F364289

General Info

Members Datasets Scaffolds Average Seq Length
253 132 506 540

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0005359|Ga0466963_0005359_5184_6992
Length 602
Sequence MTSIHTGGADRVPAPGRTAAAPESAAPGAEGATVLDSAHAGDIVGAFGRIRRDGTGAYGAFSGRWRRLRTLAVITGPGLIVMVGDNDAGGVATYAQAGQNYGMGLLWTLALLIPVLYVNQEMVLRLGAVARVGHARLIFERFGKFWGAFSVGDLLILNALTIVTEFIGVSLALGFLGCPRIVAVPAAAVLLFAVVAGGSFRRWERLMFLLIAVNVLIIPLVALVHPTPKATAAGLLPQFPGGLNSTVLLLVVAIVGTTVAPWQLFFQQSNVVDKRITARWIPYGRADLAIGIVVVMVGATALMTVAAFGLAGTADAGHFTDAGAVASGLSQHLGRTVGVLFAIILLDASLIGANAVGLATTYAVGDAMGKRHSLHWKISEAPLFYGGYALLLGVSAAISFSPDHILGLVTQGVQALAGVLLPSATVFLVLLCNDRAVLGPWVNTVRQNIIAWTIVWSLVLLSLALTATTFFPGLPTGSIEAGLAAGAVLGMXGGAVMIVAGRRHRNLTEAEAIVRTLGGGLDPGEVDELDDAASLTRAERRAIRRQDRASWQTPNLALLDRPAMSPMRRAGLFTLRGYLVVAVAFVIIKIVQAGVVGPAASL

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
63 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
77 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
78 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
79 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
116 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
117 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
118 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
119 2547132424 Nocardia nova SH22a Isolate Unclassified
120 2671180195 Frankia sp. CcI49 Isolate Nodule
121 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
122 2773857922 Frankia sp. CcI49 Isolate Nodule
123 2773857933 Frankia sp. BMG5.30 Isolate Nodule
124 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
125 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
126 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
127 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
128 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
129 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
130 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
131 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.09
Metatranscriptomes 0.79
Isolates 7.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.37
Nodule 3.95
Rhizoplane 0.4
Rhizosphere 68.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0005359 3300044694 Bacteria 7504
2 JGI24735J21928_10003473 3300002067 Bacteria 5369
3 JGI24735J21928_10003704 3300002067 Bacteria 5183
4 JGI25156J39149_1001419 3300002705 Bacteria 10202
5 JGI25156J39149_1001566 3300002705 Bacteria 9450
6 JGI25162J39368_1000057 3300002737 Bacteria 145686
7 Ga0055533_1000576 3300003756 Bacteria 12894
8 Ga0055529_1001503 3300003763 Bacteria 6827
9 Ga0055529_1001593 3300003763 Bacteria 6187
10 Ga0070660_100003600 3300005339 Bacteria 10698
11 Ga0070703_10001130 3300005406 Bacteria 8257
12 Ga0070709_10000477 3300005434 Bacteria 23762
13 Ga0070714_100014093 3300005435 Bacteria 6416
14 Ga0070710_10001276 3300005437 Bacteria 11964
15 Ga0070711_100002658 3300005439 Bacteria 10241
16 Ga0070705_100005602 3300005440 Bacteria 6129
17 Ga0070708_100000129 3300005445 Bacteria 51544
18 Ga0070708_100002436 3300005445 Bacteria 14421
19 Ga0070708_100006017 3300005445 Bacteria 9641
20 Ga0070708_100009404 3300005445 Bacteria 7880
21 Ga0070708_100014591 3300005445 Bacteria 6473
22 Ga0070708_100025922 3300005445 Bacteria 5014
23 Ga0070706_100000156 3300005467 Bacteria 86633
24 Ga0070706_100000359 3300005467 Bacteria 55028
25 Ga0070706_100002385 3300005467 Bacteria 18952
26 Ga0070706_100004408 3300005467 Bacteria 13599
27 Ga0070706_100007583 3300005467 Bacteria 10159
28 Ga0070706_100024672 3300005467 Bacteria 5536
29 Ga0070706_100054699 3300005467 Bacteria 3684
30 Ga0070706_100076764 3300005467 Bacteria 3092
31 Ga0070706_100129423 3300005467 Bacteria 2355
32 Ga0070707_100000078 3300005468 Bacteria 86633
33 Ga0070707_100005742 3300005468 Bacteria 11572
34 Ga0070707_100014705 3300005468 Bacteria 7335
35 Ga0070707_100070094 3300005468 Bacteria 3376
36 Ga0070707_100128597 3300005468 Bacteria 2462
37 Ga0070707_100186854 3300005468 Bacteria 2020
38 Ga0070698_100000546 3300005471 Bacteria 40175
39 Ga0070698_100001544 3300005471 Bacteria 25532
40 Ga0070698_100002563 3300005471 Bacteria 20001
41 Ga0070698_100020678 3300005471 Bacteria 6901
42 Ga0070699_100000180 3300005518 Bacteria 61309
43 Ga0070699_100000254 3300005518 Bacteria 52437
44 Ga0070699_100110988 3300005518 Bacteria 2408
45 Ga0070697_100005739 3300005536 Bacteria 9568
46 Ga0068853_100043975 3300005539 Bacteria 3822
47 Ga0070695_100069523 3300005545 Bacteria 2301
48 Ga0068855_100133652 3300005563 Bacteria 2831
49 Ga0070717_10006741 3300006028 Bacteria 8473
50 Ga0070717_10007549 3300006028 Bacteria 8082
51 Ga0070717_10011939 3300006028 Bacteria 6610
52 Ga0070717_10019838 3300006028 Bacteria 5278
53 Ga0070717_10039308 3300006028 Bacteria 3849
54 Ga0070717_10102699 3300006028 Bacteria 2429
55 Ga0070715_10001087 3300006163 Bacteria 7701
56 Ga0070716_100000375 3300006173 Bacteria 18369
57 Ga0099794_10000490 3300007265 Bacteria 13262
58 Ga0099795_10004496 3300007788 Bacteria 3607
59 Ga0105240_10011765 3300009093 Bacteria 12157
60 Ga0105240_10015522 3300009093 Bacteria 10356
61 Ga0105240_10102480 3300009093 Bacteria 3478
62 Ga0114129_10085101 3300009147 Bacteria 4387
63 Ga0105238_10000607 3300009551 Bacteria 37628
64 Ga0105239_10005195 3300010375 Bacteria 15321
65 Ga0157370_10006203 3300013104 Bacteria 13256
66 Ga0157369_10001147 3300013105 Bacteria 33050
67 Ga0157369_10042125 3300013105 Bacteria 4982
68 Ga0157369_10108036 3300013105 Bacteria 2960
69 Ga0157374_10000099 3300013296 Bacteria 80415
70 Ga0157372_10010626 3300013307 Bacteria 9795
71 Ga0206350_10342085 3300020080 Bacteria 3281
72 Ga0213873_10000360 3300021358 Bacteria 7507
73 Ga0213874_10002306 3300021377 Bacteria 4085
74 Ga0213876_10000210 3300021384 Bacteria 58885
75 Ga0213876_10002088 3300021384 Bacteria 11824
76 Ga0213876_10008817 3300021384 Bacteria 5445
77 Ga0213876_10015519 3300021384 Bacteria 4031
78 Ga0213876_10018040 3300021384 Bacteria 3724
79 Ga0213875_10000279 3300021388 Bacteria 50175
80 Ga0213875_10002281 3300021388 Bacteria 11628
81 Ga0213875_10003612 3300021388 Bacteria 8748
82 Ga0213875_10027044 3300021388 Bacteria 2729
83 Ga0213875_10035980 3300021388 Bacteria 2335
84 Ga0224712_10000797 3300022467 Bacteria 6645
85 Ga0209674_100155 3300025226 Bacteria 91885
86 Ga0209759_1000138 3300025256 Bacteria 125136
87 Ga0209759_1000629 3300025256 Bacteria 33507
88 Ga0209759_1005100 3300025256 Bacteria 4688
89 Ga0209455_1001046 3300025272 Bacteria 13728
90 Ga0207692_10004706 3300025898 Bacteria 5416
91 Ga0207647_10000404 3300025904 Bacteria 35356
92 Ga0207685_10013608 3300025905 Bacteria 2522
93 Ga0207699_10002363 3300025906 Bacteria 8910
94 Ga0207684_10000001 3300025910 Bacteria 1115726
95 Ga0207684_10000227 3300025910 Bacteria 86625
96 Ga0207684_10001806 3300025910 Bacteria 22396
97 Ga0207684_10007147 3300025910 Bacteria 10087
98 Ga0207684_10020721 3300025910 Bacteria 5619
99 Ga0207684_10036516 3300025910 Bacteria 4170
100 Ga0207695_10055128 3300025913 Bacteria 4145
101 Ga0207695_10125063 3300025913 Bacteria 2535
102 Ga0207693_10001158 3300025915 Bacteria 23531
103 Ga0207663_10015444 3300025916 Bacteria 4213
104 Ga0207646_10000179 3300025922 Bacteria 86647
105 Ga0207646_10001770 3300025922 Bacteria 26156
106 Ga0207646_10002450 3300025922 Bacteria 21909
107 Ga0207646_10008258 3300025922 Bacteria 10452
108 Ga0207646_10025330 3300025922 Bacteria 5427
109 Ga0207646_10100421 3300025922 Bacteria 2594
110 Ga0207646_10146611 3300025922 Bacteria 2127
111 Ga0207694_10000606 3300025924 Bacteria 32510
112 Ga0207700_10000238 3300025928 Bacteria 32837
113 Ga0207700_10006863 3300025928 Bacteria 6921
114 Ga0207664_10009747 3300025929 Bacteria 6755
115 Ga0207665_10003356 3300025939 Bacteria 10721
116 Ga0207667_10017107 3300025949 Bacteria 8175
117 Ga0209588_1000080 3300027671 Bacteria 31448
118 Ga0265319_1000005 3300028563 Bacteria 249025
119 Ga0265319_1007621 3300028563 Bacteria 4838
120 Ga0265318_10008565 3300028577 Bacteria 4543
121 Ga0265328_10007113 3300031239 Bacteria 4688
122 Ga0265320_10005006 3300031240 Bacteria 8588
123 Ga0265327_10046372 3300031251 Bacteria 2301
124 Ga0265313_10003668 3300031595 Bacteria 12277
125 Ga0265314_10022378 3300031711 Bacteria 4842
126 Ga0307516_10000090 3300031730 Bacteria 101690
127 Ga0373926_0001355 3300035083 Bacteria 7408
128 Ga0373946_0036467 3300035171 Bacteria 1994
129 Ga0373935_0002415 3300035692 Bacteria 10694
130 Ga0373947_0000116 3300035725 Bacteria 39945
131 Ga0373937_0004780 3300036401 Bacteria 11503
132 Ga0436364_0027415 3300037853 Bacteria 25526
133 Ga0436364_0055978 3300037853 Bacteria 20042
134 Ga0436364_0180436 3300037853 Bacteria 9299
135 Ga0436364_0255791 3300037853 Bacteria 9711
136 Ga0436364_0331112 3300037853 Bacteria 12320
137 Ga0436364_0475204 3300037853 Bacteria 11217
138 Ga0436364_0568088 3300037853 Bacteria 2994
139 Ga0436364_0625242 3300037853 Bacteria 8780
140 Ga0436364_0662184 3300037853 Bacteria 8624
141 Ga0436364_0838356 3300037853 Bacteria 3005
142 Ga0436364_1018655 3300037853 Bacteria 3133
143 Ga0436364_1179679 3300037853 Bacteria 24973
144 Ga0436364_1286189 3300037853 Bacteria 5263
145 Ga0436364_1400872 3300037853 Bacteria 3398
146 Ga0436364_1427311 3300037853 Bacteria 97691
147 Ga0395901_0000175 3300038443 Bacteria 83175
148 Ga0436365_0162783 3300039437 Bacteria 4180
149 Ga0436365_0194503 3300039437 Bacteria 8631
150 Ga0436365_0319629 3300039437 Bacteria 2183
151 Ga0436365_0410802 3300039437 Bacteria 48863
152 Ga0436365_0586833 3300039437 Bacteria 4951
153 Ga0436365_0661858 3300039437 Bacteria 5594
154 Ga0436365_0770655 3300039437 Bacteria 14135
155 Ga0436365_0790255 3300039437 Bacteria 2449
156 Ga0436365_0839251 3300039437 Bacteria 2659
157 Ga0436365_0855511 3300039437 Bacteria 21676
158 Ga0436365_0879956 3300039437 Bacteria 2145
159 Ga0436365_1004005 3300039437 Bacteria 7025
160 Ga0436365_1052963 3300039437 Bacteria 5563
161 Ga0436365_1108994 3300039437 Bacteria 4800
162 Ga0436360_0146478 3300039438 Bacteria 7456
163 Ga0436360_0410502 3300039438 Bacteria 2319
164 Ga0436360_0568566 3300039438 Bacteria 5136
165 Ga0436360_0631804 3300039438 Bacteria 4386
166 Ga0436361_0005423 3300039447 Bacteria 6272
167 Ga0436361_0030069 3300039447 Bacteria 5478
168 Ga0436361_0568170 3300039447 Bacteria 4483
169 Ga0436361_0607739 3300039447 Bacteria 1664
170 Ga0436363_0479513 3300039450 Bacteria 6191
171 Ga0436363_0560615 3300039450 Bacteria 3651
172 Ga0436363_1047748 3300039450 Bacteria 2479
173 Ga0436363_1377054 3300039450 Bacteria 1692
174 Ga0436363_1707842 3300039450 Bacteria 2633
175 Ga0436362_0484241 3300039453 Bacteria 3117
176 Ga0436362_1166649 3300039453 Bacteria 17114
177 Ga0466969_0012804 3300044656 Bacteria 4421
178 Ga0466969_0034304 3300044656 Bacteria 2572
179 Ga0466966_0000895 3300044684 Bacteria 19023
180 Ga0466966_0042776 3300044684 Bacteria 2906
181 Ga0466961_0017796 3300044693 Bacteria 4566
182 Ga0466961_0020397 3300044693 Bacteria 4263
183 Ga0466963_0004669 3300044694 Bacteria 7996
184 Ga0466963_0019692 3300044694 Bacteria 4236
185 Ga0466971_0011749 3300044719 Bacteria 3835
186 Ga0466971_0022755 3300044719 Bacteria 2793
187 Ga0466971_0030835 3300044719 Bacteria 2400
188 Ga0466971_0032914 3300044719 Bacteria 2322
189 Ga0466968_0004398 3300044735 Bacteria 5263
190 Ga0466957_0004441 3300044842 Bacteria 7813
191 Ga0466959_0014719 3300045049 Bacteria 5694
192 Ga0466958_0002264 3300045836 Bacteria 9593
193 Ga0466958_0003985 3300045836 Bacteria 7740
194 Ga0466958_0005853 3300045836 Bacteria 6656
195 Ga0466958_0011705 3300045836 Bacteria 4949
196 Ga0466958_0013898 3300045836 Bacteria 4592
197 Ga0466958_0020342 3300045836 Bacteria 3868
198 Ga0466958_0022456 3300045836 Bacteria 3696
199 Ga0466967_0003233 3300045976 Bacteria 10534
200 Ga0466967_0011717 3300045976 Bacteria 6664
201 Ga0495652_0008455 3300046529 Bacteria 9391
202 Ga0495657_0058806 3300046675 Bacteria 2551
203 Ga0495623_0014927 3300046679 Bacteria 5023
204 Ga0495604_0018922 3300047317 Bacteria 5516
205 Ga0495680_0033980 3300047322 Bacteria 4125
206 Ga0495686_0001630 3300047472 Bacteria 23423
207 Ga0495602_0062182 3300048088 Bacteria 3240
208 Ga0496102_0012922 3300048905 Bacteria 7230
209 Ga0496118_0000029 3300048921 Bacteria 340978
210 Ga0496121_0000383 3300048924 Bacteria 90365
211 Ga0496126_0001315 3300048929 Bacteria 39505
212 Ga0496126_0001663 3300048929 Bacteria 33385
213 Ga0495682_0000156 3300049460 Bacteria 57409
214 Ga0501032_0001059 3300049569 Bacteria 21988
215 Ga0501033_0007638 3300049570 Bacteria 8405
216 Ga0501034_0006174 3300049571 Bacteria 12915
217 Ga0501034_0045637 3300049571 Bacteria 4427
218 Ga0501037_0000982 3300049573 Bacteria 21204
219 Ga0501038_0035400 3300049574 Bacteria 4383
220 Ga0501039_0004173 3300049575 Bacteria 10877
221 Ga0501042_0057818 3300049578 Bacteria 2767
222 Ga0501043_0002277 3300049579 Bacteria 16316
223 Ga0501043_0024100 3300049579 Bacteria 4775
224 Ga0501046_0001177 3300049580 Bacteria 25444
225 Ga0501047_0021758 3300049581 Bacteria 6157
226 Ga0501070_0000361 3300049586 Bacteria 41441
227 Ga0501070_0010189 3300049586 Bacteria 7953
228 Ga0501070_0019894 3300049586 Bacteria 5630
229 Ga0501080_0116696 3300049742 Bacteria 2474
230 Ga0501035_0006617 3300049822 Bacteria 10849
231 Ga0501035_0008453 3300049822 Bacteria 9588
232 Ga0501035_0011361 3300049822 Bacteria 8253
233 Ga0501044_0000185 3300049823 Bacteria 77663
234 Ga0501044_0003620 3300049823 Bacteria 17384
235 Ga0501044_0097083 3300049823 Bacteria 2968
236 2512349797 2512047030 Bacteria 9031815
237 2515683220 2515154122 Bacteria 8609520
238 2515691785 2515154123 Bacteria 6387382
239 2516021887 2515154189 Bacteria 9629850
240 2548694184 2547132424 Bacteria 8348532
241 2671838246 2671180195 Bacteria 9757215
242 2713474307 2711768613 Bacteria 11048459
243 2774856402 2773857922 Bacteria 9757215
244 2774905954 2773857933 Bacteria 5818019
245 2792838012 2791355137 Bacteria 9654227
246 2885419026 2885409591 Bacteria 9235467
247 2900641631 2900634093 Bacteria 10263517
248 2902684101 2902682994 Bacteria 8951596
249 2904621301 2904615490 Bacteria 10047340
250 2904692195 2904690495 Bacteria 9412302
251 2908756733 2908756301 Bacteria 8864324
252 2921652154 2921643360 Bacteria 11448031
253 2935632554 2935630451 Bacteria 8169952
254 Ga0466963_0005359
255 JGI24735J21928_10003473
256 JGI24735J21928_10003704
257 JGI25156J39149_1001419
258 JGI25156J39149_1001566
259 JGI25162J39368_1000057
260 Ga0055533_1000576
261 Ga0055529_1001503
262 Ga0055529_1001593
263 Ga0070660_100003600
264 Ga0070703_10001130
265 Ga0070709_10000477
266 Ga0070714_100014093
267 Ga0070710_10001276
268 Ga0070711_100002658
269 Ga0070705_100005602
270 Ga0070708_100000129
271 Ga0070708_100002436
272 Ga0070708_100006017
273 Ga0070708_100009404
274 Ga0070708_100014591
275 Ga0070708_100025922
276 Ga0070706_100000156
277 Ga0070706_100000359
278 Ga0070706_100002385
279 Ga0070706_100004408
280 Ga0070706_100007583
281 Ga0070706_100024672
282 Ga0070706_100054699
283 Ga0070706_100076764
284 Ga0070706_100129423
285 Ga0070707_100000078
286 Ga0070707_100005742
287 Ga0070707_100014705
288 Ga0070707_100070094
289 Ga0070707_100128597
290 Ga0070707_100186854
291 Ga0070698_100000546
292 Ga0070698_100001544
293 Ga0070698_100002563
294 Ga0070698_100020678
295 Ga0070699_100000180
296 Ga0070699_100000254
297 Ga0070699_100110988
298 Ga0070697_100005739
299 Ga0068853_100043975
300 Ga0070695_100069523
301 Ga0068855_100133652
302 Ga0070717_10006741
303 Ga0070717_10007549
304 Ga0070717_10011939
305 Ga0070717_10019838
306 Ga0070717_10039308
307 Ga0070717_10102699
308 Ga0070715_10001087
309 Ga0070716_100000375
310 Ga0099794_10000490
311 Ga0099795_10004496
312 Ga0105240_10011765
313 Ga0105240_10015522
314 Ga0105240_10102480
315 Ga0114129_10085101
316 Ga0105238_10000607
317 Ga0105239_10005195
318 Ga0157370_10006203
319 Ga0157369_10001147
320 Ga0157369_10042125
321 Ga0157369_10108036
322 Ga0157374_10000099
323 Ga0157372_10010626
324 Ga0206350_10342085
325 Ga0213873_10000360
326 Ga0213874_10002306
327 Ga0213876_10000210
328 Ga0213876_10002088
329 Ga0213876_10008817
330 Ga0213876_10015519
331 Ga0213876_10018040
332 Ga0213875_10000279
333 Ga0213875_10002281
334 Ga0213875_10003612
335 Ga0213875_10027044
336 Ga0213875_10035980
337 Ga0224712_10000797
338 Ga0209674_100155
339 Ga0209759_1000138
340 Ga0209759_1000629
341 Ga0209759_1005100
342 Ga0209455_1001046
343 Ga0207692_10004706
344 Ga0207647_10000404
345 Ga0207685_10013608
346 Ga0207699_10002363
347 Ga0207684_10000001
348 Ga0207684_10000227
349 Ga0207684_10001806
350 Ga0207684_10007147
351 Ga0207684_10020721
352 Ga0207684_10036516
353 Ga0207695_10055128
354 Ga0207695_10125063
355 Ga0207693_10001158
356 Ga0207663_10015444
357 Ga0207646_10000179
358 Ga0207646_10001770
359 Ga0207646_10002450
360 Ga0207646_10008258
361 Ga0207646_10025330
362 Ga0207646_10100421
363 Ga0207646_10146611
364 Ga0207694_10000606
365 Ga0207700_10000238
366 Ga0207700_10006863
367 Ga0207664_10009747
368 Ga0207665_10003356
369 Ga0207667_10017107
370 Ga0209588_1000080
371 Ga0265319_1000005
372 Ga0265319_1007621
373 Ga0265318_10008565
374 Ga0265328_10007113
375 Ga0265320_10005006
376 Ga0265327_10046372
377 Ga0265313_10003668
378 Ga0265314_10022378
379 Ga0307516_10000090
380 Ga0373926_0001355
381 Ga0373946_0036467
382 Ga0373935_0002415
383 Ga0373947_0000116
384 Ga0373937_0004780
385 Ga0436364_0027415
386 Ga0436364_0055978
387 Ga0436364_0180436
388 Ga0436364_0255791
389 Ga0436364_0331112
390 Ga0436364_0475204
391 Ga0436364_0568088
392 Ga0436364_0625242
393 Ga0436364_0662184
394 Ga0436364_0838356
395 Ga0436364_1018655
396 Ga0436364_1179679
397 Ga0436364_1286189
398 Ga0436364_1400872
399 Ga0436364_1427311
400 Ga0395901_0000175
401 Ga0436365_0162783
402 Ga0436365_0194503
403 Ga0436365_0319629
404 Ga0436365_0410802
405 Ga0436365_0586833
406 Ga0436365_0661858
407 Ga0436365_0770655
408 Ga0436365_0790255
409 Ga0436365_0839251
410 Ga0436365_0855511
411 Ga0436365_0879956
412 Ga0436365_1004005
413 Ga0436365_1052963
414 Ga0436365_1108994
415 Ga0436360_0146478
416 Ga0436360_0410502
417 Ga0436360_0568566
418 Ga0436360_0631804
419 Ga0436361_0005423
420 Ga0436361_0030069
421 Ga0436361_0568170
422 Ga0436361_0607739
423 Ga0436363_0479513
424 Ga0436363_0560615
425 Ga0436363_1047748
426 Ga0436363_1377054
427 Ga0436363_1707842
428 Ga0436362_0484241
429 Ga0436362_1166649
430 Ga0466969_0012804
431 Ga0466969_0034304
432 Ga0466966_0000895
433 Ga0466966_0042776
434 Ga0466961_0017796
435 Ga0466961_0020397
436 Ga0466963_0004669
437 Ga0466963_0019692
438 Ga0466971_0011749
439 Ga0466971_0022755
440 Ga0466971_0030835
441 Ga0466971_0032914
442 Ga0466968_0004398
443 Ga0466957_0004441
444 Ga0466959_0014719
445 Ga0466958_0002264
446 Ga0466958_0003985
447 Ga0466958_0005853
448 Ga0466958_0011705
449 Ga0466958_0013898
450 Ga0466958_0020342
451 Ga0466958_0022456
452 Ga0466967_0003233
453 Ga0466967_0011717
454 Ga0495652_0008455
455 Ga0495657_0058806
456 Ga0495623_0014927
457 Ga0495604_0018922
458 Ga0495680_0033980
459 Ga0495686_0001630
460 Ga0495602_0062182
461 Ga0496102_0012922
462 Ga0496118_0000029
463 Ga0496121_0000383
464 Ga0496126_0001315
465 Ga0496126_0001663
466 Ga0495682_0000156
467 Ga0501032_0001059
468 Ga0501033_0007638
469 Ga0501034_0006174
470 Ga0501034_0045637
471 Ga0501037_0000982
472 Ga0501038_0035400
473 Ga0501039_0004173
474 Ga0501042_0057818
475 Ga0501043_0002277
476 Ga0501043_0024100
477 Ga0501046_0001177
478 Ga0501047_0021758
479 Ga0501070_0000361
480 Ga0501070_0010189
481 Ga0501070_0019894
482 Ga0501080_0116696
483 Ga0501035_0006617
484 Ga0501035_0008453
485 Ga0501035_0011361
486 Ga0501044_0000185
487 Ga0501044_0003620
488 Ga0501044_0097083
489 2512349797
490 2515683220
491 2515691785
492 2516021887
493 2548694184
494 2671838246
495 2713474307
496 2774856402
497 2774905954
498 2792838012
499 2885419026
500 2900641631
501 2902684101
502 2904621301
503 2904692195
504 2908756733
505 2921652154
506 2935632554

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01566

Nramp

Natural resistance-associated macrophage protein-like

91

445

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.8902 55 451
8e6n-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state 0.8711 55 451
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8631 55 456
7qia-assembly1.cif.gz_A structure of apo-elenrmt in complex with two nanobodies at 3.5a 0.8531 55 456
8e5v-assembly1.cif.gz_A x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state 0.8242 60 451
ID Description Score Start End Superfamily
af_A0A1D6F612_111_472_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8806 77 431 1.20.1740.10
af_I1J9B4_68_431_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8634 76 430 1.20.1740.10
af_A0A1D6F612_111_472_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8622 77 431 1.20.1740.10
af_Q95XG8_64_454_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8586 77 431 1.20.1740.10
af_P9WIZ5_52_401_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8576 77 430 1.20.1740.10
ID Description Score Start End GO Terms
AF-F0FXI0-F1-model_v4 Manganese transporter NRAMP 0.9809 22 322 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
AF-F0FXI0-F1-model_v4 Manganese transporter NRAMP 0.9745 22 322 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755
AF-A0A7C4IMF7-F1-model_v4 Divalent metal cation transporter 0.962 47 340 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A7C4IMF7-F1-model_v4 Divalent metal cation transporter 0.9523 47 340 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0034755
AF-A0A2Z3R0J4-F1-model_v4 Divalent metal cation transporter 0.9502 42 460 GO:0005384
GO:0005886
GO:0012505
GO:0015086
GO:0015293
GO:0034755

Map