F364337

General Info

Members Datasets Scaffolds Average Seq Length
253 127 506 109

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0005082|Ga0495656_0005082_2544_2903
Length 119
Sequence MDADRIRRWTVLARATTTIAVLRGATTDAYGDEQDTDTAVAAGIPASLTEQSRRVTTRDDPTPRIVRYAVARVTAGTDIRDQDRVRDERTGSVYIVDAVSSMANPTAAADLRLDLRRTT

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
10 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
11 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
12 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
13 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
14 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
15 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
16 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
17 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
18 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
19 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
20 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
21 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
22 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
23 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
24 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
25 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
26 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
27 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
28 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
29 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
30 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
31 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
32 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
33 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
34 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
35 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
36 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
37 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
38 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
39 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
40 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
41 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
42 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
43 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
44 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
45 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
46 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
47 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
48 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
49 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
50 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
51 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
52 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
53 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
54 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
59 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
60 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
61 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
70 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
75 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
76 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
77 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
78 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
81 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
82 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
83 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
86 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
122 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
125 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
126 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
127 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 0
Rhizoplane 6.72
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 2.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0005082 3300046615 Bacteria 4535
2 rootL2_10011377 3300003322 Bacteria 10750
3 rootL2_10030372 3300003322 Bacteria 4641
4 Ga0065707_10084858 3300005295 Bacteria 6707
5 Ga0070680_100005324 3300005336 Bacteria 9734
6 Ga0070680_100072676 3300005336 Bacteria 2827
7 Ga0070692_11089677 3300005345 Unclassified 563
8 Ga0070707_100805647 3300005468 Bacteria 903
9 Ga0068856_101153576 3300005614 Bacteria 792
10 Ga0105251_10041880 3300009011 Bacteria 2226
11 Ga0111539_11011658 3300009094 Bacteria 966
12 Ga0207713_1030406 3300025735 Bacteria 2405
13 Ga0207707_11189606 3300025912 Bacteria 617
14 Ga0207660_10087980 3300025917 Viruses 2296
15 Ga0207660_11319778 3300025917 Bacteria 586
16 Ga0207667_12142396 3300025949 Bacteria 517
17 Ga0207702_10973406 3300026078 Bacteria 841
18 Ga0207698_11007985 3300026142 Bacteria 844
19 Ga0307513_10620743 3300031456 Bacteria 789
20 Ga0307408_100093843 3300031548 Bacteria 2271
21 Ga0307405_10109417 3300031731 Bacteria 1869
22 Ga0307405_11025495 3300031731 Bacteria 705
23 Ga0307406_10001969 3300031901 Bacteria 11212
24 Ga0307406_10063653 3300031901 Bacteria 2390
25 Ga0307406_11207797 3300031901 Bacteria 657
26 Ga0307412_10002411 3300031911 Bacteria 10389
27 Ga0307412_10098879 3300031911 Bacteria 2058
28 Ga0307412_10180148 3300031911 Bacteria 1588
29 Ga0307412_11659294 3300031911 Bacteria 585
30 Ga0307416_100039753 3300032002 Bacteria 3646
31 Ga0307416_100540030 3300032002 Bacteria 1237
32 Ga0395899_0487996 3300037312 Bacteria 801
33 Ga0395900_0000279 3300037418 Bacteria 77066
34 Ga0395900_0015819 3300037418 Bacteria 7689
35 Ga0395900_0061193 3300037418 Bacteria 3872
36 Ga0395898_0000586 3300037466 Bacteria 67669
37 Ga0395898_0001732 3300037466 Bacteria 28854
38 Ga0395905_0000670 3300037471 Bacteria 45512
39 Ga0395901_0000245 3300038443 Bacteria 67642
40 Ga0395901_0000304 3300038443 Bacteria 60378
41 Ga0395901_1319105 3300038443 Unclassified 683
42 Ga0439436_0000656 3300041404 Bacteria 9218
43 Ga0439436_0045263 3300041404 Bacteria 1252
44 Ga0439436_0047075 3300041404 Bacteria 1224
45 Ga0439438_086849 3300041405 Bacteria 764
46 Ga0439439_0004961 3300041406 Bacteria 3021
47 Ga0439439_0033961 3300041406 Bacteria 1307
48 Ga0439439_0046371 3300041406 Bacteria 1134
49 Ga0451797_0878582 3300041453 Bacteria 666
50 Ga0451853_2133718 3300041512 Bacteria 2449
51 Ga0451853_2544266 3300041512 Bacteria 2900
52 Ga0451853_3920518 3300041512 Bacteria 2543
53 Ga0439433_0002181 3300041999 Bacteria 4127
54 Ga0439433_0053934 3300041999 Bacteria 950
55 Ga0439442_002899 3300042002 Bacteria 3379
56 Ga0439448_0113920 3300042005 Bacteria 925
57 Ga0439449_0013084 3300042007 Bacteria 3121
58 Ga0439449_0252895 3300042007 Bacteria 662
59 Ga0439455_0012890 3300042012 Bacteria 1884
60 Ga0439455_0057309 3300042012 Bacteria 1027
61 Ga0439457_000846 3300042014 Bacteria 9198
62 Ga0439457_042643 3300042014 Bacteria 1011
63 Ga0439462_0013951 3300042015 Bacteria 2062
64 Ga0439462_0019343 3300042015 Bacteria 1772
65 Ga0450911_001372 3300042115 Bacteria 5696
66 Ga0450911_003248 3300042115 Bacteria 2916
67 Ga0450897_000014 3300042128 Bacteria 9627
68 Ga0450897_000932 3300042128 Bacteria 1833
69 Ga0450897_014191 3300042128 Bacteria 802
70 Ga0450894_000191 3300042131 Bacteria 11057
71 Ga0450894_000375 3300042131 Bacteria 7766
72 Ga0450894_000619 3300042131 Bacteria 5981
73 Ga0450894_000918 3300042131 Bacteria 4653
74 Ga0450894_002641 3300042131 Bacteria 2385
75 Ga0450894_008677 3300042131 Bacteria 1316
76 Ga0450895_000003 3300042132 Bacteria 15207
77 Ga0450895_000006 3300042132 Bacteria 13430
78 Ga0450895_005271 3300042132 Bacteria 1039
79 Ga0450896_000022 3300042133 Bacteria 8551
80 Ga0450896_011816 3300042133 Bacteria 1231
81 Ga0450898_000058 3300042134 Bacteria 9472
82 Ga0450898_000836 3300042134 Bacteria 3828
83 Ga0450898_001939 3300042134 Bacteria 2818
84 Ga0450899_000072 3300042135 Bacteria 8354
85 Ga0450899_000241 3300042135 Bacteria 5838
86 Ga0450899_000271 3300042135 Bacteria 5591
87 Ga0450899_000535 3300042135 Bacteria 4313
88 Ga0450903_031589 3300042138 Bacteria 798
89 Ga0450906_000199 3300042145 Bacteria 11369
90 Ga0450906_002529 3300042145 Bacteria 3995
91 Ga0450906_003302 3300042145 Bacteria 3483
92 Ga0450906_004311 3300042145 Bacteria 2984
93 Ga0450906_025265 3300042145 Bacteria 1055
94 Ga0450907_000022 3300042146 Bacteria 73469
95 Ga0450907_001136 3300042146 Bacteria 6048
96 Ga0450907_005470 3300042146 Bacteria 2140
97 Ga0450910_000064 3300042147 Bacteria 11006
98 Ga0450910_000700 3300042147 Bacteria 4021
99 Ga0439458_0000216 3300042157 Bacteria 13570
100 Ga0439458_0000474 3300042157 Bacteria 10268
101 Ga0439458_0004577 3300042157 Bacteria 3164
102 Ga0450908_000238 3300042184 Bacteria 11037
103 Ga0450908_028619 3300042184 Bacteria 970
104 Ga0450908_053719 3300042184 Bacteria 702
105 Ga0450909_000081 3300042185 Bacteria 8813
106 Ga0450909_000135 3300042185 Bacteria 7681
107 Ga0450918_048262 3300042531 Bacteria 772
108 Ga0450893_0026748 3300042532 Bacteria 1015
109 Ga0450893_0047057 3300042532 Bacteria 801
110 Ga0466967_0837534 3300045976 Bacteria 914
111 Ga0495603_0000120 3300046455 Bacteria 38417
112 Ga0495603_0007226 3300046455 Bacteria 6666
113 Ga0495603_0035914 3300046455 Bacteria 2975
114 Ga0495629_0003090 3300046459 Bacteria 12631
115 Ga0495582_0204539 3300046473 Bacteria 1128
116 Ga0495605_0000478 3300046474 Bacteria 35149
117 Ga0495605_0333747 3300046474 Bacteria 638
118 Ga0495639_0000026 3300046475 Bacteria 68642
119 Ga0495639_0000080 3300046475 Bacteria 45233
120 Ga0495639_0000266 3300046475 Bacteria 25874
121 Ga0495662_0000012 3300046476 Bacteria 66974
122 Ga0495662_0002139 3300046476 Bacteria 9912
123 Ga0495662_0141302 3300046476 Bacteria 1185
124 Ga0495662_0262910 3300046476 Bacteria 849
125 Ga0495662_0332466 3300046476 Bacteria 747
126 Ga0495585_0003706 3300046492 Bacteria 10213
127 Ga0495585_0026160 3300046492 Bacteria 3334
128 Ga0495585_0434687 3300046492 Bacteria 629
129 Ga0495594_0000026 3300046499 Bacteria 68304
130 Ga0495594_0004143 3300046499 Bacteria 7445
131 Ga0495594_0011183 3300046499 Bacteria 4660
132 Ga0495594_0018887 3300046499 Viruses 3658
133 Ga0495594_0032828 3300046499 Bacteria 2819
134 Ga0495594_0054064 3300046499 Bacteria 2213
135 Ga0495594_0278258 3300046499 Viruses 953
136 Ga0495594_0290567 3300046499 Bacteria 931
137 Ga0495607_0084549 3300046501 Bacteria 1735
138 Ga0495583_0002848 3300046506 Bacteria 14085
139 Ga0495583_0012518 3300046506 Bacteria 4791
140 Ga0495583_0047545 3300046506 Bacteria 1972
141 Ga0495610_0041048 3300046512 Bacteria 2326
142 Ga0495631_0164318 3300046518 Bacteria 952
143 Ga0495643_0003812 3300046522 Bacteria 10885
144 Ga0495666_0568557 3300046526 Bacteria 505
145 Ga0495642_0048634 3300046528 Bacteria 1740
146 Ga0495640_0133301 3300046533 Bacteria 1606
147 Ga0495586_0000054 3300046535 Bacteria 68112
148 Ga0495587_0098125 3300046536 Bacteria 1689
149 Ga0495587_0309551 3300046536 Unclassified 883
150 Ga0495645_0320304 3300046543 Bacteria 1007
151 Ga0495622_0000315 3300046557 Bacteria 35856
152 Ga0495622_0000709 3300046557 Bacteria 18862
153 Ga0495622_0001646 3300046557 Bacteria 11034
154 Ga0495622_0001898 3300046557 Bacteria 10278
155 Ga0495622_0154367 3300046557 Bacteria 1037
156 Ga0495656_0000717 3300046615 Bacteria 10703
157 Ga0495668_0003032 3300046616 Bacteria 13074
158 Ga0495668_0613119 3300046616 Bacteria 601
159 Ga0495634_0035129 3300046642 Bacteria 3435
160 Ga0495634_0070744 3300046642 Bacteria 2299
161 Ga0495634_0076002 3300046642 Bacteria 2205
162 Ga0495611_0057616 3300046648 Bacteria 1761
163 Ga0495611_0067015 3300046648 Bacteria 1638
164 Ga0495625_0004352 3300046660 Bacteria 13454
165 Ga0495625_0020671 3300046660 Bacteria 5075
166 Ga0495625_0050479 3300046660 Bacteria 2985
167 Ga0495635_0001194 3300046663 Bacteria 17292
168 Ga0495659_0014993 3300046664 Bacteria 2544
169 Ga0495588_0271758 3300046674 Bacteria 893
170 Ga0495657_0015817 3300046675 Bacteria 5510
171 Ga0495657_0049502 3300046675 Bacteria 2830
172 Ga0495657_0084536 3300046675 Bacteria 2047
173 Ga0495658_0003179 3300046683 Bacteria 8180
174 Ga0495669_0148208 3300046684 Bacteria 1110
175 Ga0495613_0000140 3300046689 Bacteria 72331
176 Ga0495613_0012046 3300046689 Bacteria 6426
177 Ga0495613_0155762 3300046689 Bacteria 1628
178 Ga0495613_0588266 3300046689 Unclassified 741
179 Ga0495649_0000102 3300046694 Bacteria 75118
180 Ga0495589_0008496 3300046794 Bacteria 5357
181 Ga0495589_0331019 3300046794 Bacteria 703
182 Ga0495600_0006018 3300046809 Bacteria 7341
183 Ga0495600_0006729 3300046809 Bacteria 7006
184 Ga0495600_0051665 3300046809 Bacteria 2683
185 Ga0495600_0054983 3300046809 Bacteria 2600
186 Ga0495600_0183154 3300046809 Bacteria 1349
187 Ga0495660_0000989 3300046810 Bacteria 20765
188 Ga0495581_0000071 3300047315 Bacteria 40218
189 Ga0495581_0000080 3300047315 Bacteria 38435
190 Ga0495581_0005372 3300047315 Bacteria 7414
191 Ga0495581_0340253 3300047315 Bacteria 876
192 Ga0495581_0419269 3300047315 Unclassified 780
193 Ga0495604_0346087 3300047317 Bacteria 989
194 Ga0495604_0681679 3300047317 Unclassified 654
195 Ga0495636_0001316 3300047318 Bacteria 9427
196 Ga0495636_0166155 3300047318 Bacteria 996
197 Ga0495676_0002030 3300047321 Bacteria 17805
198 Ga0495676_0013635 3300047321 Bacteria 7296
199 Ga0495683_0104065 3300047323 Bacteria 1362
200 Ga0495683_0174554 3300047323 Bacteria 986
201 Ga0495687_000908 3300047443 Bacteria 30933
202 Ga0495687_005562 3300047443 Bacteria 7988
203 Ga0495687_005651 3300047443 Bacteria 7898
204 Ga0495687_011416 3300047443 Bacteria 4781
205 Ga0495687_021544 3300047443 Bacteria 3115
206 Ga0495687_181848 3300047443 Bacteria 685
207 Ga0495677_0003162 3300047445 Bacteria 6420
208 Ga0495677_0007240 3300047445 Bacteria 4151
209 Ga0495677_0142249 3300047445 Bacteria 921
210 Ga0495685_000094 3300047447 Bacteria 32174
211 Ga0495685_002578 3300047447 Bacteria 5703
212 Ga0495685_004337 3300047447 Bacteria 4573
213 Ga0495685_008284 3300047447 Viruses 3447
214 Ga0495685_011994 3300047447 Bacteria 2931
215 Ga0495685_013197 3300047447 Bacteria 2803
216 Ga0495685_128814 3300047447 Bacteria 828
217 Ga0495681_0016215 3300047470 Bacteria 4189
218 Ga0495681_0032761 3300047470 Bacteria 2612
219 Ga0495686_0000343 3300047472 Bacteria 76639
220 Ga0495686_0221232 3300047472 Bacteria 1077
221 Ga0495614_0024694 3300048089 Viruses 2594
222 Ga0495614_0029366 3300048089 Bacteria 2366
223 Ga0495614_0399651 3300048089 Bacteria 645
224 Ga0496100_0000044 3300048903 Bacteria 79684
225 Ga0496100_0007060 3300048903 Bacteria 6163
226 Ga0496100_0057332 3300048903 Bacteria 2551
227 Ga0496101_0001756 3300048904 Bacteria 12998
228 Ga0496101_0083040 3300048904 Bacteria 2371
229 Ga0496104_0447737 3300048907 Bacteria 1203
230 Ga0496105_0000074 3300048908 Bacteria 75488
231 Ga0496106_0066560 3300048909 Bacteria 2744
232 Ga0496107_0000021 3300048910 Bacteria 135339
233 Ga0496107_0127358 3300048910 Bacteria 1878
234 Ga0496108_0000800 3300048911 Bacteria 24536
235 Ga0496109_0007133 3300048912 Bacteria 9441
236 Ga0496110_0098527 3300048913 Bacteria 2620
237 Ga0496111_0247945 3300048914 Bacteria 1322
238 Ga0496113_0828420 3300048916 Bacteria 734
239 Ga0496115_0664185 3300048918 Bacteria 823
240 Ga0501290_035537 3300049513 Bacteria 729
241 Ga0501038_0002031 3300049574 Bacteria 18714
242 Ga0501043_0208092 3300049579 Bacteria 1516
243 Ga0501073_0182211 3300049589 Bacteria 1453
244 Ga0501227_000012 3300049665 Bacteria 30656
245 Ga0501044_0013373 3300049823 Bacteria 8875
246 nmdc:mga08y16_1544797_c1 3300050511 Unclassified 623
247 Ga0500553_111512 3300053101 Bacteria 1150
248 Ga0500621_031995 3300053126 Bacteria 2093
249 Ga0500652_080577 3300053131 Bacteria 1355
250 Ga0500658_0023044 3300053134 Bacteria 2374
251 Ga0500559_0088140 3300053136 Bacteria 1418
252 Ga0500603_035388 3300053150 Bacteria 1309
253 2954674093 2954673503 Bacteria 9685905
254 Ga0495656_0005082
255 rootL2_10011377
256 rootL2_10030372
257 Ga0065707_10084858
258 Ga0070680_100005324
259 Ga0070680_100072676
260 Ga0070692_11089677
261 Ga0070707_100805647
262 Ga0068856_101153576
263 Ga0105251_10041880
264 Ga0111539_11011658
265 Ga0207713_1030406
266 Ga0207707_11189606
267 Ga0207660_10087980
268 Ga0207660_11319778
269 Ga0207667_12142396
270 Ga0207702_10973406
271 Ga0207698_11007985
272 Ga0307513_10620743
273 Ga0307408_100093843
274 Ga0307405_10109417
275 Ga0307405_11025495
276 Ga0307406_10001969
277 Ga0307406_10063653
278 Ga0307406_11207797
279 Ga0307412_10002411
280 Ga0307412_10098879
281 Ga0307412_10180148
282 Ga0307412_11659294
283 Ga0307416_100039753
284 Ga0307416_100540030
285 Ga0395899_0487996
286 Ga0395900_0000279
287 Ga0395900_0015819
288 Ga0395900_0061193
289 Ga0395898_0000586
290 Ga0395898_0001732
291 Ga0395905_0000670
292 Ga0395901_0000245
293 Ga0395901_0000304
294 Ga0395901_1319105
295 Ga0439436_0000656
296 Ga0439436_0045263
297 Ga0439436_0047075
298 Ga0439438_086849
299 Ga0439439_0004961
300 Ga0439439_0033961
301 Ga0439439_0046371
302 Ga0451797_0878582
303 Ga0451853_2133718
304 Ga0451853_2544266
305 Ga0451853_3920518
306 Ga0439433_0002181
307 Ga0439433_0053934
308 Ga0439442_002899
309 Ga0439448_0113920
310 Ga0439449_0013084
311 Ga0439449_0252895
312 Ga0439455_0012890
313 Ga0439455_0057309
314 Ga0439457_000846
315 Ga0439457_042643
316 Ga0439462_0013951
317 Ga0439462_0019343
318 Ga0450911_001372
319 Ga0450911_003248
320 Ga0450897_000014
321 Ga0450897_000932
322 Ga0450897_014191
323 Ga0450894_000191
324 Ga0450894_000375
325 Ga0450894_000619
326 Ga0450894_000918
327 Ga0450894_002641
328 Ga0450894_008677
329 Ga0450895_000003
330 Ga0450895_000006
331 Ga0450895_005271
332 Ga0450896_000022
333 Ga0450896_011816
334 Ga0450898_000058
335 Ga0450898_000836
336 Ga0450898_001939
337 Ga0450899_000072
338 Ga0450899_000241
339 Ga0450899_000271
340 Ga0450899_000535
341 Ga0450903_031589
342 Ga0450906_000199
343 Ga0450906_002529
344 Ga0450906_003302
345 Ga0450906_004311
346 Ga0450906_025265
347 Ga0450907_000022
348 Ga0450907_001136
349 Ga0450907_005470
350 Ga0450910_000064
351 Ga0450910_000700
352 Ga0439458_0000216
353 Ga0439458_0000474
354 Ga0439458_0004577
355 Ga0450908_000238
356 Ga0450908_028619
357 Ga0450908_053719
358 Ga0450909_000081
359 Ga0450909_000135
360 Ga0450918_048262
361 Ga0450893_0026748
362 Ga0450893_0047057
363 Ga0466967_0837534
364 Ga0495603_0000120
365 Ga0495603_0007226
366 Ga0495603_0035914
367 Ga0495629_0003090
368 Ga0495582_0204539
369 Ga0495605_0000478
370 Ga0495605_0333747
371 Ga0495639_0000026
372 Ga0495639_0000080
373 Ga0495639_0000266
374 Ga0495662_0000012
375 Ga0495662_0002139
376 Ga0495662_0141302
377 Ga0495662_0262910
378 Ga0495662_0332466
379 Ga0495585_0003706
380 Ga0495585_0026160
381 Ga0495585_0434687
382 Ga0495594_0000026
383 Ga0495594_0004143
384 Ga0495594_0011183
385 Ga0495594_0018887
386 Ga0495594_0032828
387 Ga0495594_0054064
388 Ga0495594_0278258
389 Ga0495594_0290567
390 Ga0495607_0084549
391 Ga0495583_0002848
392 Ga0495583_0012518
393 Ga0495583_0047545
394 Ga0495610_0041048
395 Ga0495631_0164318
396 Ga0495643_0003812
397 Ga0495666_0568557
398 Ga0495642_0048634
399 Ga0495640_0133301
400 Ga0495586_0000054
401 Ga0495587_0098125
402 Ga0495587_0309551
403 Ga0495645_0320304
404 Ga0495622_0000315
405 Ga0495622_0000709
406 Ga0495622_0001646
407 Ga0495622_0001898
408 Ga0495622_0154367
409 Ga0495656_0000717
410 Ga0495668_0003032
411 Ga0495668_0613119
412 Ga0495634_0035129
413 Ga0495634_0070744
414 Ga0495634_0076002
415 Ga0495611_0057616
416 Ga0495611_0067015
417 Ga0495625_0004352
418 Ga0495625_0020671
419 Ga0495625_0050479
420 Ga0495635_0001194
421 Ga0495659_0014993
422 Ga0495588_0271758
423 Ga0495657_0015817
424 Ga0495657_0049502
425 Ga0495657_0084536
426 Ga0495658_0003179
427 Ga0495669_0148208
428 Ga0495613_0000140
429 Ga0495613_0012046
430 Ga0495613_0155762
431 Ga0495613_0588266
432 Ga0495649_0000102
433 Ga0495589_0008496
434 Ga0495589_0331019
435 Ga0495600_0006018
436 Ga0495600_0006729
437 Ga0495600_0051665
438 Ga0495600_0054983
439 Ga0495600_0183154
440 Ga0495660_0000989
441 Ga0495581_0000071
442 Ga0495581_0000080
443 Ga0495581_0005372
444 Ga0495581_0340253
445 Ga0495581_0419269
446 Ga0495604_0346087
447 Ga0495604_0681679
448 Ga0495636_0001316
449 Ga0495636_0166155
450 Ga0495676_0002030
451 Ga0495676_0013635
452 Ga0495683_0104065
453 Ga0495683_0174554
454 Ga0495687_000908
455 Ga0495687_005562
456 Ga0495687_005651
457 Ga0495687_011416
458 Ga0495687_021544
459 Ga0495687_181848
460 Ga0495677_0003162
461 Ga0495677_0007240
462 Ga0495677_0142249
463 Ga0495685_000094
464 Ga0495685_002578
465 Ga0495685_004337
466 Ga0495685_008284
467 Ga0495685_011994
468 Ga0495685_013197
469 Ga0495685_128814
470 Ga0495681_0016215
471 Ga0495681_0032761
472 Ga0495686_0000343
473 Ga0495686_0221232
474 Ga0495614_0024694
475 Ga0495614_0029366
476 Ga0495614_0399651
477 Ga0496100_0000044
478 Ga0496100_0007060
479 Ga0496100_0057332
480 Ga0496101_0001756
481 Ga0496101_0083040
482 Ga0496104_0447737
483 Ga0496105_0000074
484 Ga0496106_0066560
485 Ga0496107_0000021
486 Ga0496107_0127358
487 Ga0496108_0000800
488 Ga0496109_0007133
489 Ga0496110_0098527
490 Ga0496111_0247945
491 Ga0496113_0828420
492 Ga0496115_0664185
493 Ga0501290_035537
494 Ga0501038_0002031
495 Ga0501043_0208092
496 Ga0501073_0182211
497 Ga0501227_000012
498 Ga0501044_0013373
499 nmdc:mga08y16_1544797_c1
500 Ga0500553_111512
501 Ga0500621_031995
502 Ga0500652_080577
503 Ga0500658_0023044
504 Ga0500559_0088140
505 Ga0500603_035388
506 2954674093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qzz-assembly1.cif.gz_A crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex with s-adenosyl-l-methionine (sam) 0.72 84 109
2wvd-assembly2.cif.gz_B structural and mechanistic insights into helicobacter pylori nikr function 0.7104 84 109
7dl8-assembly1.cif.gz_C crystal structure of alba1 from trypanosoma brucei 0.6802 84 109
7dl8-assembly1.cif.gz_D crystal structure of alba1 from trypanosoma brucei 0.6689 84 109
6xyb-assembly1.cif.gz_D crystal structure of q4d6q6, a conserved kinetoplastid-specific protein from trypanosoma cruzi 0.6636 84 106
ID Description Score Start End Superfamily
af_Q86WA8_6_128_2.30.130.40 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;LON domain-like 0.7976 77 107 2.30.130.40
af_Q9SJM1_111_185_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.789 84 106 3.30.70.260
af_O80644_110_174_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7588 84 108 3.30.70.260
af_I1N552_108_193_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7586 84 106 3.30.70.260
af_I1N552_1_226_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7335 84 105 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7T7L2E5-F1-model_v4 Uncharacterized protein 0.9406 1 109
AF-A0A7T7L2E5-F1-model_v4 Uncharacterized protein 0.9324 1 109
AF-A0A6N9VGZ1-F1-model_v4 Head-to-tail stopper 0.9044 1 109
AF-A0A1V2KZA2-F1-model_v4 Head-tail adaptor protein 0.8943 5 109
AF-A0A497RIB4-F1-model_v4 Peptidoglycan binding-like domain-containing protein 0.8924 57 105

Map