ga0436365_1565489 3300039437 Bacteria 4814
127 Ga0466966_0002598 3300044684 Bacteria 11837
128 Ga0466961_0000060 3300044693 Bacteria 65360
129 Ga0466961_0040456 3300044693 Bacteria 2989
130 Ga0466963_0064851 3300044694 Bacteria 2448
131 Ga0466963_0094370 3300044694 Bacteria 2040
132 Ga0466971_0048137 3300044719 Bacteria 1917
133 Ga0466957_0026833 3300044842 Bacteria 3419
134 Ga0466959_0040959 3300045049 Bacteria 3421
135 Ga0466959_0057973 3300045049 Bacteria 2822
136 Ga0466958_0035116 3300045836 Bacteria 2994
137 Ga0466958_0290164 3300045836 Bacteria 1049
138 Ga0466967_0074127 3300045976 Bacteria 3056
139 Ga0466967_0412502 3300045976 Bacteria 1315
140 Ga0495592_0100103 3300046454 Bacteria 2067
141 Ga0495603_0011173 3300046455 Bacteria 5443
142 Ga0495651_0004592 3300046462 Bacteria 10557
143 Ga0495653_0056752 3300046463 Bacteria 2983
144 Ga0495664_0002455 3300046477 Bacteria 9976
145 Ga0495606_0015856 3300046507 Bacteria 5783
146 Ga0495608_0074206 3300046511 Bacteria 2217
147 Ga0495652_0007482 3300046529 Bacteria 10065
148 Ga0495640_0049170 3300046533 Bacteria 2909
149 Ga0495587_0008692 3300046536 Bacteria 6522
150 Ga0495667_0015643 3300046559 Bacteria 5129
151 Ga0495634_0119928 3300046642 Bacteria 1684
152 Ga0495625_0136884 3300046660 Bacteria 1655
153 Ga0495635_0026923 3300046663 Bacteria 3999
154 Ga0495657_0001548 3300046675 Bacteria 19769
155 Ga0495599_0027107 3300046678 Bacteria 3591
156 Ga0495623_0017839 3300046679 Bacteria 4584
157 Ga0495646_0013928 3300046680 Bacteria 5111
158 Ga0495613_0037017 3300046689 Bacteria 3618
159 Ga0495600_0004226 3300046809 Bacteria 8576
160 Ga0495581_0045543 3300047315 Bacteria 2536
161 Ga0495604_0002599 3300047317 Bacteria 14477
162 Ga0495675_0003763 3300047444 Bacteria 9179
163 Ga0495602_0042268 3300048088 Bacteria 4154
164 Ga0496100_0151839 3300048903 Bacteria 1653
165 Ga0496101_0134937 3300048904 Bacteria 1877
166 Ga0496103_0035697 3300048906 Bacteria 3044
167 Ga0496106_0004376 3300048909 Bacteria 10495
168 Ga0496106_0335803 3300048909 Bacteria 1213
169 Ga0496109_0227772 3300048912 Bacteria 1753
170 Ga0496111_0124294 3300048914 Bacteria 1907
171 Ga0496112_0038931 3300048915 Bacteria 4644
172 Ga0496112_0048603 3300048915 Bacteria 4159
173 Ga0496113_0081396 3300048916 Bacteria 2482
174 Ga0496118_0079619 3300048921 Bacteria 2311
175 Ga0496120_0095600 3300048923 Bacteria 1579
176 Ga0496120_0187499 3300048923 Bacteria 1011
177 Ga0496126_0050405 3300048929 Unclassified 3794
178 Ga0501033_0042596 3300049570 Bacteria 3384
179 Ga0501034_0024710 3300049571 Bacteria 6111
180 Ga0501034_0067138 3300049571 Bacteria 3600
181 Ga0501034_0088134 3300049571 Bacteria 3102
182 Ga0501034_0249815 3300049571 Bacteria 1718
183 Ga0501034_0344037 3300049571 Bacteria 1421
184 Ga0501039_0225198 3300049575 Bacteria 1474
185 Ga0501043_0147028 3300049579 Bacteria 1845
186 Ga0501047_0026255 3300049581 Bacteria 5603
187 Ga0501047_0036479 3300049581 Bacteria 4751
188 Ga0501047_0219632 3300049581 Bacteria 1757
189 Ga0501067_0148874 3300049583 Bacteria 1304
190 Ga0501069_0126202 3300049585 Bacteria 1463
191 Ga0501070_0075686 3300049586 Bacteria 2787
192 Ga0501070_0094556 3300049586 Bacteria 2473
193 Ga0501070_0123514 3300049586 Bacteria 2139
194 Ga0501073_0109923 3300049589 Bacteria 1912
195 Ga0501074_0222610 3300049590 Bacteria 1343
196 Ga0501079_0124452 3300049741 Bacteria 2006
197 Ga0501080_0298667 3300049742 Bacteria 1461
198 Ga0501035_0001160 3300049822 Bacteria 27476
199 Ga0501035_0392898 3300049822 Bacteria 1155
200 Ga0501044_0028547 3300049823 Bacteria 5889
201 Ga0501044_0051911 3300049823 Bacteria 4228
202 Ga0501044_0088606 3300049823 Bacteria 3124
203 nmdc:mga03683_167758_c1 3300050489 Bacteria 996
204 nmdc:mga05p37_201_c1 3300050507 Bacteria 59705
205 nmdc:mga05p37_27418_c1 3300050507 Bacteria 6934
206 nmdc:mga05p37_337337_c1 3300050507 Bacteria 1778
207 nmdc:mga05p37_66_c1 3300050507 Bacteria 91764
208 nmdc:mga09592_1702_c1 3300050508 Bacteria 17731
209 nmdc:mga09592_2047_c1 3300050508 Bacteria 16265
210 nmdc:mga0qj67_36319_c1 3300050509 Bacteria 3855
211 nmdc:mga0qj67_512_c1 3300050509 Bacteria 26543
212 nmdc:mga06r32_37487_c1 3300050510 Bacteria 4585
213 nmdc:mga06r32_451_c1 3300050510 Bacteria 34946
214 nmdc:mga06r32_7326_c1 3300050510 Bacteria 9931
215 nmdc:mga08y16_1809_c1 3300050511 Bacteria 21689
216 nmdc:mga08y16_48_c1 3300050511 Bacteria 111306
217 nmdc:mga0n895_119328_c1 3300050512 Bacteria 2658
218 nmdc:mga0n895_22228_c1 3300050512 Bacteria 5947
219 nmdc:mga0n895_43_c1 3300050512 Bacteria 74924
220 nmdc:mga0rr50_1204_c1 3300050513 Bacteria 14048
221 nmdc:mga0rr50_15776_c1 3300050513 Bacteria 4996
222 nmdc:mga08x19_57562_c1 3300050514 Bacteria 2512
223 nmdc:mga0a205_155415_c1 3300050515 Bacteria 2186
224 nmdc:mga0a205_3268_c1 3300050515 Bacteria 14416
225 Ga0495595_0060015 3300053084 Bacteria 1779
226 Ga0495619_0034538 3300053085 Bacteria 3288
227 Ga0495619_0256756 3300053085 Bacteria 1211
228 Ga0500578_0174895 3300053086 Bacteria 1326
229 Ga0500643_000042 3300053087 Bacteria 158933
230 Ga0500566_0000087 3300053094 Bacteria 45921
231 Ga0500640_029235 3300053095 Bacteria 2408
232 Ga0500641_0080759 3300053096 Bacteria 1380
233 Ga0500572_000303 3300053111 Bacteria 17455
234 Ga0500608_021787 3300053122 Bacteria 2965
235 Ga0500614_000432 3300053123 Bacteria 10918
236 Ga0500559_0011166 3300053136 Bacteria 3841
237 Ga0500603_000824 3300053150 Bacteria 7414
238 Ga0500639_000717 3300053163 Bacteria 16797
239 Ga0500596_000523 3300053735 Bacteria 7239
240 Ga0501082_0140253 3300060353 Bacteria 2098
241 2508541301 2508501009 Bacteria 7784016
242 2524440631 2524023205 Bacteria 8918781
243 2745077907 2744054633 Bacteria 8678936
244 2824608189 2824600985 Bacteria 8488197
245 2824617142 2824609381 Bacteria 8672835
246 2824660993 2824653114 Bacteria 8493680
247 2824678938 2824671348 Bacteria 8369588
248 2847937960 2847930680 Bacteria 9342022
249 2874619618 2874612657 Bacteria 8252029
250 2876768646 2876761206 Bacteria 10111113
251 2879084242 2879083081 Bacteria 8587928
252 2888426038 2888419890 Bacteria 7857137
253 8056690371 8056689827 Bacteria 6712655
254 Ga0501083_0098495
255 LJQas_1004486
256 JGI25406J46586_10001380
257 JGI25153J46596_10002124
258 JGI25153J46596_10005484
259 JGI25153J46596_10006612
260 JGI25160J50197_1000468
261 JGI25404J52841_10016851
262 Ga0070690_100364441
263 Ga0070670_100390198
264 Ga0068869_100138637
265 Ga0070666_10071179
266 Ga0070680_100018583
267 Ga0068868_100035675
268 Ga0070689_100065967
269 Ga0070668_100205946
270 Ga0070671_100190625
271 Ga0070667_100118918
272 Ga0070714_100105470
273 Ga0070714_100410476
274 Ga0070713_100001192
275 Ga0070713_100102987
276 Ga0070710_10007572
277 Ga0070711_100016389
278 Ga0070663_100105232
279 Ga0070698_100414082
280 Ga0070684_100082485
281 Ga0068853_100001044
282 Ga0068853_100137698
283 Ga0070686_100191702
284 Ga0070704_100013413
285 Ga0068855_100071225
286 Ga0068857_100003596
287 Ga0068856_100001713
288 Ga0068856_100156806
289 Ga0068852_100457780
290 Ga0068859_100396800
291 Ga0068861_100209509
292 Ga0068851_10004580
293 Ga0068858_100021035
294 Ga0081455_10072980
295 Ga0081455_10218205
296 Ga0081540_1012931
297 Ga0081540_1017427
298 Ga0081540_1024482
299 Ga0081539_10000306
300 Ga0070717_10029209
301 Ga0070717_10323693
302 Ga0075365_10008902
303 Ga0070715_10101958
304 Ga0070716_100023019
305 Ga0097621_100007709
306 Ga0075428_100000740
307 Ga0075428_100005056
308 Ga0075430_100001054
309 Ga0075431_100001076
310 Ga0075431_100022310
311 Ga0075431_100052546
312 Ga0075433_10009722
313 Ga0075434_100003201
314 Ga0075434_100121719
315 Ga0075429_100000098
316 Ga0075429_100002876
317 Ga0075429_100064883
318 Ga0075436_100265843
319 Ga0097620_100396790
320 Ga0075435_100011835
321 Ga0075435_100027047
322 Ga0075435_100265612
323 Ga0105240_10061474
324 Ga0111539_10001453
325 Ga0111539_10001671
326 Ga0105245_10006447
327 Ga0114129_10000025
328 Ga0114129_10008949
329 Ga0114129_10017470
330 Ga0114129_10051974
331 Ga0114129_10338370
332 Ga0105242_10098903
333 Ga0105237_10005466
334 Ga0105238_10011272
335 Ga0157369_10005875
336 Ga0213874_10042619
337 Ga0209233_1001599
338 Ga0209564_1001218
339 Ga0209758_1002794
340 Ga0207656_10004372
341 Ga0207707_10004226
342 Ga0207707_10346309
343 Ga0207671_10028875
344 Ga0207660_10004976
345 Ga0207657_10019260
346 Ga0207652_10006366
347 Ga0207694_10022474
348 Ga0207687_10021457
349 Ga0207700_10106863
350 Ga0207690_10101589
351 Ga0207711_10059609
352 Ga0207661_10070477
353 Ga0207667_10010402
354 Ga0207674_10012857
355 Ga0207698_10123971
356 Ga0209389_1000009
357 Ga0209489_100050
358 Ga0209700_100016
359 Ga0207428_10000137
360 Ga0207428_10001840
361 Ga0307515_10076036
362 Ga0265325_10007291
363 Ga0265325_10014117
364 Ga0265339_10007480
365 Ga0265316_10061027
366 Ga0265313_10102723
367 Ga0316583_10002894
368 Ga0373954_0018512
369 Ga0373927_0041247
370 Ga0395899_0038268
371 Ga0395900_0001040
372 Ga0395900_0019647
373 Ga0395898_0019812
374 Ga0395898_0071648
375 Ga0395898_0248027
376 Ga0395898_0451812
377 Ga0395901_0031178
378 Ga0395901_0056946
379 Ga0436365_1565489
380 Ga0466966_0002598
381 Ga0466961_0000060
382 Ga0466961_0040456
383 Ga0466963_0064851
384 Ga0466963_0094370
385 Ga0466971_0048137
386 Ga0466957_0026833
387 Ga0466959_0040959
388 Ga0466959_0057973
389 Ga0466958_0035116
390 Ga0466958_0290164
391 Ga0466967_0074127
392 Ga0466967_0412502
393 Ga0495592_0100103
394 Ga0495603_0011173
395 Ga0495651_0004592
396 Ga0495653_0056752
397 Ga0495664_0002455
398 Ga0495606_0015856
399 Ga0495608_0074206
400 Ga0495652_0007482
401 Ga0495640_0049170
402 Ga0495587_0008692
403 Ga0495667_0015643
404 Ga0495634_0119928
405 Ga0495625_0136884
406 Ga0495635_0026923
407 Ga0495657_0001548
408 Ga0495599_0027107
409 Ga0495623_0017839
410 Ga0495646_0013928
411 Ga0495613_0037017
412 Ga0495600_0004226
413 Ga0495581_0045543
414 Ga0495604_0002599
415 Ga0495675_0003763
416 Ga0495602_0042268
417 Ga0496100_0151839
418 Ga0496101_0134937
419 Ga0496103_0035697
420 Ga0496106_0004376
421 Ga0496106_0335803
422 Ga0496109_0227772
423 Ga0496111_0124294
424 Ga0496112_0038931
425 Ga0496112_0048603
426 Ga0496113_0081396
427 Ga0496118_0079619
428 Ga0496120_0095600
429 Ga0496120_0187499
430 Ga0496126_0050405
431 Ga0501033_0042596
432 Ga0501034_0024710
433 Ga0501034_0067138
434 Ga0501034_0088134
435 Ga0501034_0249815
436 Ga0501034_0344037
437 Ga0501039_0225198
438 Ga0501043_0147028
439 Ga0501047_0026255
440 Ga0501047_0036479
441 Ga0501047_0219632
442 Ga0501067_0148874
443 Ga0501069_0126202
444 Ga0501070_0075686
445 Ga0501070_0094556
446 Ga0501070_0123514
447 Ga0501073_0109923
448 Ga0501074_0222610
449 Ga0501079_0124452
450 Ga0501080_0298667
451 Ga0501035_0001160
452 Ga0501035_0392898
453 Ga0501044_0028547
454 Ga0501044_0051911
455 Ga0501044_0088606
456 nmdc:mga03683_167758_c1
457 nmdc:mga05p37_201_c1
458 nmdc:mga05p37_27418_c1
459 nmdc:mga05p37_337337_c1
460 nmdc:mga05p37_66_c1
461 nmdc:mga09592_1702_c1
462 nmdc:mga09592_2047_c1
463 nmdc:mga0qj67_36319_c1
464 nmdc:mga0qj67_512_c1
465 nmdc:mga06r32_37487_c1
466 nmdc:mga06r32_451_c1
467 nmdc:mga06r32_7326_c1
468 nmdc:mga08y16_1809_c1
469 nmdc:mga08y16_48_c1
470 nmdc:mga0n895_119328_c1
471 nmdc:mga0n895_22228_c1
472 nmdc:mga0n895_43_c1
473 nmdc:mga0rr50_1204_c1
474 nmdc:mga0rr50_15776_c1
475 nmdc:mga08x19_57562_c1
476 nmdc:mga0a205_155415_c1
477 nmdc:mga0a205_3268_c1
478 Ga0495595_0060015
479 Ga0495619_0034538
480 Ga0495619_0256756
481 Ga0500578_0174895
482 Ga0500643_000042
483 Ga0500566_0000087
484 Ga0500640_029235
485 Ga0500641_0080759
486 Ga0500572_000303
487 Ga0500608_021787
488 Ga0500614_000432
489 Ga0500559_0011166
490 Ga0500603_000824
491 Ga0500639_000717
492 Ga0500596_000523
493 Ga0501082_0140253
494 2508541301
495 2524440631
496 2745077907
497 2824608189
498 2824617142
499 2824660993
500 2824678938
501 2847937960
502 2874619618
503 2876768646
504 2879084242
505 2888426038
506 8056690371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

109

186

0.96

PF08544

GHMP_kinases_C

GHMP kinases C terminal

244

318

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.848 3 294
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.8332 5 294
2v2q-assembly1.cif.gz_A ispe in complex with ligand 0.8317 3 292
2v2q-assembly1.cif.gz_A ispe in complex with ligand 0.8232 3 292
2ww4-assembly1.cif.gz_B a triclinic crystal form of e. coli 4-diphosphocytidyl-2c-methyl-d- erythritol kinase 0.8216 4 291
ID Description Score Start End Superfamily
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9109 3 160 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8847 4 160 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8806 1 161 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8753 1 161 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8742 4 160 3.30.230.10
ID Description Score Start End GO Terms
AF-Q13BT8-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9891 1 294 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A1I3EF76-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9887 1 294 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A522GGY3-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9596 4 294 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A7W6GH83-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9577 3 294 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A522GGY3-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9531 4 294 GO:0005524
GO:0016114
GO:0019288
GO:0050515

Map