F364419

General Info

Members Datasets Scaffolds Average Seq Length
253 170 506 214

Family's Representative Sequence

Representative Sequence 3300049684|Ga0501255_009793|Ga0501255_009793_113_871
Length 252
Sequence MLGQQKKGRADLADFFAERRDHAERVLLERRWQEDLMIPTLFIVLTFSLLYWFPIRRWMNRWGATSSDVACQMAGDNLLVDPTYSGTMAVLVNAKPEHIWPWLVQIGYRRGGLYSYDWLDRLFGYLDRPSATRILPEFQHLAVGDHIPLGRGPSWPVAVLEPNRTLVLDMRNLGGLDWVWQFGLDPIDETRTRLISRSRVRAQAVWAQLLTHAIEPAGFLMTRRMLLGLKERAEALRAASTTETRADERPAA

Samples

Sample ID Description Type Environment
1 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
123 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
159 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.14
Rhizosphere 94.86
Stem 0
Stem Tuber 0
Unclassified 30.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501255_009793 3300049684 Bacteria 1071
2 SwRhRL2b_contig_1608303 2162886007 Eukaryota 1094
3 JGI24751J29686_10014824 3300002459 Bacteria 1608
4 Ga0065704_10007371 3300005289 Bacteria 3995
5 Ga0065712_10074997 3300005290 Bacteria 3958
6 Ga0065707_10107618 3300005295 Bacteria 2527
7 Ga0070658_10515751 3300005327 Unclassified 1033
8 Ga0070676_10165765 3300005328 Bacteria 1425
9 Ga0070690_100248353 3300005330 Bacteria 1257
10 Ga0070670_100030735 3300005331 Bacteria 4625
11 Ga0070670_100230694 3300005331 Unclassified 1611
12 Ga0070677_10000822 3300005333 Bacteria 10242
13 Ga0070666_10172696 3300005335 Bacteria 1514
14 Ga0070680_100183657 3300005336 Bacteria 1762
15 Ga0068868_100008685 3300005338 Bacteria 7275
16 Ga0070660_100006697 3300005339 Bacteria 7994
17 Ga0070689_100072340 3300005340 Bacteria 2695
18 Ga0070689_100098860 3300005340 Bacteria 2308
19 Ga0070689_100169187 3300005340 Bacteria 1770
20 Ga0070687_100076461 3300005343 Bacteria 1813
21 Ga0070661_100058460 3300005344 Bacteria 2825
22 Ga0070661_100311822 3300005344 Bacteria 1227
23 Ga0070669_100004044 3300005353 Bacteria 10610
24 Ga0070675_100011595 3300005354 Bacteria 6904
25 Ga0070675_100296687 3300005354 Bacteria 1423
26 Ga0070671_100018044 3300005355 Bacteria 5726
27 Ga0070671_100479035 3300005355 Bacteria 1069
28 Ga0070674_100034071 3300005356 Bacteria 3397
29 Ga0070673_100011430 3300005364 Bacteria 6056
30 Ga0070673_100048414 3300005364 Unclassified 3314
31 Ga0070688_100212150 3300005365 Bacteria 1360
32 Ga0070659_100058063 3300005366 Bacteria 3052
33 Ga0070659_100688774 3300005366 Unclassified 883
34 Ga0070667_100018203 3300005367 Bacteria 5825
35 Ga0070667_100315790 3300005367 Bacteria 1409
36 Ga0070667_100517147 3300005367 Unclassified 1095
37 Ga0070705_100546425 3300005440 Unclassified 887
38 Ga0070681_10239871 3300005458 Bacteria 1726
39 Ga0070679_100013734 3300005530 Bacteria 7757
40 Ga0070684_100159166 3300005535 Bacteria 2048
41 Ga0070684_100365606 3300005535 Bacteria 1328
42 Ga0070672_100022000 3300005543 Unclassified 4676
43 Ga0070672_100115421 3300005543 Bacteria 2193
44 Ga0070672_100761184 3300005543 Bacteria 850
45 Ga0070686_100208800 3300005544 Bacteria 1404
46 Ga0070665_100046583 3300005548 Bacteria 4354
47 Ga0070665_100760400 3300005548 Bacteria 982
48 Ga0068855_100041157 3300005563 Bacteria 5478
49 Ga0070664_100001721 3300005564 Bacteria 17534
50 Ga0070664_100045782 3300005564 Bacteria 3695
51 Ga0070664_100324275 3300005564 Bacteria 1396
52 Ga0068857_100026525 3300005577 Bacteria 5107
53 Ga0070702_100131341 3300005615 Bacteria 1582
54 Ga0068859_100061060 3300005617 Bacteria 3798
55 Ga0068859_100082415 3300005617 Unclassified 3259
56 Ga0068859_101032576 3300005617 Unclassified 903
57 Ga0068864_100103567 3300005618 Unclassified 2527
58 Ga0068864_100151595 3300005618 Bacteria 2100
59 Ga0068864_100277485 3300005618 Bacteria 1563
60 Ga0068866_10196124 3300005718 Bacteria 1203
61 Ga0068870_10040057 3300005840 Bacteria 2427
62 Ga0068863_100091769 3300005841 Bacteria 2880
63 Ga0068863_100204050 3300005841 Bacteria 1902
64 Ga0068863_101136330 3300005841 Bacteria 786
65 Ga0068858_100023493 3300005842 Bacteria 5743
66 Ga0068858_100120742 3300005842 Unclassified 2450
67 Ga0068860_100014013 3300005843 Bacteria 7864
68 Ga0068860_100053099 3300005843 Bacteria 3854
69 Ga0068862_100020458 3300005844 Bacteria 5528
70 Ga0068862_100064336 3300005844 Unclassified 3157
71 Ga0068862_100291823 3300005844 Unclassified 1498
72 Ga0068862_100526030 3300005844 Unclassified 1126
73 Ga0068871_100080552 3300006358 Bacteria 2696
74 Ga0075428_100056245 3300006844 Bacteria 4309
75 Ga0075430_100025403 3300006846 Bacteria 5040
76 Ga0075431_100843216 3300006847 Unclassified 888
77 Ga0075431_101278989 3300006847 Unclassified 695
78 Ga0075434_100008946 3300006871 Bacteria 9325
79 Ga0075434_100039718 3300006871 Bacteria 4662
80 Ga0075429_100087038 3300006880 Bacteria 2723
81 Ga0097620_100061060 3300006931 Bacteria 3798
82 Ga0097620_100082416 3300006931 Unclassified 3259
83 Ga0097620_100184716 3300006931 Unclassified 2168
84 Ga0097620_101032889 3300006931 Unclassified 903
85 Ga0075435_100164102 3300007076 Bacteria 1872
86 Ga0111539_10071052 3300009094 Bacteria 4107
87 Ga0111539_10103603 3300009094 Unclassified 3339
88 Ga0111539_10166475 3300009094 Bacteria 2577
89 Ga0111539_11134242 3300009094 Bacteria 908
90 Ga0105245_10196131 3300009098 Bacteria 1937
91 Ga0105243_10564533 3300009148 Unclassified 1090
92 Ga0105242_10842773 3300009176 Bacteria 911
93 Ga0105248_10001230 3300009177 Bacteria 28575
94 Ga0105248_10903211 3300009177 Unclassified 997
95 Ga0105249_10895725 3300009553 Unclassified 954
96 Ga0105239_10765756 3300010375 Bacteria 1105
97 Ga0157378_10062035 3300013297 Bacteria 3338
98 Ga0157378_10637478 3300013297 Bacteria 1080
99 Ga0157375_11371887 3300013308 Unclassified 832
100 Ga0163163_10001423 3300014325 Bacteria 20246
101 Ga0163163_10082726 3300014325 Unclassified 3214
102 Ga0163163_10141383 3300014325 Bacteria 2449
103 Ga0157380_10035882 3300014326 Bacteria 3833
104 Ga0157379_10035986 3300014968 Unclassified 4415
105 Ga0157379_10144348 3300014968 Bacteria 2146
106 Ga0157379_10288598 3300014968 Bacteria 1494
107 Ga0157379_10403692 3300014968 Bacteria 1256
108 Ga0157376_10007983 3300014969 Bacteria 7596
109 Ga0157376_10358341 3300014969 Bacteria 1398
110 Ga0207673_1014152 3300025290 Bacteria 1051
111 Ga0207697_10010334 3300025315 Bacteria 3994
112 Ga0207682_10002240 3300025893 Bacteria 8733
113 Ga0207688_10010401 3300025901 Bacteria 5063
114 Ga0207680_10192837 3300025903 Bacteria 1384
115 Ga0207645_10004303 3300025907 Bacteria 10563
116 Ga0207643_10000286 3300025908 Bacteria 35077
117 Ga0207643_10066758 3300025908 Bacteria 2064
118 Ga0207707_10244190 3300025912 Bacteria 1561
119 Ga0207660_10216958 3300025917 Bacteria 1500
120 Ga0207662_10529432 3300025918 Unclassified 814
121 Ga0207657_10048278 3300025919 Bacteria 3717
122 Ga0207649_10064529 3300025920 Bacteria 2315
123 Ga0207649_10333598 3300025920 Unclassified 1118
124 Ga0207652_10009197 3300025921 Bacteria 7952
125 Ga0207681_10351375 3300025923 Bacteria 1180
126 Ga0207650_10063868 3300025925 Unclassified 2754
127 Ga0207650_10103393 3300025925 Bacteria 2196
128 Ga0207650_10552260 3300025925 Unclassified 966
129 Ga0207659_10029665 3300025926 Bacteria 3730
130 Ga0207659_10074009 3300025926 Bacteria 2496
131 Ga0207659_10074115 3300025926 Bacteria 2494
132 Ga0207659_10106664 3300025926 Unclassified 2122
133 Ga0207687_10583475 3300025927 Bacteria 941
134 Ga0207644_10008503 3300025931 Bacteria 6717
135 Ga0207644_10271048 3300025931 Bacteria 1360
136 Ga0207644_10386384 3300025931 Unclassified 1142
137 Ga0207690_10916369 3300025932 Unclassified 727
138 Ga0207670_10225935 3300025936 Bacteria 1435
139 Ga0207691_10015636 3300025940 Bacteria 7214
140 Ga0207691_10018656 3300025940 Bacteria 6572
141 Ga0207691_10106562 3300025940 Bacteria 2496
142 Ga0207691_10503373 3300025940 Bacteria 1029
143 Ga0207711_10044188 3300025941 Unclassified 3803
144 Ga0207689_10054207 3300025942 Unclassified 3303
145 Ga0207661_10070654 3300025944 Bacteria 2851
146 Ga0207661_10798736 3300025944 Unclassified 869
147 Ga0207679_10039060 3300025945 Bacteria 3387
148 Ga0207667_10021499 3300025949 Bacteria 7147
149 Ga0207651_10083405 3300025960 Bacteria 2311
150 Ga0207712_10110696 3300025961 Bacteria 2059
151 Ga0207658_10108539 3300025986 Unclassified 2189
152 Ga0207658_10288724 3300025986 Bacteria 1409
153 Ga0207677_10325219 3300026023 Bacteria 1279
154 Ga0207703_10016220 3300026035 Bacteria 5806
155 Ga0207703_10076978 3300026035 Unclassified 2768
156 Ga0207703_10089835 3300026035 Unclassified 2580
157 Ga0207678_10206631 3300026067 Bacteria 1680
158 Ga0207708_10004743 3300026075 Bacteria 10003
159 Ga0207708_10303272 3300026075 Bacteria 1300
160 Ga0207641_10015277 3300026088 Bacteria 6292
161 Ga0207641_10147290 3300026088 Bacteria 2130
162 Ga0207641_10240732 3300026088 Unclassified 1686
163 Ga0207641_10969024 3300026088 Bacteria 846
164 Ga0207676_10047674 3300026095 Bacteria 3322
165 Ga0207676_10115272 3300026095 Bacteria 2256
166 Ga0207675_100053344 3300026118 Bacteria 3773
167 Ga0207683_10344935 3300026121 Unclassified 1366
168 Ga0209996_1014188 3300027395 Bacteria 1081
169 Ga0209999_1023729 3300027543 Bacteria 1131
170 Ga0268266_10517191 3300028379 Bacteria 1141
171 Ga0268265_10098517 3300028380 Bacteria 2355
172 Ga0268265_10113006 3300028380 Unclassified 2221
173 Ga0268265_10443590 3300028380 Unclassified 1210
174 Ga0268265_10766385 3300028380 Bacteria 938
175 Ga0268264_10198072 3300028381 Unclassified 1835
176 Ga0307408_100745781 3300031548 Unclassified 884
177 Ga0307407_10703390 3300031903 Unclassified 761
178 Ga0307412_10359928 3300031911 Unclassified 1171
179 Ga0307416_100277386 3300032002 Unclassified 1650
180 Ga0307414_10645161 3300032004 Unclassified 954
181 Ga0373923_0108289 3300035111 Bacteria 1232
182 Ga0373943_0256888 3300035170 Unclassified 983
183 Ga0373955_0498545 3300035172 Unclassified 744
184 Ga0373931_0328705 3300035691 Unclassified 952
185 Ga0373935_0466386 3300035692 Bacteria 914
186 Ga0373935_0546874 3300035692 Unclassified 844
187 Ga0439453_0082532 3300041408 Unclassified 695
188 Ga0439450_018190 3300042008 Unclassified 1474
189 Ga0439446_0018673 3300042156 Unclassified 1945
190 Ga0439435_0011866 3300042436 Unclassified 2098
191 Ga0439444_0050281 3300042437 Bacteria 845
192 Ga0453683_0214485 3300044673 Bacteria 1223
193 Ga0451576_0028592 3300045051 Bacteria 5969
194 Ga0451576_0281899 3300045051 Bacteria 1737
195 Ga0451576_0673087 3300045051 Bacteria 1087
196 Ga0495582_0092971 3300046473 Bacteria 1683
197 Ga0495608_0002072 3300046511 Bacteria 14434
198 Ga0495608_0112132 3300046511 Unclassified 1753
199 Ga0495628_0125139 3300046516 Bacteria 1970
200 Ga0495630_0006460 3300046517 Bacteria 8340
201 Ga0495640_0412769 3300046533 Bacteria 828
202 Ga0495667_0135441 3300046559 Bacteria 1588
203 Ga0495634_0084825 3300046642 Bacteria 2065
204 Ga0495635_0341144 3300046663 Bacteria 1001
205 Ga0495646_0157801 3300046680 Unclassified 1258
206 Ga0495669_0012839 3300046684 Bacteria 3566
207 Ga0495613_0006307 3300046689 Bacteria 8869
208 Ga0495674_0099039 3300047319 Bacteria 2482
209 Ga0495674_0220006 3300047319 Bacteria 1570
210 Ga0495676_0533896 3300047321 Unclassified 768
211 Ga0495684_0001550 3300047471 Bacteria 18403
212 Ga0496101_0419384 3300048904 Bacteria 1055
213 Ga0496104_0060366 3300048907 Unclassified 3592
214 Ga0496104_0386033 3300048907 Unclassified 1313
215 Ga0496105_0098993 3300048908 Bacteria 2408
216 Ga0496106_0576773 3300048909 Unclassified 902
217 Ga0496108_0190130 3300048911 Bacteria 1779
218 Ga0496108_0352237 3300048911 Bacteria 1285
219 Ga0496110_0139106 3300048913 Bacteria 2195
220 Ga0496111_0045593 3300048914 Unclassified 3155
221 Ga0496112_0143974 3300048915 Bacteria 2352
222 Ga0496112_0823925 3300048915 Bacteria 852
223 Ga0496113_0114693 3300048916 Bacteria 2101
224 Ga0496114_0079629 3300048917 Bacteria 2766
225 Ga0501295_034424 3300049518 Unclassified 1019
226 Ga0501039_0159528 3300049575 Bacteria 1773
227 Ga0501042_0325929 3300049578 Unclassified 1110
228 Ga0501042_0388470 3300049578 Unclassified 1011
229 Ga0501072_0310829 3300049588 Bacteria 1253
230 Ga0501076_0254889 3300049592 Bacteria 1436
231 Ga0501216_006405 3300049660 Unclassified 1805
232 Ga0501225_0013746 3300049705 Unclassified 2264
233 Ga0501225_0033477 3300049705 Bacteria 1414
234 Ga0501079_0185324 3300049741 Bacteria 1625
235 Ga0501079_0225826 3300049741 Unclassified 1463
236 Ga0501241_059432 3300049758 Unclassified 766
237 Ga0501212_040319 3300049851 Unclassified 771
238 nmdc:mga09592_49009_c1 3300050508 Bacteria 3561
239 nmdc:mga0qj67_137652_c1 3300050509 Bacteria 1979
240 nmdc:mga06r32_425915_c1 3300050510 Unclassified 1308
241 nmdc:mga08y16_107502_c1 3300050511 Unclassified 2904
242 nmdc:mga08y16_130755_c1 3300050511 Bacteria 2611
243 nmdc:mga08y16_212933_c1 3300050511 Unclassified 2001
244 nmdc:mga08y16_350775_c1 3300050511 Unclassified 1516
245 nmdc:mga0n895_126083_c1 3300050512 Bacteria 2584
246 nmdc:mga0rr50_123394_c1 3300050513 Bacteria 2065
247 nmdc:mga0rr50_296236_c1 3300050513 Bacteria 1352
248 nmdc:mga08x19_168784_c1 3300050514 Unclassified 1489
249 Ga0495601_0012366 3300053077 Bacteria 5120
250 Ga0495601_0356678 3300053077 Bacteria 950
251 Ga0495595_0191528 3300053084 Unclassified 1016
252 Ga0495619_0001631 3300053085 Bacteria 14785
253 Ga0590077_000030 3300059426 Bacteria 33448
254 Ga0501255_009793
255 SwRhRL2b_contig_1608303
256 JGI24751J29686_10014824
257 Ga0065704_10007371
258 Ga0065712_10074997
259 Ga0065707_10107618
260 Ga0070658_10515751
261 Ga0070676_10165765
262 Ga0070690_100248353
263 Ga0070670_100030735
264 Ga0070670_100230694
265 Ga0070677_10000822
266 Ga0070666_10172696
267 Ga0070680_100183657
268 Ga0068868_100008685
269 Ga0070660_100006697
270 Ga0070689_100072340
271 Ga0070689_100098860
272 Ga0070689_100169187
273 Ga0070687_100076461
274 Ga0070661_100058460
275 Ga0070661_100311822
276 Ga0070669_100004044
277 Ga0070675_100011595
278 Ga0070675_100296687
279 Ga0070671_100018044
280 Ga0070671_100479035
281 Ga0070674_100034071
282 Ga0070673_100011430
283 Ga0070673_100048414
284 Ga0070688_100212150
285 Ga0070659_100058063
286 Ga0070659_100688774
287 Ga0070667_100018203
288 Ga0070667_100315790
289 Ga0070667_100517147
290 Ga0070705_100546425
291 Ga0070681_10239871
292 Ga0070679_100013734
293 Ga0070684_100159166
294 Ga0070684_100365606
295 Ga0070672_100022000
296 Ga0070672_100115421
297 Ga0070672_100761184
298 Ga0070686_100208800
299 Ga0070665_100046583
300 Ga0070665_100760400
301 Ga0068855_100041157
302 Ga0070664_100001721
303 Ga0070664_100045782
304 Ga0070664_100324275
305 Ga0068857_100026525
306 Ga0070702_100131341
307 Ga0068859_100061060
308 Ga0068859_100082415
309 Ga0068859_101032576
310 Ga0068864_100103567
311 Ga0068864_100151595
312 Ga0068864_100277485
313 Ga0068866_10196124
314 Ga0068870_10040057
315 Ga0068863_100091769
316 Ga0068863_100204050
317 Ga0068863_101136330
318 Ga0068858_100023493
319 Ga0068858_100120742
320 Ga0068860_100014013
321 Ga0068860_100053099
322 Ga0068862_100020458
323 Ga0068862_100064336
324 Ga0068862_100291823
325 Ga0068862_100526030
326 Ga0068871_100080552
327 Ga0075428_100056245
328 Ga0075430_100025403
329 Ga0075431_100843216
330 Ga0075431_101278989
331 Ga0075434_100008946
332 Ga0075434_100039718
333 Ga0075429_100087038
334 Ga0097620_100061060
335 Ga0097620_100082416
336 Ga0097620_100184716
337 Ga0097620_101032889
338 Ga0075435_100164102
339 Ga0111539_10071052
340 Ga0111539_10103603
341 Ga0111539_10166475
342 Ga0111539_11134242
343 Ga0105245_10196131
344 Ga0105243_10564533
345 Ga0105242_10842773
346 Ga0105248_10001230
347 Ga0105248_10903211
348 Ga0105249_10895725
349 Ga0105239_10765756
350 Ga0157378_10062035
351 Ga0157378_10637478
352 Ga0157375_11371887
353 Ga0163163_10001423
354 Ga0163163_10082726
355 Ga0163163_10141383
356 Ga0157380_10035882
357 Ga0157379_10035986
358 Ga0157379_10144348
359 Ga0157379_10288598
360 Ga0157379_10403692
361 Ga0157376_10007983
362 Ga0157376_10358341
363 Ga0207673_1014152
364 Ga0207697_10010334
365 Ga0207682_10002240
366 Ga0207688_10010401
367 Ga0207680_10192837
368 Ga0207645_10004303
369 Ga0207643_10000286
370 Ga0207643_10066758
371 Ga0207707_10244190
372 Ga0207660_10216958
373 Ga0207662_10529432
374 Ga0207657_10048278
375 Ga0207649_10064529
376 Ga0207649_10333598
377 Ga0207652_10009197
378 Ga0207681_10351375
379 Ga0207650_10063868
380 Ga0207650_10103393
381 Ga0207650_10552260
382 Ga0207659_10029665
383 Ga0207659_10074009
384 Ga0207659_10074115
385 Ga0207659_10106664
386 Ga0207687_10583475
387 Ga0207644_10008503
388 Ga0207644_10271048
389 Ga0207644_10386384
390 Ga0207690_10916369
391 Ga0207670_10225935
392 Ga0207691_10015636
393 Ga0207691_10018656
394 Ga0207691_10106562
395 Ga0207691_10503373
396 Ga0207711_10044188
397 Ga0207689_10054207
398 Ga0207661_10070654
399 Ga0207661_10798736
400 Ga0207679_10039060
401 Ga0207667_10021499
402 Ga0207651_10083405
403 Ga0207712_10110696
404 Ga0207658_10108539
405 Ga0207658_10288724
406 Ga0207677_10325219
407 Ga0207703_10016220
408 Ga0207703_10076978
409 Ga0207703_10089835
410 Ga0207678_10206631
411 Ga0207708_10004743
412 Ga0207708_10303272
413 Ga0207641_10015277
414 Ga0207641_10147290
415 Ga0207641_10240732
416 Ga0207641_10969024
417 Ga0207676_10047674
418 Ga0207676_10115272
419 Ga0207675_100053344
420 Ga0207683_10344935
421 Ga0209996_1014188
422 Ga0209999_1023729
423 Ga0268266_10517191
424 Ga0268265_10098517
425 Ga0268265_10113006
426 Ga0268265_10443590
427 Ga0268265_10766385
428 Ga0268264_10198072
429 Ga0307408_100745781
430 Ga0307407_10703390
431 Ga0307412_10359928
432 Ga0307416_100277386
433 Ga0307414_10645161
434 Ga0373923_0108289
435 Ga0373943_0256888
436 Ga0373955_0498545
437 Ga0373931_0328705
438 Ga0373935_0466386
439 Ga0373935_0546874
440 Ga0439453_0082532
441 Ga0439450_018190
442 Ga0439446_0018673
443 Ga0439435_0011866
444 Ga0439444_0050281
445 Ga0453683_0214485
446 Ga0451576_0028592
447 Ga0451576_0281899
448 Ga0451576_0673087
449 Ga0495582_0092971
450 Ga0495608_0002072
451 Ga0495608_0112132
452 Ga0495628_0125139
453 Ga0495630_0006460
454 Ga0495640_0412769
455 Ga0495667_0135441
456 Ga0495634_0084825
457 Ga0495635_0341144
458 Ga0495646_0157801
459 Ga0495669_0012839
460 Ga0495613_0006307
461 Ga0495674_0099039
462 Ga0495674_0220006
463 Ga0495676_0533896
464 Ga0495684_0001550
465 Ga0496101_0419384
466 Ga0496104_0060366
467 Ga0496104_0386033
468 Ga0496105_0098993
469 Ga0496106_0576773
470 Ga0496108_0190130
471 Ga0496108_0352237
472 Ga0496110_0139106
473 Ga0496111_0045593
474 Ga0496112_0143974
475 Ga0496112_0823925
476 Ga0496113_0114693
477 Ga0496114_0079629
478 Ga0501295_034424
479 Ga0501039_0159528
480 Ga0501042_0325929
481 Ga0501042_0388470
482 Ga0501072_0310829
483 Ga0501076_0254889
484 Ga0501216_006405
485 Ga0501225_0013746
486 Ga0501225_0033477
487 Ga0501079_0185324
488 Ga0501079_0225826
489 Ga0501241_059432
490 Ga0501212_040319
491 nmdc:mga09592_49009_c1
492 nmdc:mga0qj67_137652_c1
493 nmdc:mga06r32_425915_c1
494 nmdc:mga08y16_107502_c1
495 nmdc:mga08y16_130755_c1
496 nmdc:mga08y16_212933_c1
497 nmdc:mga08y16_350775_c1
498 nmdc:mga0n895_126083_c1
499 nmdc:mga0rr50_123394_c1
500 nmdc:mga0rr50_296236_c1
501 nmdc:mga08x19_168784_c1
502 Ga0495601_0012366
503 Ga0495601_0356678
504 Ga0495595_0191528
505 Ga0495619_0001631
506 Ga0590077_000030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.7168 48 194
7azn-assembly1.cif.gz_A structure of mouse asterc (gramd1c) with a new cholesterol-derived compound 0.704 118 206
5kyn-assembly1.cif.gz_A structure of sec23 and tango1 complex 0.7007 137 168
3aeh-assembly2.cif.gz_B integral membrane domain of autotransporter hbp 0.6917 129 167
3qrc-assembly1.cif.gz_A the crystal structure of ail, the attachment invasion locus protein of yersinia pestis, in complex with the heparin analogue sucrose octasulfate 0.685 129 164
ID Description Score Start End Superfamily
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7259 45 197 3.30.530.20
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7111 48 198 3.30.530.20
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7014 45 197 3.30.530.20
af_B6U7Y1_211_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6995 48 162 3.30.530.20
af_P75822_323_463_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.6985 45 187 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V7KQY5-F1-model_v4 SRPBCC family protein 0.9771 1 205
AF-A0A3N5NZQ9-F1-model_v4 SRPBCC family protein 0.953 19 207
AF-A0A1C9WQ50-F1-model_v4 SRPBCC family protein 0.947 17 213
AF-A0A315X949-F1-model_v4 SRPBCC family protein 0.9426 3 213 GO:0016020
AF-A0A2C9SPP0-F1-model_v4 SRPBCC family protein 0.9294 8 203

Map