F364291

General Info

Members Datasets Scaffolds Average Seq Length
253 153 506 293

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0054608|Ga0466964_0054608_631_1572
Length 313
Sequence VTWQFILAGLFVGSLVGLTGMGGGSLMTPILILLLGFSPTVAIGTDIAHGAIFKTVGAIRHRRLGNVSARLSAWMFLGSAPASVFGVWLSTSLAHRYGDSINSISAQVLGGALIFGSVGVAVKTFVRPKKTADAPFVLTRRDRVAAVLIGVVGGVVVGLTSVGTGVFFGLSLLVLFPLRARKVLGTDIFHAAALLYVAGFGHFIAGNVDMGAVGWLLVGSIPGILIGSQLSVSVPDRPLRGALASVLGLSGLALLKVPGTTTVIVVALACGTTVLLTYIARKNWIDRRARNRSRRPLQADANPSRALEITRLA

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
85 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
91 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
132 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
150 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.81
Rhizosphere 84.19
Stem 0
Stem Tuber 0
Unclassified 8.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0054608 3300044706 Unclassified 1647
2 Ga0070670_100000896 3300005331 Bacteria 23474
3 Ga0070670_100018474 3300005331 Bacteria 5981
4 Ga0070666_10264681 3300005335 Unclassified 1219
5 Ga0070661_100306298 3300005344 Bacteria 1238
6 Ga0070675_100055176 3300005354 Bacteria 3270
7 Ga0070671_100038251 3300005355 Bacteria 3982
8 Ga0070674_100002894 3300005356 Bacteria 9504
9 Ga0070673_100016939 3300005364 Bacteria 5168
10 Ga0070688_100018103 3300005365 Bacteria 4058
11 Ga0070659_100153774 3300005366 Unclassified 1878
12 Ga0070714_100119815 3300005435 Bacteria 2340
13 Ga0070713_100416032 3300005436 Bacteria 1258
14 Ga0070701_10035337 3300005438 Bacteria 2510
15 Ga0070678_100020637 3300005456 Bacteria 4326
16 Ga0070678_100031438 3300005456 Bacteria 3662
17 Ga0070678_100138755 3300005456 Bacteria 1942
18 Ga0068867_100182436 3300005459 Bacteria 1669
19 Ga0070685_10009942 3300005466 Bacteria 4934
20 Ga0070699_100052597 3300005518 Bacteria 3523
21 Ga0070699_100095944 3300005518 Bacteria 2597
22 Ga0070684_100159684 3300005535 Bacteria 2044
23 Ga0070704_100355664 3300005549 Bacteria 1238
24 Ga0068857_100125174 3300005577 Bacteria 2316
25 Ga0068856_100177654 3300005614 Bacteria 2141
26 Ga0070702_100044471 3300005615 Bacteria 2507
27 Ga0068864_100009029 3300005618 Bacteria 8217
28 Ga0068870_10001466 3300005840 Bacteria 9551
29 Ga0068870_10026431 3300005840 Bacteria 2893
30 Ga0081455_10007749 3300005937 Bacteria 11259
31 Ga0081455_10027919 3300005937 Bacteria 5163
32 Ga0081455_10035495 3300005937 Bacteria 4454
33 Ga0081455_10045940 3300005937 Bacteria 3795
34 Ga0081539_10004040 3300005985 Bacteria 16822
35 Ga0070712_100019238 3300006175 Bacteria 4450
36 Ga0068871_100244315 3300006358 Bacteria 1562
37 Ga0075428_100003443 3300006844 Bacteria 17316
38 Ga0075428_100006409 3300006844 Bacteria 13094
39 Ga0075428_100159161 3300006844 Bacteria 2451
40 Ga0075431_100091681 3300006847 Bacteria 3136
41 Ga0075431_100366488 3300006847 Bacteria 1446
42 Ga0075433_10590236 3300006852 Unclassified 975
43 Ga0075434_100060849 3300006871 Bacteria 3757
44 Ga0075434_100370808 3300006871 Unclassified 1452
45 Ga0068865_100074230 3300006881 Bacteria 2421
46 Ga0111539_10362900 3300009094 Unclassified 1686
47 Ga0111539_10876944 3300009094 Unclassified 1044
48 Ga0105245_10009318 3300009098 Bacteria 8562
49 Ga0105245_10135753 3300009098 Bacteria 2312
50 Ga0105245_10294985 3300009098 Bacteria 1589
51 Ga0105245_10397707 3300009098 Bacteria 1376
52 Ga0114129_10001817 3300009147 Bacteria 29087
53 Ga0114129_10032539 3300009147 Bacteria 7370
54 Ga0114129_10123159 3300009147 Bacteria 3567
55 Ga0114129_10196446 3300009147 Bacteria 2735
56 Ga0105243_10026582 3300009148 Bacteria 4431
57 Ga0105243_10495857 3300009148 Archaea 1156
58 Ga0105248_10529621 3300009177 Bacteria 1329
59 Ga0105249_10327290 3300009553 Bacteria 1545
60 Ga0105239_10105764 3300010375 Bacteria 3117
61 Ga0105239_10223701 3300010375 Bacteria 2111
62 Ga0163162_10299341 3300013306 Bacteria 1740
63 Ga0163163_10006134 3300014325 Bacteria 10472
64 Ga0157380_10022817 3300014326 Bacteria 4719
65 Ga0157377_10237174 3300014745 Bacteria 1176
66 Ga0157376_10246208 3300014969 Bacteria 1668
67 Ga0207688_10001529 3300025901 Bacteria 12148
68 Ga0207680_10211241 3300025903 Bacteria 1327
69 Ga0207685_10157677 3300025905 Bacteria 1033
70 Ga0207645_10173029 3300025907 Bacteria 1416
71 Ga0207643_10002405 3300025908 Bacteria 10132
72 Ga0207643_10040593 3300025908 Bacteria 2621
73 Ga0207684_10337606 3300025910 Bacteria 1298
74 Ga0207693_10023761 3300025915 Bacteria 4865
75 Ga0207649_10302498 3300025920 Bacteria 1170
76 Ga0207650_10053744 3300025925 Bacteria 2986
77 Ga0207687_10147841 3300025927 Bacteria 1789
78 Ga0207687_10213718 3300025927 Bacteria 1514
79 Ga0207644_10042986 3300025931 Bacteria 3205
80 Ga0207690_10078260 3300025932 Unclassified 2301
81 Ga0207686_10236246 3300025934 Bacteria 1328
82 Ga0207709_10037048 3300025935 Bacteria 2896
83 Ga0207709_10225059 3300025935 Bacteria 1355
84 Ga0207709_10283659 3300025935 Archaea 1224
85 Ga0207704_10353949 3300025938 Bacteria 1144
86 Ga0207708_10002418 3300026075 Bacteria 13708
87 Ga0207702_10028808 3300026078 Bacteria 4619
88 Ga0207648_10103339 3300026089 Bacteria 2498
89 Ga0207674_10020839 3300026116 Bacteria 7076
90 Ga0207683_10002847 3300026121 Bacteria 15094
91 Ga0207683_10137593 3300026121 Bacteria 2199
92 Ga0207698_10399816 3300026142 Bacteria 1313
93 Ga0207428_10007271 3300027907 Bacteria 10124
94 Ga0207428_10210460 3300027907 Bacteria 1461
95 Ga0265337_1021194 3300028556 Bacteria 2029
96 Ga0265338_10045575 3300028800 Bacteria 4029
97 Ga0265325_10067720 3300031241 Bacteria 1798
98 Ga0265339_10011677 3300031249 Bacteria 5395
99 Ga0265331_10099276 3300031250 Bacteria 1341
100 Ga0265314_10005691 3300031711 Bacteria 11186
101 Ga0373931_0215879 3300035691 Unclassified 1153
102 Ga0395899_0003587 3300037312 Bacteria 12284
103 Ga0395900_0236310 3300037418 Bacteria 1835
104 Ga0395898_0049530 3300037466 Bacteria 4116
105 Ga0395898_0060840 3300037466 Bacteria 3669
106 Ga0395898_0185893 3300037466 Bacteria 1985
107 Ga0395905_0014592 3300037471 Bacteria 7494
108 Ga0395905_0270390 3300037471 Bacteria 1585
109 Ga0395901_0029110 3300038443 Bacteria 5684
110 Ga0395901_0073891 3300038443 Bacteria 3556
111 Ga0395901_0076906 3300038443 Bacteria 3483
112 Ga0450920_007428 3300042122 Bacteria 1987
113 Ga0466964_0007241 3300044706 Bacteria 4147
114 Ga0466968_0001804 3300044735 Bacteria 7728
115 Ga0466967_0005837 3300045976 Bacteria 8613
116 Ga0466967_0043833 3300045976 Bacteria 3876
117 Ga0466967_0826886 3300045976 Unclassified 920
118 Ga0495651_0141590 3300046462 Bacteria 1743
119 Ga0495651_0148538 3300046462 Bacteria 1692
120 Ga0495653_0078428 3300046463 Bacteria 2449
121 Ga0495664_0055458 3300046477 Bacteria 2358
122 Ga0495608_0154808 3300046511 Bacteria 1459
123 Ga0495628_0251794 3300046516 Unclassified 1318
124 Ga0495630_0477951 3300046517 Bacteria 955
125 Ga0495652_0166120 3300046529 Bacteria 1708
126 Ga0495587_0013237 3300046536 Bacteria 5186
127 Ga0495645_0093230 3300046543 Bacteria 2149
128 Ga0495667_0036835 3300046559 Bacteria 3262
129 Ga0495667_0296008 3300046559 Bacteria 1026
130 Ga0495656_0180130 3300046615 Bacteria 1038
131 Ga0495600_0047053 3300046809 Bacteria 2814
132 Ga0495660_0189491 3300046810 Unclassified 989
133 Ga0495581_0243461 3300047315 Bacteria 1052
134 Ga0495674_0052775 3300047319 Bacteria 3576
135 Ga0495674_0129772 3300047319 Bacteria 2124
136 Ga0495683_0166488 3300047323 Bacteria 1016
137 Ga0495684_0041444 3300047471 Bacteria 3529
138 Ga0496100_0088697 3300048903 Bacteria 2106
139 Ga0496100_0148487 3300048903 Bacteria 1669
140 Ga0496101_0005040 3300048904 Bacteria 8398
141 Ga0496101_0038383 3300048904 Bacteria 3402
142 Ga0496101_0209951 3300048904 Bacteria 1508
143 Ga0496102_0210073 3300048905 Bacteria 1835
144 Ga0496102_0263576 3300048905 Bacteria 1625
145 Ga0496103_0025137 3300048906 Bacteria 3598
146 Ga0496104_0000467 3300048907 Bacteria 34852
147 Ga0496104_0010563 3300048907 Bacteria 8246
148 Ga0496104_0029495 3300048907 Bacteria 5090
149 Ga0496104_0125936 3300048907 Bacteria 2460
150 Ga0496105_0000255 3300048908 Bacteria 35883
151 Ga0496105_0007239 3300048908 Bacteria 8570
152 Ga0496106_0135544 3300048909 Unclassified 1934
153 Ga0496107_0017034 3300048910 Bacteria 5109
154 Ga0496108_0001345 3300048911 Bacteria 19324
155 Ga0496108_0025949 3300048911 Bacteria 4832
156 Ga0496109_0000268 3300048912 Bacteria 50359
157 Ga0496109_0003229 3300048912 Bacteria 13575
158 Ga0496109_0027135 3300048912 Bacteria 5111
159 Ga0496109_0081545 3300048912 Bacteria 2981
160 Ga0496109_0114296 3300048912 Bacteria 2511
161 Ga0496110_0000642 3300048913 Bacteria 23961
162 Ga0496110_0003392 3300048913 Bacteria 12176
163 Ga0496110_0036496 3300048913 Bacteria 4268
164 Ga0496111_0000034 3300048914 Bacteria 54519
165 Ga0496111_0040124 3300048914 Bacteria 3357
166 Ga0496111_0044327 3300048914 Bacteria 3198
167 Ga0496111_0108921 3300048914 Bacteria 2039
168 Ga0496111_0374251 3300048914 Bacteria 1054
169 Ga0496112_0011759 3300048915 Bacteria 8014
170 Ga0496112_0140354 3300048915 Bacteria 2386
171 Ga0496112_0544967 3300048915 Bacteria 1094
172 Ga0496113_0004635 3300048916 Bacteria 8477
173 Ga0496113_0031089 3300048916 Bacteria 3871
174 Ga0496114_0008934 3300048917 Bacteria 7944
175 Ga0496114_0013480 3300048917 Bacteria 6554
176 Ga0496114_0092845 3300048917 Bacteria 2565
177 Ga0496114_0164998 3300048917 Bacteria 1928
178 Ga0501031_0009880 3300049568 Bacteria 6211
179 Ga0501032_0166100 3300049569 Bacteria 1448
180 Ga0501033_0011314 3300049570 Bacteria 6831
181 Ga0501036_0208270 3300049572 Bacteria 1643
182 Ga0501038_0002835 3300049574 Bacteria 16133
183 Ga0501038_0408840 3300049574 Bacteria 1049
184 Ga0501040_0011589 3300049576 Bacteria 5770
185 Ga0501040_0112205 3300049576 Bacteria 1907
186 Ga0501040_0404385 3300049576 Bacteria 981
187 Ga0501041_0007132 3300049577 Bacteria 6556
188 Ga0501041_0230273 3300049577 Unclassified 1164
189 Ga0501042_0008392 3300049578 Bacteria 6813
190 Ga0501042_0167975 3300049578 Bacteria 1583
191 Ga0501046_0204432 3300049580 Bacteria 1468
192 Ga0501046_0226687 3300049580 Bacteria 1382
193 Ga0501048_0019984 3300049582 Bacteria 4911
194 Ga0501067_0099228 3300049583 Bacteria 1617
195 Ga0501067_0203889 3300049583 Bacteria 1101
196 Ga0501067_0252103 3300049583 Bacteria 982
197 Ga0501068_0034780 3300049584 Bacteria 3006
198 Ga0501069_0082567 3300049585 Bacteria 1811
199 Ga0501070_0034727 3300049586 Bacteria 4215
200 Ga0501071_0048037 3300049587 Bacteria 3067
201 Ga0501071_0319370 3300049587 Unclassified 1179
202 Ga0501071_0427672 3300049587 Unclassified 1012
203 Ga0501072_0011084 3300049588 Bacteria 6879
204 Ga0501072_0044635 3300049588 Bacteria 3485
205 Ga0501072_0144137 3300049588 Bacteria 1899
206 Ga0501074_0007610 3300049590 Bacteria 7840
207 Ga0501074_0085103 3300049590 Bacteria 2266
208 Ga0501075_0056575 3300049591 Bacteria 2952
209 Ga0501075_0305233 3300049591 Bacteria 1213
210 Ga0501076_0090810 3300049592 Bacteria 2456
211 Ga0501076_0187991 3300049592 Unclassified 1685
212 Ga0501077_0003797 3300049593 Bacteria 9094
213 Ga0501077_0011455 3300049593 Bacteria 5539
214 Ga0501077_0062867 3300049593 Bacteria 2355
215 Ga0501077_0094100 3300049593 Bacteria 1899
216 Ga0501077_0220054 3300049593 Bacteria 1207
217 Ga0501079_0004409 3300049741 Bacteria 10422
218 Ga0501079_0030341 3300049741 Bacteria 4153
219 Ga0501079_0037405 3300049741 Bacteria 3741
220 Ga0501079_0130138 3300049741 Bacteria 1958
221 Ga0501079_0219927 3300049741 Unclassified 1484
222 Ga0501080_0016309 3300049742 Bacteria 6858
223 Ga0501080_0137951 3300049742 Bacteria 2256
224 Ga0501081_0001579 3300049743 Bacteria 14051
225 Ga0501083_0142307 3300049744 Bacteria 1570
226 Ga0501083_0328913 3300049744 Bacteria 994
227 Ga0501035_0007148 3300049822 Bacteria 10442
228 Ga0501045_0090301 3300049824 Bacteria 2263
229 nmdc:mga05p37_127298_c1 3300050507 Bacteria 3127
230 nmdc:mga05p37_2481_c1 3300050507 Bacteria 21472
231 nmdc:mga05p37_78738_c1 3300050507 Bacteria 4059
232 nmdc:mga05p37_92511_c1 3300050507 Bacteria 3726
233 nmdc:mga09592_382326_c1 3300050508 Bacteria 1217
234 nmdc:mga09592_7064_c1 3300050508 Bacteria 9124
235 nmdc:mga0qj67_64033_c1 3300050509 Bacteria 2924
236 nmdc:mga08y16_315620_c1 3300050511 Unclassified 1610
237 nmdc:mga0n895_43488_c1 3300050512 Bacteria 4377
238 nmdc:mga0n895_66179_c1 3300050512 Bacteria 3578
239 nmdc:mga0rr50_170054_c1 3300050513 Bacteria 1775
240 nmdc:mga0a205_480551_c1 3300050515 Unclassified 1101
241 Ga0495601_0131471 3300053077 Bacteria 1630
242 Ga0495601_0193421 3300053077 Unclassified 1329
243 Ga0495612_0031900 3300053078 Bacteria 2127
244 Ga0495595_0028985 3300053084 Bacteria 2474
245 Ga0501084_0018862 3300054114 Bacteria 5743
246 Ga0501084_0071002 3300054114 Bacteria 2915
247 Ga0501084_0239364 3300054114 Bacteria 1532
248 Ga0501082_0009071 3300060353 Bacteria 8579
249 Ga0530510_0024772 3300061734 Bacteria 4286
250 Ga0530510_0174165 3300061734 Unclassified 1594
251 Ga0530510_0235932 3300061734 Bacteria 1361
252 Ga0530510_0301818 3300061734 Bacteria 1198
253 Ga0530510_0356319 3300061734 Bacteria 1099
254 Ga0466964_0054608
255 Ga0070670_100000896
256 Ga0070670_100018474
257 Ga0070666_10264681
258 Ga0070661_100306298
259 Ga0070675_100055176
260 Ga0070671_100038251
261 Ga0070674_100002894
262 Ga0070673_100016939
263 Ga0070688_100018103
264 Ga0070659_100153774
265 Ga0070714_100119815
266 Ga0070713_100416032
267 Ga0070701_10035337
268 Ga0070678_100020637
269 Ga0070678_100031438
270 Ga0070678_100138755
271 Ga0068867_100182436
272 Ga0070685_10009942
273 Ga0070699_100052597
274 Ga0070699_100095944
275 Ga0070684_100159684
276 Ga0070704_100355664
277 Ga0068857_100125174
278 Ga0068856_100177654
279 Ga0070702_100044471
280 Ga0068864_100009029
281 Ga0068870_10001466
282 Ga0068870_10026431
283 Ga0081455_10007749
284 Ga0081455_10027919
285 Ga0081455_10035495
286 Ga0081455_10045940
287 Ga0081539_10004040
288 Ga0070712_100019238
289 Ga0068871_100244315
290 Ga0075428_100003443
291 Ga0075428_100006409
292 Ga0075428_100159161
293 Ga0075431_100091681
294 Ga0075431_100366488
295 Ga0075433_10590236
296 Ga0075434_100060849
297 Ga0075434_100370808
298 Ga0068865_100074230
299 Ga0111539_10362900
300 Ga0111539_10876944
301 Ga0105245_10009318
302 Ga0105245_10135753
303 Ga0105245_10294985
304 Ga0105245_10397707
305 Ga0114129_10001817
306 Ga0114129_10032539
307 Ga0114129_10123159
308 Ga0114129_10196446
309 Ga0105243_10026582
310 Ga0105243_10495857
311 Ga0105248_10529621
312 Ga0105249_10327290
313 Ga0105239_10105764
314 Ga0105239_10223701
315 Ga0163162_10299341
316 Ga0163163_10006134
317 Ga0157380_10022817
318 Ga0157377_10237174
319 Ga0157376_10246208
320 Ga0207688_10001529
321 Ga0207680_10211241
322 Ga0207685_10157677
323 Ga0207645_10173029
324 Ga0207643_10002405
325 Ga0207643_10040593
326 Ga0207684_10337606
327 Ga0207693_10023761
328 Ga0207649_10302498
329 Ga0207650_10053744
330 Ga0207687_10147841
331 Ga0207687_10213718
332 Ga0207644_10042986
333 Ga0207690_10078260
334 Ga0207686_10236246
335 Ga0207709_10037048
336 Ga0207709_10225059
337 Ga0207709_10283659
338 Ga0207704_10353949
339 Ga0207708_10002418
340 Ga0207702_10028808
341 Ga0207648_10103339
342 Ga0207674_10020839
343 Ga0207683_10002847
344 Ga0207683_10137593
345 Ga0207698_10399816
346 Ga0207428_10007271
347 Ga0207428_10210460
348 Ga0265337_1021194
349 Ga0265338_10045575
350 Ga0265325_10067720
351 Ga0265339_10011677
352 Ga0265331_10099276
353 Ga0265314_10005691
354 Ga0373931_0215879
355 Ga0395899_0003587
356 Ga0395900_0236310
357 Ga0395898_0049530
358 Ga0395898_0060840
359 Ga0395898_0185893
360 Ga0395905_0014592
361 Ga0395905_0270390
362 Ga0395901_0029110
363 Ga0395901_0073891
364 Ga0395901_0076906
365 Ga0450920_007428
366 Ga0466964_0007241
367 Ga0466968_0001804
368 Ga0466967_0005837
369 Ga0466967_0043833
370 Ga0466967_0826886
371 Ga0495651_0141590
372 Ga0495651_0148538
373 Ga0495653_0078428
374 Ga0495664_0055458
375 Ga0495608_0154808
376 Ga0495628_0251794
377 Ga0495630_0477951
378 Ga0495652_0166120
379 Ga0495587_0013237
380 Ga0495645_0093230
381 Ga0495667_0036835
382 Ga0495667_0296008
383 Ga0495656_0180130
384 Ga0495600_0047053
385 Ga0495660_0189491
386 Ga0495581_0243461
387 Ga0495674_0052775
388 Ga0495674_0129772
389 Ga0495683_0166488
390 Ga0495684_0041444
391 Ga0496100_0088697
392 Ga0496100_0148487
393 Ga0496101_0005040
394 Ga0496101_0038383
395 Ga0496101_0209951
396 Ga0496102_0210073
397 Ga0496102_0263576
398 Ga0496103_0025137
399 Ga0496104_0000467
400 Ga0496104_0010563
401 Ga0496104_0029495
402 Ga0496104_0125936
403 Ga0496105_0000255
404 Ga0496105_0007239
405 Ga0496106_0135544
406 Ga0496107_0017034
407 Ga0496108_0001345
408 Ga0496108_0025949
409 Ga0496109_0000268
410 Ga0496109_0003229
411 Ga0496109_0027135
412 Ga0496109_0081545
413 Ga0496109_0114296
414 Ga0496110_0000642
415 Ga0496110_0003392
416 Ga0496110_0036496
417 Ga0496111_0000034
418 Ga0496111_0040124
419 Ga0496111_0044327
420 Ga0496111_0108921
421 Ga0496111_0374251
422 Ga0496112_0011759
423 Ga0496112_0140354
424 Ga0496112_0544967
425 Ga0496113_0004635
426 Ga0496113_0031089
427 Ga0496114_0008934
428 Ga0496114_0013480
429 Ga0496114_0092845
430 Ga0496114_0164998
431 Ga0501031_0009880
432 Ga0501032_0166100
433 Ga0501033_0011314
434 Ga0501036_0208270
435 Ga0501038_0002835
436 Ga0501038_0408840
437 Ga0501040_0011589
438 Ga0501040_0112205
439 Ga0501040_0404385
440 Ga0501041_0007132
441 Ga0501041_0230273
442 Ga0501042_0008392
443 Ga0501042_0167975
444 Ga0501046_0204432
445 Ga0501046_0226687
446 Ga0501048_0019984
447 Ga0501067_0099228
448 Ga0501067_0203889
449 Ga0501067_0252103
450 Ga0501068_0034780
451 Ga0501069_0082567
452 Ga0501070_0034727
453 Ga0501071_0048037
454 Ga0501071_0319370
455 Ga0501071_0427672
456 Ga0501072_0011084
457 Ga0501072_0044635
458 Ga0501072_0144137
459 Ga0501074_0007610
460 Ga0501074_0085103
461 Ga0501075_0056575
462 Ga0501075_0305233
463 Ga0501076_0090810
464 Ga0501076_0187991
465 Ga0501077_0003797
466 Ga0501077_0011455
467 Ga0501077_0062867
468 Ga0501077_0094100
469 Ga0501077_0220054
470 Ga0501079_0004409
471 Ga0501079_0030341
472 Ga0501079_0037405
473 Ga0501079_0130138
474 Ga0501079_0219927
475 Ga0501080_0016309
476 Ga0501080_0137951
477 Ga0501081_0001579
478 Ga0501083_0142307
479 Ga0501083_0328913
480 Ga0501035_0007148
481 Ga0501045_0090301
482 nmdc:mga05p37_127298_c1
483 nmdc:mga05p37_2481_c1
484 nmdc:mga05p37_78738_c1
485 nmdc:mga05p37_92511_c1
486 nmdc:mga09592_382326_c1
487 nmdc:mga09592_7064_c1
488 nmdc:mga0qj67_64033_c1
489 nmdc:mga08y16_315620_c1
490 nmdc:mga0n895_43488_c1
491 nmdc:mga0n895_66179_c1
492 nmdc:mga0rr50_170054_c1
493 nmdc:mga0a205_480551_c1
494 Ga0495601_0131471
495 Ga0495601_0193421
496 Ga0495612_0031900
497 Ga0495595_0028985
498 Ga0501084_0018862
499 Ga0501084_0071002
500 Ga0501084_0239364
501 Ga0501082_0009071
502 Ga0530510_0024772
503 Ga0530510_0174165
504 Ga0530510_0235932
505 Ga0530510_0301818
506 Ga0530510_0356319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

5

254

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5872 2 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5575 2 251
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5494 2 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5493 2 251
8jt9-assembly1.cif.gz_A human vmat2 complex with ketanserin 0.4503 32 255
ID Description Score Start End Superfamily
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5464 70 255 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5191 70 255 1.20.1250.20
af_Q54EX8_313_506_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4882 40 258 1.20.1250.20
af_B6T9A5_7_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4812 40 257 1.20.1250.20
af_Q54EX8_313_506_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4496 40 258 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V3MIU2-F1-model_v4 Probable membrane transporter protein 0.9463 5 255 GO:0005886
AF-A0A060HF77-F1-model_v4 Probable membrane transporter protein 0.9362 4 256 GO:0005886
AF-A0A832I385-F1-model_v4 Probable membrane transporter protein 0.9323 4 256 GO:0005886
AF-A0A520X7I1-F1-model_v4 Probable membrane transporter protein 0.9181 5 256 GO:0005886
AF-A0A5B8AQY2-F1-model_v4 deleted 0.9171 1 256

Map