F364289
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 132 | 506 | 540 |
Family's Representative Sequence
| Representative Sequence | 3300044694|Ga0466963_0005359|Ga0466963_0005359_5184_6992 |
| Length | 602 |
| Sequence | MTSIHTGGADRVPAPGRTAAAPESAAPGAEGATVLDSAHAGDIVGAFGRIRRDGTGAYGAFSGRWRRLRTLAVITGPGLIVMVGDNDAGGVATYAQAGQNYGMGLLWTLALLIPVLYVNQEMVLRLGAVARVGHARLIFERFGKFWGAFSVGDLLILNALTIVTEFIGVSLALGFLGCPRIVAVPAAAVLLFAVVAGGSFRRWERLMFLLIAVNVLIIPLVALVHPTPKATAAGLLPQFPGGLNSTVLLLVVAIVGTTVAPWQLFFQQSNVVDKRITARWIPYGRADLAIGIVVVMVGATALMTVAAFGLAGTADAGHFTDAGAVASGLSQHLGRTVGVLFAIILLDASLIGANAVGLATTYAVGDAMGKRHSLHWKISEAPLFYGGYALLLGVSAAISFSPDHILGLVTQGVQALAGVLLPSATVFLVLLCNDRAVLGPWVNTVRQNIIAWTIVWSLVLLSLALTATTFFPGLPTGSIEAGLAAGAVLGMXGGAVMIVAGRRHRNLTEAEAIVRTLGGGLDPGEVDELDDAASLTRAERRAIRRQDRASWQTPNLALLDRPAMSPMRRAGLFTLRGYLVVAVAFVIIKIVQAGVVGPAASL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 6 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 27 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 28 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 38 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 39 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 40 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 41 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 42 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 43 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 44 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 45 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 61 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 63 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 64 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 65 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 66 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 68 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 69 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 70 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 71 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 72 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 73 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 74 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 75 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 76 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 77 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 78 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 79 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 80 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 81 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 82 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 83 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 84 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 85 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 86 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 87 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 88 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 89 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 97 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 98 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 99 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 100 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 116 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 117 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 118 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 119 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 120 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 121 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 122 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 123 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 124 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 125 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 126 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 127 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 128 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 129 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 130 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 131 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 132 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.09 |
| Metatranscriptomes | 0.79 |
| Isolates | 7.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.37 |
| Nodule | 3.95 |
| Rhizoplane | 0.4 |
| Rhizosphere | 68.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466963_0005359 | 3300044694 | Bacteria | 7504 |
| 2 | JGI24735J21928_10003473 | 3300002067 | Bacteria | 5369 |
| 3 | JGI24735J21928_10003704 | 3300002067 | Bacteria | 5183 |
| 4 | JGI25156J39149_1001419 | 3300002705 | Bacteria | 10202 |
| 5 | JGI25156J39149_1001566 | 3300002705 | Bacteria | 9450 |
| 6 | JGI25162J39368_1000057 | 3300002737 | Bacteria | 145686 |
| 7 | Ga0055533_1000576 | 3300003756 | Bacteria | 12894 |
| 8 | Ga0055529_1001503 | 3300003763 | Bacteria | 6827 |
| 9 | Ga0055529_1001593 | 3300003763 | Bacteria | 6187 |
| 10 | Ga0070660_100003600 | 3300005339 | Bacteria | 10698 |
| 11 | Ga0070703_10001130 | 3300005406 | Bacteria | 8257 |
| 12 | Ga0070709_10000477 | 3300005434 | Bacteria | 23762 |
| 13 | Ga0070714_100014093 | 3300005435 | Bacteria | 6416 |
| 14 | Ga0070710_10001276 | 3300005437 | Bacteria | 11964 |
| 15 | Ga0070711_100002658 | 3300005439 | Bacteria | 10241 |
| 16 | Ga0070705_100005602 | 3300005440 | Bacteria | 6129 |
| 17 | Ga0070708_100000129 | 3300005445 | Bacteria | 51544 |
| 18 | Ga0070708_100002436 | 3300005445 | Bacteria | 14421 |
| 19 | Ga0070708_100006017 | 3300005445 | Bacteria | 9641 |
| 20 | Ga0070708_100009404 | 3300005445 | Bacteria | 7880 |
| 21 | Ga0070708_100014591 | 3300005445 | Bacteria | 6473 |
| 22 | Ga0070708_100025922 | 3300005445 | Bacteria | 5014 |
| 23 | Ga0070706_100000156 | 3300005467 | Bacteria | 86633 |
| 24 | Ga0070706_100000359 | 3300005467 | Bacteria | 55028 |
| 25 | Ga0070706_100002385 | 3300005467 | Bacteria | 18952 |
| 26 | Ga0070706_100004408 | 3300005467 | Bacteria | 13599 |
| 27 | Ga0070706_100007583 | 3300005467 | Bacteria | 10159 |
| 28 | Ga0070706_100024672 | 3300005467 | Bacteria | 5536 |
| 29 | Ga0070706_100054699 | 3300005467 | Bacteria | 3684 |
| 30 | Ga0070706_100076764 | 3300005467 | Bacteria | 3092 |
| 31 | Ga0070706_100129423 | 3300005467 | Bacteria | 2355 |
| 32 | Ga0070707_100000078 | 3300005468 | Bacteria | 86633 |
| 33 | Ga0070707_100005742 | 3300005468 | Bacteria | 11572 |
| 34 | Ga0070707_100014705 | 3300005468 | Bacteria | 7335 |
| 35 | Ga0070707_100070094 | 3300005468 | Bacteria | 3376 |
| 36 | Ga0070707_100128597 | 3300005468 | Bacteria | 2462 |
| 37 | Ga0070707_100186854 | 3300005468 | Bacteria | 2020 |
| 38 | Ga0070698_100000546 | 3300005471 | Bacteria | 40175 |
| 39 | Ga0070698_100001544 | 3300005471 | Bacteria | 25532 |
| 40 | Ga0070698_100002563 | 3300005471 | Bacteria | 20001 |
| 41 | Ga0070698_100020678 | 3300005471 | Bacteria | 6901 |
| 42 | Ga0070699_100000180 | 3300005518 | Bacteria | 61309 |
| 43 | Ga0070699_100000254 | 3300005518 | Bacteria | 52437 |
| 44 | Ga0070699_100110988 | 3300005518 | Bacteria | 2408 |
| 45 | Ga0070697_100005739 | 3300005536 | Bacteria | 9568 |
| 46 | Ga0068853_100043975 | 3300005539 | Bacteria | 3822 |
| 47 | Ga0070695_100069523 | 3300005545 | Bacteria | 2301 |
| 48 | Ga0068855_100133652 | 3300005563 | Bacteria | 2831 |
| 49 | Ga0070717_10006741 | 3300006028 | Bacteria | 8473 |
| 50 | Ga0070717_10007549 | 3300006028 | Bacteria | 8082 |
| 51 | Ga0070717_10011939 | 3300006028 | Bacteria | 6610 |
| 52 | Ga0070717_10019838 | 3300006028 | Bacteria | 5278 |
| 53 | Ga0070717_10039308 | 3300006028 | Bacteria | 3849 |
| 54 | Ga0070717_10102699 | 3300006028 | Bacteria | 2429 |
| 55 | Ga0070715_10001087 | 3300006163 | Bacteria | 7701 |
| 56 | Ga0070716_100000375 | 3300006173 | Bacteria | 18369 |
| 57 | Ga0099794_10000490 | 3300007265 | Bacteria | 13262 |
| 58 | Ga0099795_10004496 | 3300007788 | Bacteria | 3607 |
| 59 | Ga0105240_10011765 | 3300009093 | Bacteria | 12157 |
| 60 | Ga0105240_10015522 | 3300009093 | Bacteria | 10356 |
| 61 | Ga0105240_10102480 | 3300009093 | Bacteria | 3478 |
| 62 | Ga0114129_10085101 | 3300009147 | Bacteria | 4387 |
| 63 | Ga0105238_10000607 | 3300009551 | Bacteria | 37628 |
| 64 | Ga0105239_10005195 | 3300010375 | Bacteria | 15321 |
| 65 | Ga0157370_10006203 | 3300013104 | Bacteria | 13256 |
| 66 | Ga0157369_10001147 | 3300013105 | Bacteria | 33050 |
| 67 | Ga0157369_10042125 | 3300013105 | Bacteria | 4982 |
| 68 | Ga0157369_10108036 | 3300013105 | Bacteria | 2960 |
| 69 | Ga0157374_10000099 | 3300013296 | Bacteria | 80415 |
| 70 | Ga0157372_10010626 | 3300013307 | Bacteria | 9795 |
| 71 | Ga0206350_10342085 | 3300020080 | Bacteria | 3281 |
| 72 | Ga0213873_10000360 | 3300021358 | Bacteria | 7507 |
| 73 | Ga0213874_10002306 | 3300021377 | Bacteria | 4085 |
| 74 | Ga0213876_10000210 | 3300021384 | Bacteria | 58885 |
| 75 | Ga0213876_10002088 | 3300021384 | Bacteria | 11824 |
| 76 | Ga0213876_10008817 | 3300021384 | Bacteria | 5445 |
| 77 | Ga0213876_10015519 | 3300021384 | Bacteria | 4031 |
| 78 | Ga0213876_10018040 | 3300021384 | Bacteria | 3724 |
| 79 | Ga0213875_10000279 | 3300021388 | Bacteria | 50175 |
| 80 | Ga0213875_10002281 | 3300021388 | Bacteria | 11628 |
| 81 | Ga0213875_10003612 | 3300021388 | Bacteria | 8748 |
| 82 | Ga0213875_10027044 | 3300021388 | Bacteria | 2729 |
| 83 | Ga0213875_10035980 | 3300021388 | Bacteria | 2335 |
| 84 | Ga0224712_10000797 | 3300022467 | Bacteria | 6645 |
| 85 | Ga0209674_100155 | 3300025226 | Bacteria | 91885 |
| 86 | Ga0209759_1000138 | 3300025256 | Bacteria | 125136 |
| 87 | Ga0209759_1000629 | 3300025256 | Bacteria | 33507 |
| 88 | Ga0209759_1005100 | 3300025256 | Bacteria | 4688 |
| 89 | Ga0209455_1001046 | 3300025272 | Bacteria | 13728 |
| 90 | Ga0207692_10004706 | 3300025898 | Bacteria | 5416 |
| 91 | Ga0207647_10000404 | 3300025904 | Bacteria | 35356 |
| 92 | Ga0207685_10013608 | 3300025905 | Bacteria | 2522 |
| 93 | Ga0207699_10002363 | 3300025906 | Bacteria | 8910 |
| 94 | Ga0207684_10000001 | 3300025910 | Bacteria | 1115726 |
| 95 | Ga0207684_10000227 | 3300025910 | Bacteria | 86625 |
| 96 | Ga0207684_10001806 | 3300025910 | Bacteria | 22396 |
| 97 | Ga0207684_10007147 | 3300025910 | Bacteria | 10087 |
| 98 | Ga0207684_10020721 | 3300025910 | Bacteria | 5619 |
| 99 | Ga0207684_10036516 | 3300025910 | Bacteria | 4170 |
| 100 | Ga0207695_10055128 | 3300025913 | Bacteria | 4145 |
| 101 | Ga0207695_10125063 | 3300025913 | Bacteria | 2535 |
| 102 | Ga0207693_10001158 | 3300025915 | Bacteria | 23531 |
| 103 | Ga0207663_10015444 | 3300025916 | Bacteria | 4213 |
| 104 | Ga0207646_10000179 | 3300025922 | Bacteria | 86647 |
| 105 | Ga0207646_10001770 | 3300025922 | Bacteria | 26156 |
| 106 | Ga0207646_10002450 | 3300025922 | Bacteria | 21909 |
| 107 | Ga0207646_10008258 | 3300025922 | Bacteria | 10452 |
| 108 | Ga0207646_10025330 | 3300025922 | Bacteria | 5427 |
| 109 | Ga0207646_10100421 | 3300025922 | Bacteria | 2594 |
| 110 | Ga0207646_10146611 | 3300025922 | Bacteria | 2127 |
| 111 | Ga0207694_10000606 | 3300025924 | Bacteria | 32510 |
| 112 | Ga0207700_10000238 | 3300025928 | Bacteria | 32837 |
| 113 | Ga0207700_10006863 | 3300025928 | Bacteria | 6921 |
| 114 | Ga0207664_10009747 | 3300025929 | Bacteria | 6755 |
| 115 | Ga0207665_10003356 | 3300025939 | Bacteria | 10721 |
| 116 | Ga0207667_10017107 | 3300025949 | Bacteria | 8175 |
| 117 | Ga0209588_1000080 | 3300027671 | Bacteria | 31448 |
| 118 | Ga0265319_1000005 | 3300028563 | Bacteria | 249025 |
| 119 | Ga0265319_1007621 | 3300028563 | Bacteria | 4838 |
| 120 | Ga0265318_10008565 | 3300028577 | Bacteria | 4543 |
| 121 | Ga0265328_10007113 | 3300031239 | Bacteria | 4688 |
| 122 | Ga0265320_10005006 | 3300031240 | Bacteria | 8588 |
| 123 | Ga0265327_10046372 | 3300031251 | Bacteria | 2301 |
| 124 | Ga0265313_10003668 | 3300031595 | Bacteria | 12277 |
| 125 | Ga0265314_10022378 | 3300031711 | Bacteria | 4842 |
| 126 | Ga0307516_10000090 | 3300031730 | Bacteria | 101690 |
| 127 | Ga0373926_0001355 | 3300035083 | Bacteria | 7408 |
| 128 | Ga0373946_0036467 | 3300035171 | Bacteria | 1994 |
| 129 | Ga0373935_0002415 | 3300035692 | Bacteria | 10694 |
| 130 | Ga0373947_0000116 | 3300035725 | Bacteria | 39945 |
| 131 | Ga0373937_0004780 | 3300036401 | Bacteria | 11503 |
| 132 | Ga0436364_0027415 | 3300037853 | Bacteria | 25526 |
| 133 | Ga0436364_0055978 | 3300037853 | Bacteria | 20042 |
| 134 | Ga0436364_0180436 | 3300037853 | Bacteria | 9299 |
| 135 | Ga0436364_0255791 | 3300037853 | Bacteria | 9711 |
| 136 | Ga0436364_0331112 | 3300037853 | Bacteria | 12320 |
| 137 | Ga0436364_0475204 | 3300037853 | Bacteria | 11217 |
| 138 | Ga0436364_0568088 | 3300037853 | Bacteria | 2994 |
| 139 | Ga0436364_0625242 | 3300037853 | Bacteria | 8780 |
| 140 | Ga0436364_0662184 | 3300037853 | Bacteria | 8624 |
| 141 | Ga0436364_0838356 | 3300037853 | Bacteria | 3005 |
| 142 | Ga0436364_1018655 | 3300037853 | Bacteria | 3133 |
| 143 | Ga0436364_1179679 | 3300037853 | Bacteria | 24973 |
| 144 | Ga0436364_1286189 | 3300037853 | Bacteria | 5263 |
| 145 | Ga0436364_1400872 | 3300037853 | Bacteria | 3398 |
| 146 | Ga0436364_1427311 | 3300037853 | Bacteria | 97691 |
| 147 | Ga0395901_0000175 | 3300038443 | Bacteria | 83175 |
| 148 | Ga0436365_0162783 | 3300039437 | Bacteria | 4180 |
| 149 | Ga0436365_0194503 | 3300039437 | Bacteria | 8631 |
| 150 | Ga0436365_0319629 | 3300039437 | Bacteria | 2183 |
| 151 | Ga0436365_0410802 | 3300039437 | Bacteria | 48863 |
| 152 | Ga0436365_0586833 | 3300039437 | Bacteria | 4951 |
| 153 | Ga0436365_0661858 | 3300039437 | Bacteria | 5594 |
| 154 | Ga0436365_0770655 | 3300039437 | Bacteria | 14135 |
| 155 | Ga0436365_0790255 | 3300039437 | Bacteria | 2449 |
| 156 | Ga0436365_0839251 | 3300039437 | Bacteria | 2659 |
| 157 | Ga0436365_0855511 | 3300039437 | Bacteria | 21676 |
| 158 | Ga0436365_0879956 | 3300039437 | Bacteria | 2145 |
| 159 | Ga0436365_1004005 | 3300039437 | Bacteria | 7025 |
| 160 | Ga0436365_1052963 | 3300039437 | Bacteria | 5563 |
| 161 | Ga0436365_1108994 | 3300039437 | Bacteria | 4800 |
| 162 | Ga0436360_0146478 | 3300039438 | Bacteria | 7456 |
| 163 | Ga0436360_0410502 | 3300039438 | Bacteria | 2319 |
| 164 | Ga0436360_0568566 | 3300039438 | Bacteria | 5136 |
| 165 | Ga0436360_0631804 | 3300039438 | Bacteria | 4386 |
| 166 | Ga0436361_0005423 | 3300039447 | Bacteria | 6272 |
| 167 | Ga0436361_0030069 | 3300039447 | Bacteria | 5478 |
| 168 | Ga0436361_0568170 | 3300039447 | Bacteria | 4483 |
| 169 | Ga0436361_0607739 | 3300039447 | Bacteria | 1664 |
| 170 | Ga0436363_0479513 | 3300039450 | Bacteria | 6191 |
| 171 | Ga0436363_0560615 | 3300039450 | Bacteria | 3651 |
| 172 | Ga0436363_1047748 | 3300039450 | Bacteria | 2479 |
| 173 | Ga0436363_1377054 | 3300039450 | Bacteria | 1692 |
| 174 | Ga0436363_1707842 | 3300039450 | Bacteria | 2633 |
| 175 | Ga0436362_0484241 | 3300039453 | Bacteria | 3117 |
| 176 | Ga0436362_1166649 | 3300039453 | Bacteria | 17114 |
| 177 | Ga0466969_0012804 | 3300044656 | Bacteria | 4421 |
| 178 | Ga0466969_0034304 | 3300044656 | Bacteria | 2572 |
| 179 | Ga0466966_0000895 | 3300044684 | Bacteria | 19023 |
| 180 | Ga0466966_0042776 | 3300044684 | Bacteria | 2906 |
| 181 | Ga0466961_0017796 | 3300044693 | Bacteria | 4566 |
| 182 | Ga0466961_0020397 | 3300044693 | Bacteria | 4263 |
| 183 | Ga0466963_0004669 | 3300044694 | Bacteria | 7996 |
| 184 | Ga0466963_0019692 | 3300044694 | Bacteria | 4236 |
| 185 | Ga0466971_0011749 | 3300044719 | Bacteria | 3835 |
| 186 | Ga0466971_0022755 | 3300044719 | Bacteria | 2793 |
| 187 | Ga0466971_0030835 | 3300044719 | Bacteria | 2400 |
| 188 | Ga0466971_0032914 | 3300044719 | Bacteria | 2322 |
| 189 | Ga0466968_0004398 | 3300044735 | Bacteria | 5263 |
| 190 | Ga0466957_0004441 | 3300044842 | Bacteria | 7813 |
| 191 | Ga0466959_0014719 | 3300045049 | Bacteria | 5694 |
| 192 | Ga0466958_0002264 | 3300045836 | Bacteria | 9593 |
| 193 | Ga0466958_0003985 | 3300045836 | Bacteria | 7740 |
| 194 | Ga0466958_0005853 | 3300045836 | Bacteria | 6656 |
| 195 | Ga0466958_0011705 | 3300045836 | Bacteria | 4949 |
| 196 | Ga0466958_0013898 | 3300045836 | Bacteria | 4592 |
| 197 | Ga0466958_0020342 | 3300045836 | Bacteria | 3868 |
| 198 | Ga0466958_0022456 | 3300045836 | Bacteria | 3696 |
| 199 | Ga0466967_0003233 | 3300045976 | Bacteria | 10534 |
| 200 | Ga0466967_0011717 | 3300045976 | Bacteria | 6664 |
| 201 | Ga0495652_0008455 | 3300046529 | Bacteria | 9391 |
| 202 | Ga0495657_0058806 | 3300046675 | Bacteria | 2551 |
| 203 | Ga0495623_0014927 | 3300046679 | Bacteria | 5023 |
| 204 | Ga0495604_0018922 | 3300047317 | Bacteria | 5516 |
| 205 | Ga0495680_0033980 | 3300047322 | Bacteria | 4125 |
| 206 | Ga0495686_0001630 | 3300047472 | Bacteria | 23423 |
| 207 | Ga0495602_0062182 | 3300048088 | Bacteria | 3240 |
| 208 | Ga0496102_0012922 | 3300048905 | Bacteria | 7230 |
| 209 | Ga0496118_0000029 | 3300048921 | Bacteria | 340978 |
| 210 | Ga0496121_0000383 | 3300048924 | Bacteria | 90365 |
| 211 | Ga0496126_0001315 | 3300048929 | Bacteria | 39505 |
| 212 | Ga0496126_0001663 | 3300048929 | Bacteria | 33385 |
| 213 | Ga0495682_0000156 | 3300049460 | Bacteria | 57409 |
| 214 | Ga0501032_0001059 | 3300049569 | Bacteria | 21988 |
| 215 | Ga0501033_0007638 | 3300049570 | Bacteria | 8405 |
| 216 | Ga0501034_0006174 | 3300049571 | Bacteria | 12915 |
| 217 | Ga0501034_0045637 | 3300049571 | Bacteria | 4427 |
| 218 | Ga0501037_0000982 | 3300049573 | Bacteria | 21204 |
| 219 | Ga0501038_0035400 | 3300049574 | Bacteria | 4383 |
| 220 | Ga0501039_0004173 | 3300049575 | Bacteria | 10877 |
| 221 | Ga0501042_0057818 | 3300049578 | Bacteria | 2767 |
| 222 | Ga0501043_0002277 | 3300049579 | Bacteria | 16316 |
| 223 | Ga0501043_0024100 | 3300049579 | Bacteria | 4775 |
| 224 | Ga0501046_0001177 | 3300049580 | Bacteria | 25444 |
| 225 | Ga0501047_0021758 | 3300049581 | Bacteria | 6157 |
| 226 | Ga0501070_0000361 | 3300049586 | Bacteria | 41441 |
| 227 | Ga0501070_0010189 | 3300049586 | Bacteria | 7953 |
| 228 | Ga0501070_0019894 | 3300049586 | Bacteria | 5630 |
| 229 | Ga0501080_0116696 | 3300049742 | Bacteria | 2474 |
| 230 | Ga0501035_0006617 | 3300049822 | Bacteria | 10849 |
| 231 | Ga0501035_0008453 | 3300049822 | Bacteria | 9588 |
| 232 | Ga0501035_0011361 | 3300049822 | Bacteria | 8253 |
| 233 | Ga0501044_0000185 | 3300049823 | Bacteria | 77663 |
| 234 | Ga0501044_0003620 | 3300049823 | Bacteria | 17384 |
| 235 | Ga0501044_0097083 | 3300049823 | Bacteria | 2968 |
| 236 | 2512349797 | 2512047030 | Bacteria | 9031815 |
| 237 | 2515683220 | 2515154122 | Bacteria | 8609520 |
| 238 | 2515691785 | 2515154123 | Bacteria | 6387382 |
| 239 | 2516021887 | 2515154189 | Bacteria | 9629850 |
| 240 | 2548694184 | 2547132424 | Bacteria | 8348532 |
| 241 | 2671838246 | 2671180195 | Bacteria | 9757215 |
| 242 | 2713474307 | 2711768613 | Bacteria | 11048459 |
| 243 | 2774856402 | 2773857922 | Bacteria | 9757215 |
| 244 | 2774905954 | 2773857933 | Bacteria | 5818019 |
| 245 | 2792838012 | 2791355137 | Bacteria | 9654227 |
| 246 | 2885419026 | 2885409591 | Bacteria | 9235467 |
| 247 | 2900641631 | 2900634093 | Bacteria | 10263517 |
| 248 | 2902684101 | 2902682994 | Bacteria | 8951596 |
| 249 | 2904621301 | 2904615490 | Bacteria | 10047340 |
| 250 | 2904692195 | 2904690495 | Bacteria | 9412302 |
| 251 | 2908756733 | 2908756301 | Bacteria | 8864324 |
| 252 | 2921652154 | 2921643360 | Bacteria | 11448031 |
| 253 | 2935632554 | 2935630451 | Bacteria | 8169952 |
| 254 | Ga0466963_0005359 | |||
| 255 | JGI24735J21928_10003473 | |||
| 256 | JGI24735J21928_10003704 | |||
| 257 | JGI25156J39149_1001419 | |||
| 258 | JGI25156J39149_1001566 | |||
| 259 | JGI25162J39368_1000057 | |||
| 260 | Ga0055533_1000576 | |||
| 261 | Ga0055529_1001503 | |||
| 262 | Ga0055529_1001593 | |||
| 263 | Ga0070660_100003600 | |||
| 264 | Ga0070703_10001130 | |||
| 265 | Ga0070709_10000477 | |||
| 266 | Ga0070714_100014093 | |||
| 267 | Ga0070710_10001276 | |||
| 268 | Ga0070711_100002658 | |||
| 269 | Ga0070705_100005602 | |||
| 270 | Ga0070708_100000129 | |||
| 271 | Ga0070708_100002436 | |||
| 272 | Ga0070708_100006017 | |||
| 273 | Ga0070708_100009404 | |||
| 274 | Ga0070708_100014591 | |||
| 275 | Ga0070708_100025922 | |||
| 276 | Ga0070706_100000156 | |||
| 277 | Ga0070706_100000359 | |||
| 278 | Ga0070706_100002385 | |||
| 279 | Ga0070706_100004408 | |||
| 280 | Ga0070706_100007583 | |||
| 281 | Ga0070706_100024672 | |||
| 282 | Ga0070706_100054699 | |||
| 283 | Ga0070706_100076764 | |||
| 284 | Ga0070706_100129423 | |||
| 285 | Ga0070707_100000078 | |||
| 286 | Ga0070707_100005742 | |||
| 287 | Ga0070707_100014705 | |||
| 288 | Ga0070707_100070094 | |||
| 289 | Ga0070707_100128597 | |||
| 290 | Ga0070707_100186854 | |||
| 291 | Ga0070698_100000546 | |||
| 292 | Ga0070698_100001544 | |||
| 293 | Ga0070698_100002563 | |||
| 294 | Ga0070698_100020678 | |||
| 295 | Ga0070699_100000180 | |||
| 296 | Ga0070699_100000254 | |||
| 297 | Ga0070699_100110988 | |||
| 298 | Ga0070697_100005739 | |||
| 299 | Ga0068853_100043975 | |||
| 300 | Ga0070695_100069523 | |||
| 301 | Ga0068855_100133652 | |||
| 302 | Ga0070717_10006741 | |||
| 303 | Ga0070717_10007549 | |||
| 304 | Ga0070717_10011939 | |||
| 305 | Ga0070717_10019838 | |||
| 306 | Ga0070717_10039308 | |||
| 307 | Ga0070717_10102699 | |||
| 308 | Ga0070715_10001087 | |||
| 309 | Ga0070716_100000375 | |||
| 310 | Ga0099794_10000490 | |||
| 311 | Ga0099795_10004496 | |||
| 312 | Ga0105240_10011765 | |||
| 313 | Ga0105240_10015522 | |||
| 314 | Ga0105240_10102480 | |||
| 315 | Ga0114129_10085101 | |||
| 316 | Ga0105238_10000607 | |||
| 317 | Ga0105239_10005195 | |||
| 318 | Ga0157370_10006203 | |||
| 319 | Ga0157369_10001147 | |||
| 320 | Ga0157369_10042125 | |||
| 321 | Ga0157369_10108036 | |||
| 322 | Ga0157374_10000099 | |||
| 323 | Ga0157372_10010626 | |||
| 324 | Ga0206350_10342085 | |||
| 325 | Ga0213873_10000360 | |||
| 326 | Ga0213874_10002306 | |||
| 327 | Ga0213876_10000210 | |||
| 328 | Ga0213876_10002088 | |||
| 329 | Ga0213876_10008817 | |||
| 330 | Ga0213876_10015519 | |||
| 331 | Ga0213876_10018040 | |||
| 332 | Ga0213875_10000279 | |||
| 333 | Ga0213875_10002281 | |||
| 334 | Ga0213875_10003612 | |||
| 335 | Ga0213875_10027044 | |||
| 336 | Ga0213875_10035980 | |||
| 337 | Ga0224712_10000797 | |||
| 338 | Ga0209674_100155 | |||
| 339 | Ga0209759_1000138 | |||
| 340 | Ga0209759_1000629 | |||
| 341 | Ga0209759_1005100 | |||
| 342 | Ga0209455_1001046 | |||
| 343 | Ga0207692_10004706 | |||
| 344 | Ga0207647_10000404 | |||
| 345 | Ga0207685_10013608 | |||
| 346 | Ga0207699_10002363 | |||
| 347 | Ga0207684_10000001 | |||
| 348 | Ga0207684_10000227 | |||
| 349 | Ga0207684_10001806 | |||
| 350 | Ga0207684_10007147 | |||
| 351 | Ga0207684_10020721 | |||
| 352 | Ga0207684_10036516 | |||
| 353 | Ga0207695_10055128 | |||
| 354 | Ga0207695_10125063 | |||
| 355 | Ga0207693_10001158 | |||
| 356 | Ga0207663_10015444 | |||
| 357 | Ga0207646_10000179 | |||
| 358 | Ga0207646_10001770 | |||
| 359 | Ga0207646_10002450 | |||
| 360 | Ga0207646_10008258 | |||
| 361 | Ga0207646_10025330 | |||
| 362 | Ga0207646_10100421 | |||
| 363 | Ga0207646_10146611 | |||
| 364 | Ga0207694_10000606 | |||
| 365 | Ga0207700_10000238 | |||
| 366 | Ga0207700_10006863 | |||
| 367 | Ga0207664_10009747 | |||
| 368 | Ga0207665_10003356 | |||
| 369 | Ga0207667_10017107 | |||
| 370 | Ga0209588_1000080 | |||
| 371 | Ga0265319_1000005 | |||
| 372 | Ga0265319_1007621 | |||
| 373 | Ga0265318_10008565 | |||
| 374 | Ga0265328_10007113 | |||
| 375 | Ga0265320_10005006 | |||
| 376 | Ga0265327_10046372 | |||
| 377 | Ga0265313_10003668 | |||
| 378 | Ga0265314_10022378 | |||
| 379 | Ga0307516_10000090 | |||
| 380 | Ga0373926_0001355 | |||
| 381 | Ga0373946_0036467 | |||
| 382 | Ga0373935_0002415 | |||
| 383 | Ga0373947_0000116 | |||
| 384 | Ga0373937_0004780 | |||
| 385 | Ga0436364_0027415 | |||
| 386 | Ga0436364_0055978 | |||
| 387 | Ga0436364_0180436 | |||
| 388 | Ga0436364_0255791 | |||
| 389 | Ga0436364_0331112 | |||
| 390 | Ga0436364_0475204 | |||
| 391 | Ga0436364_0568088 | |||
| 392 | Ga0436364_0625242 | |||
| 393 | Ga0436364_0662184 | |||
| 394 | Ga0436364_0838356 | |||
| 395 | Ga0436364_1018655 | |||
| 396 | Ga0436364_1179679 | |||
| 397 | Ga0436364_1286189 | |||
| 398 | Ga0436364_1400872 | |||
| 399 | Ga0436364_1427311 | |||
| 400 | Ga0395901_0000175 | |||
| 401 | Ga0436365_0162783 | |||
| 402 | Ga0436365_0194503 | |||
| 403 | Ga0436365_0319629 | |||
| 404 | Ga0436365_0410802 | |||
| 405 | Ga0436365_0586833 | |||
| 406 | Ga0436365_0661858 | |||
| 407 | Ga0436365_0770655 | |||
| 408 | Ga0436365_0790255 | |||
| 409 | Ga0436365_0839251 | |||
| 410 | Ga0436365_0855511 | |||
| 411 | Ga0436365_0879956 | |||
| 412 | Ga0436365_1004005 | |||
| 413 | Ga0436365_1052963 | |||
| 414 | Ga0436365_1108994 | |||
| 415 | Ga0436360_0146478 | |||
| 416 | Ga0436360_0410502 | |||
| 417 | Ga0436360_0568566 | |||
| 418 | Ga0436360_0631804 | |||
| 419 | Ga0436361_0005423 | |||
| 420 | Ga0436361_0030069 | |||
| 421 | Ga0436361_0568170 | |||
| 422 | Ga0436361_0607739 | |||
| 423 | Ga0436363_0479513 | |||
| 424 | Ga0436363_0560615 | |||
| 425 | Ga0436363_1047748 | |||
| 426 | Ga0436363_1377054 | |||
| 427 | Ga0436363_1707842 | |||
| 428 | Ga0436362_0484241 | |||
| 429 | Ga0436362_1166649 | |||
| 430 | Ga0466969_0012804 | |||
| 431 | Ga0466969_0034304 | |||
| 432 | Ga0466966_0000895 | |||
| 433 | Ga0466966_0042776 | |||
| 434 | Ga0466961_0017796 | |||
| 435 | Ga0466961_0020397 | |||
| 436 | Ga0466963_0004669 | |||
| 437 | Ga0466963_0019692 | |||
| 438 | Ga0466971_0011749 | |||
| 439 | Ga0466971_0022755 | |||
| 440 | Ga0466971_0030835 | |||
| 441 | Ga0466971_0032914 | |||
| 442 | Ga0466968_0004398 | |||
| 443 | Ga0466957_0004441 | |||
| 444 | Ga0466959_0014719 | |||
| 445 | Ga0466958_0002264 | |||
| 446 | Ga0466958_0003985 | |||
| 447 | Ga0466958_0005853 | |||
| 448 | Ga0466958_0011705 | |||
| 449 | Ga0466958_0013898 | |||
| 450 | Ga0466958_0020342 | |||
| 451 | Ga0466958_0022456 | |||
| 452 | Ga0466967_0003233 | |||
| 453 | Ga0466967_0011717 | |||
| 454 | Ga0495652_0008455 | |||
| 455 | Ga0495657_0058806 | |||
| 456 | Ga0495623_0014927 | |||
| 457 | Ga0495604_0018922 | |||
| 458 | Ga0495680_0033980 | |||
| 459 | Ga0495686_0001630 | |||
| 460 | Ga0495602_0062182 | |||
| 461 | Ga0496102_0012922 | |||
| 462 | Ga0496118_0000029 | |||
| 463 | Ga0496121_0000383 | |||
| 464 | Ga0496126_0001315 | |||
| 465 | Ga0496126_0001663 | |||
| 466 | Ga0495682_0000156 | |||
| 467 | Ga0501032_0001059 | |||
| 468 | Ga0501033_0007638 | |||
| 469 | Ga0501034_0006174 | |||
| 470 | Ga0501034_0045637 | |||
| 471 | Ga0501037_0000982 | |||
| 472 | Ga0501038_0035400 | |||
| 473 | Ga0501039_0004173 | |||
| 474 | Ga0501042_0057818 | |||
| 475 | Ga0501043_0002277 | |||
| 476 | Ga0501043_0024100 | |||
| 477 | Ga0501046_0001177 | |||
| 478 | Ga0501047_0021758 | |||
| 479 | Ga0501070_0000361 | |||
| 480 | Ga0501070_0010189 | |||
| 481 | Ga0501070_0019894 | |||
| 482 | Ga0501080_0116696 | |||
| 483 | Ga0501035_0006617 | |||
| 484 | Ga0501035_0008453 | |||
| 485 | Ga0501035_0011361 | |||
| 486 | Ga0501044_0000185 | |||
| 487 | Ga0501044_0003620 | |||
| 488 | Ga0501044_0097083 | |||
| 489 | 2512349797 | |||
| 490 | 2515683220 | |||
| 491 | 2515691785 | |||
| 492 | 2516021887 | |||
| 493 | 2548694184 | |||
| 494 | 2671838246 | |||
| 495 | 2713474307 | |||
| 496 | 2774856402 | |||
| 497 | 2774905954 | |||
| 498 | 2792838012 | |||
| 499 | 2885419026 | |||
| 500 | 2900641631 | |||
| 501 | 2902684101 | |||
| 502 | 2904621301 | |||
| 503 | 2904692195 | |||
| 504 | 2908756733 | |||
| 505 | 2921652154 | |||
| 506 | 2935632554 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e6n-assembly1.cif.gz_A | x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state | 0.8902 | 55 | 451 |
| 8e6n-assembly1.cif.gz_A | x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter g223w mutant in an outward-open, manganese-bound state | 0.8711 | 55 | 451 |
| 7qia-assembly1.cif.gz_A | structure of apo-elenrmt in complex with two nanobodies at 3.5a | 0.8631 | 55 | 456 |
| 7qia-assembly1.cif.gz_A | structure of apo-elenrmt in complex with two nanobodies at 3.5a | 0.8531 | 55 | 456 |
| 8e5v-assembly1.cif.gz_A | x-ray structure of the deinococcus radiodurans nramp/mnth divalent transition metal transporter wtsoak in an occluded state | 0.8242 | 60 | 451 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6F612_111_472_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8806 | 77 | 431 | 1.20.1740.10 |
| af_I1J9B4_68_431_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8634 | 76 | 430 | 1.20.1740.10 |
| af_A0A1D6F612_111_472_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8622 | 77 | 431 | 1.20.1740.10 |
| af_Q95XG8_64_454_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8586 | 77 | 431 | 1.20.1740.10 |
| af_P9WIZ5_52_401_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.8576 | 77 | 430 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F0FXI0-F1-model_v4 | Manganese transporter NRAMP | 0.9809 | 22 | 322 |
GO:0005384
GO:0005886 GO:0012505 GO:0015086 GO:0015293 GO:0034755 |
| AF-F0FXI0-F1-model_v4 | Manganese transporter NRAMP | 0.9745 | 22 | 322 |
GO:0005384
GO:0005886 GO:0012505 GO:0015086 GO:0015293 GO:0034755 |
| AF-A0A7C4IMF7-F1-model_v4 | Divalent metal cation transporter | 0.962 | 47 | 340 |
GO:0005384
GO:0005886 GO:0012505 GO:0015086 GO:0034755 |
| AF-A0A7C4IMF7-F1-model_v4 | Divalent metal cation transporter | 0.9523 | 47 | 340 |
GO:0005384
GO:0005886 GO:0012505 GO:0015086 GO:0034755 |
| AF-A0A2Z3R0J4-F1-model_v4 | Divalent metal cation transporter | 0.9502 | 42 | 460 |
GO:0005384
GO:0005886 GO:0012505 GO:0015086 GO:0015293 GO:0034755 |