F364265

General Info

Members Datasets Scaffolds Average Seq Length
253 147 506 227

Family's Representative Sequence

Representative Sequence 3300042009|Ga0439451_018716|Ga0439451_018716_581_1264
Length 227
Sequence VPGPLAPTIGWNVVHLFCAATTAADAGAIAAAVKSLEADEHQVVPVAVVGHKADLCLLALGPDLWRLRRFQTEIVAAGLGVVDSYVSLTEVSEYAEGMPEERKQARLYPRLPPEGKPAFCFYPMSKRRGQDNWYELPYEARERLMLGHGGVGRTFAGRVLQLVTGSTGIDDYEWGVTLFAVHPDDLKQCVYTMRFDEASARYAEFGPFVTGVVGTLDEVLAATGVAG

Samples

Sample ID Description Type Environment
1 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
9 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
31 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
53 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
56 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
57 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
66 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
67 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
70 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
71 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.16
Nodule 0
Rhizoplane 4.35
Rhizosphere 88.54
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439451_018716 3300042009 Bacteria 1398
2 JGI25407J50210_10000054 3300003373 Bacteria 13615
3 JGI25405J52794_10074445 3300003911 Bacteria 743
4 Ga0070671_100031558 3300005355 Bacteria 4377
5 Ga0070713_100588703 3300005436 Unclassified 1056
6 Ga0070678_100531222 3300005456 Bacteria 1042
7 Ga0070678_100551812 3300005456 Bacteria 1023
8 Ga0070706_100081403 3300005467 Bacteria 2998
9 Ga0068858_100029178 3300005842 Bacteria 5122
10 Ga0068860_100030559 3300005843 Bacteria 5180
11 Ga0081455_10001335 3300005937 Bacteria 30513
12 Ga0081455_10008669 3300005937 Bacteria 10533
13 Ga0081455_10045217 3300005937 Bacteria 3832
14 Ga0081455_10180644 3300005937 Unclassified 1598
15 Ga0081455_10321693 3300005937 Bacteria 1101
16 Ga0081538_10000054 3300005981 Bacteria 107029
17 Ga0081538_10000996 3300005981 Bacteria 30100
18 Ga0081538_10046646 3300005981 Bacteria 2669
19 Ga0075365_10292993 3300006038 Bacteria 1145
20 Ga0075365_10316947 3300006038 Bacteria 1098
21 Ga0075362_10157220 3300006177 Bacteria 1093
22 Ga0075367_10124214 3300006178 Bacteria 1592
23 Ga0075428_100000001 3300006844 Bacteria 772630
24 Ga0075428_100001045 3300006844 Bacteria 29392
25 Ga0075428_100065314 3300006844 Bacteria 3984
26 Ga0075428_100159259 3300006844 Bacteria 2451
27 Ga0075428_100232781 3300006844 Archaea 1988
28 Ga0075430_100001313 3300006846 Bacteria 20062
29 Ga0075430_100005105 3300006846 Bacteria 11051
30 Ga0075430_100059286 3300006846 Bacteria 3218
31 Ga0075430_100103449 3300006846 Bacteria 2377
32 Ga0075430_100172513 3300006846 Bacteria 1799
33 Ga0075431_100000292 3300006847 Bacteria 39252
34 Ga0075431_100232335 3300006847 Bacteria 1878
35 Ga0075433_10538645 3300006852 Archaea 1027
36 Ga0075429_100000239 3300006880 Bacteria 37819
37 Ga0075429_100011549 3300006880 Bacteria 7659
38 Ga0075429_100034960 3300006880 Bacteria 4367
39 Ga0111539_10002903 3300009094 Bacteria 22754
40 Ga0111539_10047119 3300009094 Bacteria 5153
41 Ga0111539_10061396 3300009094 Bacteria 4453
42 Ga0111539_10224375 3300009094 Archaea 2189
43 Ga0114129_10000630 3300009147 Bacteria 43905
44 Ga0114129_10039452 3300009147 Bacteria 6657
45 Ga0114129_10469600 3300009147 Bacteria 1648
46 Ga0114129_10486468 3300009147 Bacteria 1614
47 Ga0114129_11706981 3300009147 Bacteria 768
48 Ga0105248_11472936 3300009177 Bacteria 770
49 Ga0105238_10319366 3300009551 Bacteria 1539
50 Ga0105249_10644346 3300009553 Bacteria 1117
51 Ga0163162_10348236 3300013306 Bacteria 1614
52 Ga0163162_10794790 3300013306 Bacteria 1064
53 Ga0157372_11260823 3300013307 Archaea 853
54 Ga0157375_10174917 3300013308 Bacteria 2296
55 Ga0157375_11060886 3300013308 Bacteria 947
56 Ga0157379_10898674 3300014968 Archaea 840
57 Ga0163161_10364828 3300017792 Bacteria 1151
58 Ga0213873_10047169 3300021358 Archaea 1129
59 Ga0213876_10010489 3300021384 Bacteria 4969
60 Ga0213875_10062753 3300021388 Unclassified 1738
61 Ga0224572_1001384 3300024225 Bacteria 3560
62 Ga0207684_10071817 3300025910 Bacteria 2940
63 Ga0207652_10417175 3300025921 Unclassified 1211
64 Ga0207650_10040106 3300025925 Archaea 3425
65 Ga0207687_10269847 3300025927 Bacteria 1360
66 Ga0207709_10120669 3300025935 Bacteria 1769
67 Ga0207703_10008492 3300026035 Bacteria 8115
68 Ga0207702_10698436 3300026078 Bacteria 1000
69 Ga0207683_10115393 3300026121 Bacteria 2407
70 Ga0207683_10244603 3300026121 Bacteria 1636
71 Ga0207428_10174519 3300027907 Bacteria 1626
72 Ga0207428_10294987 3300027907 Bacteria 1201
73 Ga0268264_10004377 3300028381 Bacteria 12054
74 Ga0265338_10054089 3300028800 Bacteria 3584
75 Ga0265327_10093674 3300031251 Bacteria 1461
76 Ga0316575_10032796 3300031665 Bacteria 2036
77 Ga0316578_10001513 3300031728 Bacteria 9526
78 Ga0316577_10112732 3300031733 Bacteria 1526
79 Ga0307407_10200779 3300031903 Bacteria 1336
80 Ga0307409_100023210 3300031995 Bacteria 4293
81 Ga0307415_100033180 3300032126 Bacteria 3350
82 Ga0316585_10035503 3300032137 Bacteria 1579
83 Ga0373939_0152593 3300035114 Bacteria 842
84 Ga0373956_0117527 3300035119 Bacteria 1241
85 Ga0373955_0079395 3300035172 Bacteria 1851
86 Ga0373933_0114561 3300035724 Bacteria 1684
87 Ga0373937_0137431 3300036401 Bacteria 2285
88 Ga0316582_0038300 3300036647 Bacteria 2979
89 Ga0316584_0005439 3300036712 Bacteria 8547
90 Ga0316584_0205282 3300036712 Bacteria 1452
91 Ga0436364_0356959 3300037853 Unclassified 2130
92 Ga0400483_044090 3300039062 Bacteria 76499
93 Ga0400483_144313 3300039062 Bacteria 7546
94 Ga0400483_151348 3300039062 Bacteria 2586
95 Ga0400483_237049 3300039062 Bacteria 60745
96 Ga0436365_0504900 3300039437 Bacteria 12748
97 Ga0436360_0520537 3300039438 Bacteria 1424
98 Ga0436360_1054650 3300039438 Bacteria 3124
99 Ga0436361_0290960 3300039447 Bacteria 1753
100 Ga0436362_0008978 3300039453 Bacteria 1111
101 Ga0436362_0784066 3300039453 Archaea 1563
102 Ga0451837_0178577 3300041494 Bacteria 1434
103 Ga0451847_1008836 3300041503 Bacteria 979
104 Ga0439448_0008473 3300042005 Bacteria 3011
105 Ga0439450_002113 3300042008 Bacteria 3062
106 Ga0450923_053211 3300042125 Bacteria 873
107 Ga0439440_0004072 3300042993 Bacteria 2857
108 Ga0466966_0417497 3300044684 Archaea 806
109 Ga0466963_0334534 3300044694 Bacteria 1066
110 Ga0466967_0381908 3300045976 Bacteria 1368
111 Ga0495592_0218426 3300046454 Archaea 1276
112 Ga0495629_0107933 3300046459 Unclassified 1942
113 Ga0495651_0010970 3300046462 Bacteria 6972
114 Ga0495653_0030313 3300046463 Bacteria 4310
115 Ga0495653_0085742 3300046463 Bacteria 2316
116 Ga0495608_0010320 3300046511 Bacteria 6518
117 Ga0495608_0054305 3300046511 Bacteria 2648
118 Ga0495628_0153184 3300046516 Bacteria 1755
119 Ga0495630_0038963 3300046517 Bacteria 3555
120 Ga0495587_0063912 3300046536 Bacteria 2151
121 Ga0495667_0009747 3300046559 Bacteria 6510
122 Ga0495656_0164287 3300046615 Archaea 1081
123 Ga0495635_0105165 3300046663 Bacteria 1929
124 Ga0495657_0182055 3300046675 Archaea 1289
125 Ga0495599_0542053 3300046678 Unclassified 682
126 Ga0495623_0024257 3300046679 Bacteria 3910
127 Ga0495613_0082566 3300046689 Bacteria 2334
128 Ga0495600_0430939 3300046809 Bacteria 817
129 Ga0495604_0122979 3300047317 Bacteria 1876
130 Ga0495672_0001179 3300047320 Bacteria 26520
131 Ga0495680_0096196 3300047322 Bacteria 2212
132 Ga0495675_0222892 3300047444 Bacteria 1140
133 Ga0495684_0360612 3300047471 Bacteria 1030
134 Ga0495602_0161254 3300048088 Bacteria 1750
135 Ga0496102_0701086 3300048905 Archaea 935
136 Ga0496103_0257945 3300048906 Bacteria 1122
137 Ga0496108_0114319 3300048911 Bacteria 2310
138 Ga0496108_0766133 3300048911 Bacteria 834
139 Ga0496109_0196773 3300048912 Bacteria 1895
140 Ga0496110_0632467 3300048913 Bacteria 969
141 Ga0496111_0206801 3300048914 Bacteria 1459
142 Ga0496111_0450402 3300048914 Archaea 950
143 Ga0496114_0160556 3300048917 Bacteria 1954
144 Ga0496114_0299432 3300048917 Bacteria 1420
145 Ga0496115_0298699 3300048918 Bacteria 1320
146 Ga0501033_0021872 3300049570 Bacteria 4826
147 Ga0501036_0235891 3300049572 Bacteria 1534
148 Ga0501037_0122838 3300049573 Bacteria 1866
149 Ga0501038_0330599 3300049574 Bacteria 1190
150 Ga0501039_0024339 3300049575 Bacteria 4650
151 Ga0501040_0000617 3300049576 Bacteria 21773
152 Ga0501040_0007222 3300049576 Bacteria 7197
153 Ga0501041_0006546 3300049577 Bacteria 6822
154 Ga0501041_0011830 3300049577 Bacteria 5165
155 Ga0501042_0009610 3300049578 Bacteria 6455
156 Ga0501042_0054980 3300049578 Bacteria 2840
157 Ga0501042_0522368 3300049578 Bacteria 862
158 Ga0501042_0755834 3300049578 Bacteria 707
159 Ga0501043_0107038 3300049579 Bacteria 2196
160 Ga0501046_0004331 3300049580 Bacteria 12918
161 Ga0501048_0009766 3300049582 Bacteria 7195
162 Ga0501048_0026337 3300049582 Bacteria 4234
163 Ga0501048_0409921 3300049582 Bacteria 969
164 Ga0501048_0513871 3300049582 Bacteria 859
165 Ga0501068_0014043 3300049584 Bacteria 4571
166 Ga0501068_0018206 3300049584 Bacteria 4068
167 Ga0501068_0040550 3300049584 Bacteria 2796
168 Ga0501069_0001741 3300049585 Bacteria 10854
169 Ga0501070_0003006 3300049586 Bacteria 14674
170 Ga0501071_0006528 3300049587 Bacteria 7574
171 Ga0501071_0021697 3300049587 Bacteria 4476
172 Ga0501071_0115769 3300049587 Bacteria 1984
173 Ga0501072_0004164 3300049588 Bacteria 10947
174 Ga0501072_0005719 3300049588 Bacteria 9469
175 Ga0501072_0019939 3300049588 Bacteria 5190
176 Ga0501072_0105958 3300049588 Bacteria 2236
177 Ga0501074_0015804 3300049590 Bacteria 5488
178 Ga0501074_0024200 3300049590 Bacteria 4413
179 Ga0501074_0070754 3300049590 Bacteria 2508
180 Ga0501075_0018537 3300049591 Bacteria 5038
181 Ga0501075_0083778 3300049591 Bacteria 2415
182 Ga0501075_0093727 3300049591 Bacteria 2279
183 Ga0501075_0535404 3300049591 Bacteria 894
184 Ga0501076_0010728 3300049592 Bacteria 6811
185 Ga0501076_0173233 3300049592 Unclassified 1759
186 Ga0501076_0192979 3300049592 Bacteria 1662
187 Ga0501077_0000500 3300049593 Bacteria 23803
188 Ga0501077_0013795 3300049593 Bacteria 5068
189 Ga0501079_0001377 3300049741 Bacteria 17127
190 Ga0501079_0074088 3300049741 Bacteria 2632
191 Ga0501079_0250007 3300049741 Bacteria 1386
192 Ga0501080_0077544 3300049742 Bacteria 3091
193 Ga0501080_0416989 3300049742 Bacteria 1206
194 Ga0501081_0002228 3300049743 Bacteria 12196
195 Ga0501081_0044246 3300049743 Bacteria 3056
196 Ga0501081_0754144 3300049743 Bacteria 731
197 Ga0501083_0005335 3300049744 Bacteria 9094
198 Ga0501035_0234450 3300049822 Bacteria 1563
199 Ga0501045_0006470 3300049824 Bacteria 8116
200 Ga0501045_0135252 3300049824 Bacteria 1833
201 Ga0501045_0502955 3300049824 Bacteria 900
202 nmdc:mga00v17_59590_c1 3300050491 Bacteria 2343
203 nmdc:mga0yw44_310887_c1 3300050492 Bacteria 1057
204 nmdc:mga05p37_1148590_c1 3300050507 Bacteria 808
205 nmdc:mga05p37_151344_c1 3300050507 Bacteria 2838
206 nmdc:mga05p37_196083_c1 3300050507 Bacteria 2449
207 nmdc:mga05p37_242229_c1 3300050507 Bacteria 2168
208 nmdc:mga05p37_2880_c1 3300050507 Bacteria 19975
209 nmdc:mga05p37_496632_c1 3300050507 Bacteria 1402
210 nmdc:mga05p37_698731_c1 3300050507 Bacteria 1127
211 nmdc:mga09592_101850_c1 3300050508 Bacteria 2460
212 nmdc:mga09592_1018_c1 3300050508 Bacteria 22263
213 nmdc:mga09592_16883_c1 3300050508 Bacteria 5973
214 nmdc:mga09592_454936_c1 3300050508 Bacteria 1104
215 nmdc:mga09592_64687_c1 3300050508 Bacteria 3097
216 nmdc:mga0qj67_112742_c1 3300050509 Bacteria 2195
217 nmdc:mga0qj67_1575_c1 3300050509 Bacteria 16033
218 nmdc:mga0qj67_26085_c1 3300050509 Bacteria 4523
219 nmdc:mga0qj67_29778_c1 3300050509 Bacteria 4242
220 nmdc:mga0qj67_77890_c1 3300050509 Bacteria 2653
221 nmdc:mga06r32_187655_c1 3300050510 Unclassified 2055
222 nmdc:mga06r32_24287_c1 3300050510 Bacteria 5623
223 nmdc:mga06r32_308299_c1 3300050510 Bacteria 1568
224 nmdc:mga06r32_394832_c1 3300050510 Bacteria 1365
225 nmdc:mga06r32_5360_c1 3300050510 Bacteria 11543
226 nmdc:mga08y16_1236859_c1 3300050511 Archaea 716
227 nmdc:mga08y16_169911_c1 3300050511 Bacteria 2265
228 nmdc:mga08y16_39710_c1 3300050511 Bacteria 4936
229 nmdc:mga0n895_681092_c1 3300050512 Archaea 1025
230 nmdc:mga0rr50_916116_c1 3300050513 Archaea 747
231 Ga0495612_0096666 3300053078 Bacteria 1255
232 Ga0495595_0039534 3300053084 Bacteria 2152
233 Ga0495595_0063321 3300053084 Unclassified 1736
234 Ga0495595_0330002 3300053084 Bacteria 769
235 Ga0495619_0018439 3300053085 Bacteria 4428
236 Ga0495619_0038510 3300053085 Bacteria 3119
237 Ga0495619_0353808 3300053085 Archaea 1016
238 Ga0500568_0000011 3300053139 Bacteria 248947
239 Ga0500616_0000211 3300053153 Bacteria 93551
240 Ga0501084_0008378 3300054114 Bacteria 8537
241 Ga0501084_0016060 3300054114 Bacteria 6215
242 Ga0501084_0017711 3300054114 Bacteria 5927
243 Ga0501084_0215164 3300054114 Bacteria 1621
244 Ga0501082_0007436 3300060353 Bacteria 9451
245 Ga0501082_0024851 3300060353 Bacteria 5163
246 Ga0501082_0169991 3300060353 Bacteria 1895
247 Ga0501082_0238334 3300060353 Bacteria 1583
248 Ga0501082_0288235 3300060353 Bacteria 1429
249 Ga0501082_0314805 3300060353 Bacteria 1363
250 Ga0501082_0789535 3300060353 Bacteria 831
251 Ga0530510_0024166 3300061734 Bacteria 4335
252 Ga0530510_0048236 3300061734 Bacteria 3078
253 Ga0530510_0106821 3300061734 Bacteria 2048
254 Ga0439451_018716
255 JGI25407J50210_10000054
256 JGI25405J52794_10074445
257 Ga0070671_100031558
258 Ga0070713_100588703
259 Ga0070678_100531222
260 Ga0070678_100551812
261 Ga0070706_100081403
262 Ga0068858_100029178
263 Ga0068860_100030559
264 Ga0081455_10001335
265 Ga0081455_10008669
266 Ga0081455_10045217
267 Ga0081455_10180644
268 Ga0081455_10321693
269 Ga0081538_10000054
270 Ga0081538_10000996
271 Ga0081538_10046646
272 Ga0075365_10292993
273 Ga0075365_10316947
274 Ga0075362_10157220
275 Ga0075367_10124214
276 Ga0075428_100000001
277 Ga0075428_100001045
278 Ga0075428_100065314
279 Ga0075428_100159259
280 Ga0075428_100232781
281 Ga0075430_100001313
282 Ga0075430_100005105
283 Ga0075430_100059286
284 Ga0075430_100103449
285 Ga0075430_100172513
286 Ga0075431_100000292
287 Ga0075431_100232335
288 Ga0075433_10538645
289 Ga0075429_100000239
290 Ga0075429_100011549
291 Ga0075429_100034960
292 Ga0111539_10002903
293 Ga0111539_10047119
294 Ga0111539_10061396
295 Ga0111539_10224375
296 Ga0114129_10000630
297 Ga0114129_10039452
298 Ga0114129_10469600
299 Ga0114129_10486468
300 Ga0114129_11706981
301 Ga0105248_11472936
302 Ga0105238_10319366
303 Ga0105249_10644346
304 Ga0163162_10348236
305 Ga0163162_10794790
306 Ga0157372_11260823
307 Ga0157375_10174917
308 Ga0157375_11060886
309 Ga0157379_10898674
310 Ga0163161_10364828
311 Ga0213873_10047169
312 Ga0213876_10010489
313 Ga0213875_10062753
314 Ga0224572_1001384
315 Ga0207684_10071817
316 Ga0207652_10417175
317 Ga0207650_10040106
318 Ga0207687_10269847
319 Ga0207709_10120669
320 Ga0207703_10008492
321 Ga0207702_10698436
322 Ga0207683_10115393
323 Ga0207683_10244603
324 Ga0207428_10174519
325 Ga0207428_10294987
326 Ga0268264_10004377
327 Ga0265338_10054089
328 Ga0265327_10093674
329 Ga0316575_10032796
330 Ga0316578_10001513
331 Ga0316577_10112732
332 Ga0307407_10200779
333 Ga0307409_100023210
334 Ga0307415_100033180
335 Ga0316585_10035503
336 Ga0373939_0152593
337 Ga0373956_0117527
338 Ga0373955_0079395
339 Ga0373933_0114561
340 Ga0373937_0137431
341 Ga0316582_0038300
342 Ga0316584_0005439
343 Ga0316584_0205282
344 Ga0436364_0356959
345 Ga0400483_044090
346 Ga0400483_144313
347 Ga0400483_151348
348 Ga0400483_237049
349 Ga0436365_0504900
350 Ga0436360_0520537
351 Ga0436360_1054650
352 Ga0436361_0290960
353 Ga0436362_0008978
354 Ga0436362_0784066
355 Ga0451837_0178577
356 Ga0451847_1008836
357 Ga0439448_0008473
358 Ga0439450_002113
359 Ga0450923_053211
360 Ga0439440_0004072
361 Ga0466966_0417497
362 Ga0466963_0334534
363 Ga0466967_0381908
364 Ga0495592_0218426
365 Ga0495629_0107933
366 Ga0495651_0010970
367 Ga0495653_0030313
368 Ga0495653_0085742
369 Ga0495608_0010320
370 Ga0495608_0054305
371 Ga0495628_0153184
372 Ga0495630_0038963
373 Ga0495587_0063912
374 Ga0495667_0009747
375 Ga0495656_0164287
376 Ga0495635_0105165
377 Ga0495657_0182055
378 Ga0495599_0542053
379 Ga0495623_0024257
380 Ga0495613_0082566
381 Ga0495600_0430939
382 Ga0495604_0122979
383 Ga0495672_0001179
384 Ga0495680_0096196
385 Ga0495675_0222892
386 Ga0495684_0360612
387 Ga0495602_0161254
388 Ga0496102_0701086
389 Ga0496103_0257945
390 Ga0496108_0114319
391 Ga0496108_0766133
392 Ga0496109_0196773
393 Ga0496110_0632467
394 Ga0496111_0206801
395 Ga0496111_0450402
396 Ga0496114_0160556
397 Ga0496114_0299432
398 Ga0496115_0298699
399 Ga0501033_0021872
400 Ga0501036_0235891
401 Ga0501037_0122838
402 Ga0501038_0330599
403 Ga0501039_0024339
404 Ga0501040_0000617
405 Ga0501040_0007222
406 Ga0501041_0006546
407 Ga0501041_0011830
408 Ga0501042_0009610
409 Ga0501042_0054980
410 Ga0501042_0522368
411 Ga0501042_0755834
412 Ga0501043_0107038
413 Ga0501046_0004331
414 Ga0501048_0009766
415 Ga0501048_0026337
416 Ga0501048_0409921
417 Ga0501048_0513871
418 Ga0501068_0014043
419 Ga0501068_0018206
420 Ga0501068_0040550
421 Ga0501069_0001741
422 Ga0501070_0003006
423 Ga0501071_0006528
424 Ga0501071_0021697
425 Ga0501071_0115769
426 Ga0501072_0004164
427 Ga0501072_0005719
428 Ga0501072_0019939
429 Ga0501072_0105958
430 Ga0501074_0015804
431 Ga0501074_0024200
432 Ga0501074_0070754
433 Ga0501075_0018537
434 Ga0501075_0083778
435 Ga0501075_0093727
436 Ga0501075_0535404
437 Ga0501076_0010728
438 Ga0501076_0173233
439 Ga0501076_0192979
440 Ga0501077_0000500
441 Ga0501077_0013795
442 Ga0501079_0001377
443 Ga0501079_0074088
444 Ga0501079_0250007
445 Ga0501080_0077544
446 Ga0501080_0416989
447 Ga0501081_0002228
448 Ga0501081_0044246
449 Ga0501081_0754144
450 Ga0501083_0005335
451 Ga0501035_0234450
452 Ga0501045_0006470
453 Ga0501045_0135252
454 Ga0501045_0502955
455 nmdc:mga00v17_59590_c1
456 nmdc:mga0yw44_310887_c1
457 nmdc:mga05p37_1148590_c1
458 nmdc:mga05p37_151344_c1
459 nmdc:mga05p37_196083_c1
460 nmdc:mga05p37_242229_c1
461 nmdc:mga05p37_2880_c1
462 nmdc:mga05p37_496632_c1
463 nmdc:mga05p37_698731_c1
464 nmdc:mga09592_101850_c1
465 nmdc:mga09592_1018_c1
466 nmdc:mga09592_16883_c1
467 nmdc:mga09592_454936_c1
468 nmdc:mga09592_64687_c1
469 nmdc:mga0qj67_112742_c1
470 nmdc:mga0qj67_1575_c1
471 nmdc:mga0qj67_26085_c1
472 nmdc:mga0qj67_29778_c1
473 nmdc:mga0qj67_77890_c1
474 nmdc:mga06r32_187655_c1
475 nmdc:mga06r32_24287_c1
476 nmdc:mga06r32_308299_c1
477 nmdc:mga06r32_394832_c1
478 nmdc:mga06r32_5360_c1
479 nmdc:mga08y16_1236859_c1
480 nmdc:mga08y16_169911_c1
481 nmdc:mga08y16_39710_c1
482 nmdc:mga0n895_681092_c1
483 nmdc:mga0rr50_916116_c1
484 Ga0495612_0096666
485 Ga0495595_0039534
486 Ga0495595_0063321
487 Ga0495595_0330002
488 Ga0495619_0018439
489 Ga0495619_0038510
490 Ga0495619_0353808
491 Ga0500568_0000011
492 Ga0500616_0000211
493 Ga0501084_0008378
494 Ga0501084_0016060
495 Ga0501084_0017711
496 Ga0501084_0215164
497 Ga0501082_0007436
498 Ga0501082_0024851
499 Ga0501082_0169991
500 Ga0501082_0238334
501 Ga0501082_0288235
502 Ga0501082_0314805
503 Ga0501082_0789535
504 Ga0530510_0024166
505 Ga0530510_0048236
506 Ga0530510_0106821

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06778

Chlor_dismutase

Chlorite dismutase

22

214

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5t2k-assembly1.cif.gz_D geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.8824 2 212
6fxj-assembly1.cif.gz_A structure of coproheme decarboxylase from listeria monocytogenes in complex with iron coproporphyrin iii 0.8743 2 213
5t2k-assembly1.cif.gz_C geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.8704 2 212
5t2k-assembly1.cif.gz_E geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.8693 2 212
5t2k-assembly1.cif.gz_B geobacillus stearothermophilus hemq with manganese-coproporphyrin iii 0.8661 2 212
ID Description Score Start End Superfamily
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.9218 103 214 3.30.70.1030
5loqB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.914 103 214 3.30.70.1030
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8773 105 210 3.30.70.1030
1vdhA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8718 91 214 3.30.70.1030
af_P9WL45_128_230_3.30.70.1030 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.8542 105 210 3.30.70.1030
ID Description Score Start End GO Terms
AF-A0A351EXF3-F1-model_v4 Chlorite dismutase 0.9875 2 141 GO:0016491
GO:0020037
GO:0046872
AF-A0A3C1CG82-F1-model_v4 Chlorite dismutase 0.984 1 183 GO:0016491
GO:0020037
GO:0046872
AF-A0A7K1CSG4-F1-model_v4 Chlorite dismutase 0.9831 2 209 GO:0016491
GO:0020037
GO:0046872
AF-A0A3C2DGP1-F1-model_v4 Chlorite dismutase 0.983 2 163 GO:0016491
GO:0020037
GO:0046872
AF-A0A7K0MM39-F1-model_v4 Chlorite dismutase 0.9821 33 206 GO:0016491
GO:0020037
GO:0046872

Map