F364255

General Info

Members Datasets Scaffolds Average Seq Length
253 139 506 158

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0525893|Ga0436362_0525893_2863_3435
Length 190
Sequence VARVAAIQGTRAGRPEAPNAGAGGRPGGTSMEGWMKLSDFVIPEAIIVDLRATGKEDAIREIVRSLCQAGRLAEGDLDSVARAILGREELGSTGIGQGVAVPHTRHPTVNRLIGTVALSRRGVNFAALDGEPVDILFLLISPPNQPGDHLRALENISRHLKDERFVNFLRQAKDRENVIELLEEADQGTP

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
41 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
45 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
86 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
137 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
138 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
139 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.87
Metatranscriptomes 20.55
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 4.74
Rhizosphere 89.72
Stem 0
Stem Tuber 0
Unclassified 22.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0525893 3300039453 Bacteria 4343
2 Ga0007409J51694_1052124 3300003575 Bacteria 598
3 Ga0058863_10034875 3300004799 Bacteria 2508
4 Ga0058861_11990819 3300004800 Bacteria 1711
5 Ga0058862_12559861 3300004803 Bacteria 771
6 Ga0058862_12621720 3300004803 Bacteria 1669
7 Ga0058862_12707046 3300004803 Bacteria 1442
8 Ga0058862_12754334 3300004803 Bacteria 1339
9 Ga0065704_10075282 3300005289 Bacteria 5680
10 Ga0065707_10111934 3300005295 Bacteria 2378
11 Ga0070689_100216452 3300005340 Unclassified 1570
12 Ga0070675_100425321 3300005354 Unclassified 1188
13 Ga0070659_101203259 3300005366 Bacteria 670
14 Ga0070711_100814053 3300005439 Bacteria 793
15 Ga0070663_101863553 3300005455 Bacteria 540
16 Ga0070685_10424951 3300005466 Unclassified 925
17 Ga0070698_100228484 3300005471 Bacteria 1794
18 Ga0070679_100493219 3300005530 Bacteria 1169
19 Ga0070679_102095083 3300005530 Bacteria 515
20 Ga0070684_101389790 3300005535 Bacteria 661
21 Ga0070665_100000526 3300005548 Bacteria 54616
22 Ga0070665_100342122 3300005548 Bacteria 1501
23 Ga0070665_100407825 3300005548 Unclassified 1367
24 Ga0070665_101261983 3300005548 Bacteria 749
25 Ga0068852_102219790 3300005616 Bacteria 570
26 Ga0068864_100289171 3300005618 Unclassified 1532
27 Ga0068864_101007811 3300005618 Unclassified 826
28 Ga0068866_10808684 3300005718 Bacteria 652
29 Ga0068861_101457326 3300005719 Bacteria 670
30 Ga0068858_100810079 3300005842 Bacteria 914
31 Ga0068858_100848452 3300005842 Unclassified 892
32 Ga0081455_10041773 3300005937 Bacteria 4029
33 Ga0081455_10415271 3300005937 Unclassified 930
34 Ga0081455_10725837 3300005937 Unclassified 630
35 Ga0075367_10564034 3300006178 Bacteria 723
36 Ga0075428_100012543 3300006844 Bacteria 9423
37 Ga0075428_100049400 3300006844 Bacteria 4615
38 Ga0075430_101000119 3300006846 Bacteria 689
39 Ga0111539_10312307 3300009094 Bacteria 1830
40 Ga0111539_11317220 3300009094 Bacteria 838
41 Ga0105245_11614143 3300009098 Unclassified 700
42 Ga0105247_10124349 3300009101 Bacteria 1675
43 Ga0114129_11567911 3300009147 Bacteria 807
44 Ga0105243_11151871 3300009148 Unclassified 786
45 Ga0105241_11445859 3300009174 Unclassified 660
46 Ga0105248_10103797 3300009177 Bacteria 3204
47 Ga0105248_12369796 3300009177 Unclassified 605
48 Ga0105249_10085873 3300009553 Bacteria 2933
49 Ga0105249_10283643 3300009553 Bacteria 1655
50 Ga0105249_11019438 3300009553 Bacteria 897
51 Ga0105249_11203910 3300009553 Unclassified 828
52 Ga0105249_13357771 3300009553 Unclassified 515
53 Ga0105246_10544545 3300011119 Bacteria 993
54 Ga0157370_10668199 3300013104 Bacteria 949
55 Ga0163162_10609856 3300013306 Bacteria 1217
56 Ga0163162_11854015 3300013306 Bacteria 690
57 Ga0163163_10738055 3300014325 Bacteria 1048
58 Ga0163163_11090180 3300014325 Bacteria 861
59 Ga0163163_12261362 3300014325 Unclassified 603
60 Ga0157379_10197340 3300014968 Bacteria 1819
61 Ga0157379_10882091 3300014968 Bacteria 848
62 Ga0184598_102649 3300019182 Unclassified 1344
63 Ga0184603_150075 3300019192 Unclassified 1589
64 Ga0197907_10039850 3300020069 Bacteria 1213
65 Ga0197907_11370134 3300020069 Bacteria 1271
66 Ga0206356_10012457 3300020070 Bacteria 1958
67 Ga0206356_11033613 3300020070 Bacteria 1535
68 Ga0206356_11768122 3300020070 Bacteria 639
69 Ga0206356_11861004 3300020070 Bacteria 1077
70 Ga0206355_1389115 3300020076 Unclassified 954
71 Ga0206351_10477103 3300020077 Bacteria 2025
72 Ga0206352_10213137 3300020078 Bacteria 1546
73 Ga0206352_10319017 3300020078 Bacteria 1371
74 Ga0206352_10412720 3300020078 Unclassified 1477
75 Ga0206352_10524694 3300020078 Bacteria 838
76 Ga0206352_10940304 3300020078 Bacteria 1211
77 Ga0206350_10067242 3300020080 Bacteria 1224
78 Ga0206350_10157144 3300020080 Unclassified 992
79 Ga0206350_10274563 3300020080 Bacteria 1025
80 Ga0206350_10499831 3300020080 Bacteria 1004
81 Ga0206350_11615006 3300020080 Unclassified 1163
82 Ga0206354_10343835 3300020081 Bacteria 1332
83 Ga0206354_10893289 3300020081 Bacteria 1448
84 Ga0206354_11231288 3300020081 Bacteria 762
85 Ga0206354_11286917 3300020081 Bacteria 621
86 Ga0206354_11472281 3300020081 Bacteria 1127
87 Ga0206353_10021370 3300020082 Bacteria 1743
88 Ga0206353_10384697 3300020082 Bacteria 587
89 Ga0206353_10451886 3300020082 Bacteria 1419
90 Ga0154015_1564251 3300020610 Bacteria 690
91 Ga0154015_1610328 3300020610 Bacteria 1030
92 Ga0213872_10015091 3300021361 Bacteria 3594
93 Ga0213871_10005627 3300021441 Bacteria 2599
94 Ga0213871_10127329 3300021441 Bacteria 763
95 Ga0224712_10003731 3300022467 Bacteria 4009
96 Ga0224712_10040502 3300022467 Bacteria 1753
97 Ga0224712_10040768 3300022467 Bacteria 1749
98 Ga0224712_10044139 3300022467 Bacteria 1699
99 Ga0224712_10069300 3300022467 Bacteria 1428
100 Ga0224712_10085213 3300022467 Bacteria 1312
101 Ga0224712_10120117 3300022467 Unclassified 1137
102 Ga0224712_10244160 3300022467 Unclassified 828
103 Ga0224712_10398254 3300022467 Bacteria 656
104 Ga0207642_10722646 3300025899 Bacteria 629
105 Ga0207684_10987414 3300025910 Unclassified 705
106 Ga0207652_10537573 3300025921 Bacteria 1051
107 Ga0207670_10306756 3300025936 Bacteria 1245
108 Ga0207711_10282641 3300025941 Bacteria 1528
109 Ga0207651_10896231 3300025960 Bacteria 790
110 Ga0207712_10114036 3300025961 Bacteria 2032
111 Ga0207668_11025847 3300025972 Unclassified 738
112 Ga0207677_10708812 3300026023 Bacteria 894
113 Ga0207703_10719828 3300026035 Unclassified 950
114 Ga0207708_10726919 3300026075 Bacteria 850
115 Ga0207676_11054745 3300026095 Unclassified 802
116 Ga0207676_11097835 3300026095 Unclassified 786
117 Ga0209998_10072206 3300027717 Unclassified 826
118 Ga0268266_10000700 3300028379 Bacteria 45215
119 Ga0268266_10298801 3300028379 Bacteria 1501
120 Ga0268266_10360934 3300028379 Unclassified 1367
121 Ga0268266_11135493 3300028379 Bacteria 756
122 Ga0265318_10141944 3300028577 Unclassified 882
123 Ga0265325_10017935 3300031241 Bacteria 3930
124 Ga0265331_10188159 3300031250 Bacteria 932
125 Ga0265314_10542393 3300031711 Bacteria 606
126 Ga0307405_11084075 3300031731 Unclassified 688
127 Ga0307405_11345356 3300031731 Bacteria 623
128 Ga0307413_11178985 3300031824 Bacteria 665
129 Ga0307409_100166882 3300031995 Unclassified 1933
130 Ga0307416_101453712 3300032002 Unclassified 791
131 Ga0307416_103260191 3300032002 Bacteria 543
132 Ga0373933_0871467 3300035724 Unclassified 593
133 Ga0373947_0371535 3300035725 Bacteria 962
134 Ga0373937_0288284 3300036401 Bacteria 1551
135 Ga0373937_0663772 3300036401 Unclassified 988
136 Ga0373937_0702831 3300036401 Bacteria 958
137 Ga0265778_023623 3300036457 Bacteria 770
138 Ga0436364_0483840 3300037853 Bacteria 973
139 Ga0436364_1467190 3300037853 Bacteria 796
140 Ga0436365_0253789 3300039437 Bacteria 2126
141 Ga0436365_0294430 3300039437 Bacteria 722
142 Ga0436365_0773028 3300039437 Bacteria 875
143 Ga0436360_0360865 3300039438 Bacteria 888
144 Ga0436360_0414864 3300039438 Bacteria 1736
145 Ga0436360_0437085 3300039438 Bacteria 2846
146 Ga0436360_0876133 3300039438 Bacteria 603
147 Ga0436360_1365573 3300039438 Bacteria 891
148 Ga0436361_0322874 3300039447 Bacteria 3097
149 Ga0436361_0364673 3300039447 Unclassified 609
150 Ga0436361_0878828 3300039447 Unclassified 1996
151 Ga0436361_1157939 3300039447 Unclassified 762
152 Ga0436361_1197194 3300039447 Bacteria 570
153 Ga0436363_0018634 3300039450 Unclassified 627
154 Ga0436363_0483030 3300039450 Bacteria 575
155 Ga0436363_1031033 3300039450 Bacteria 541
156 Ga0436363_1370023 3300039450 Bacteria 745
157 Ga0436363_1554178 3300039450 Bacteria 579
158 Ga0436362_0133888 3300039453 Unclassified 634
159 Ga0436362_0540416 3300039453 Bacteria 806
160 Ga0451789_1219512 3300041443 Bacteria 656
161 Ga0451798_0968918 3300041458 Bacteria 617
162 Ga0451800_1261806 3300041459 Bacteria 1086
163 Ga0451800_1421320 3300041459 Bacteria 684
164 Ga0451851_0695148 3300041507 Unclassified 888
165 Ga0466963_0615265 3300044694 Bacteria 767
166 Ga0466958_0604115 3300045836 Bacteria 714
167 Ga0495653_0825311 3300046463 Unclassified 556
168 Ga0495630_0465663 3300046517 Unclassified 969
169 Ga0495646_0532533 3300046680 Bacteria 601
170 Ga0495613_0094997 3300046689 Bacteria 2157
171 Ga0495602_0181999 3300048088 Bacteria 1620
172 Ga0496103_0799819 3300048906 Unclassified 595
173 Ga0496105_0273458 3300048908 Unclassified 1364
174 Ga0496105_0939994 3300048908 Unclassified 650
175 Ga0496108_0654097 3300048911 Bacteria 913
176 Ga0496109_0503046 3300048912 Bacteria 1144
177 Ga0496114_1069554 3300048917 Bacteria 691
178 Ga0496115_0088075 3300048918 Bacteria 2534
179 Ga0496115_0761803 3300048918 Bacteria 756
180 Ga0501033_0032088 3300049570 Unclassified 3943
181 Ga0501034_0003263 3300049571 Bacteria 18533
182 Ga0501034_0005724 3300049571 Bacteria 13510
183 Ga0501034_0008674 3300049571 Bacteria 10714
184 Ga0501034_0036381 3300049571 Bacteria 4987
185 Ga0501034_0041915 3300049571 Bacteria 4632
186 Ga0501034_0045706 3300049571 Bacteria 4424
187 Ga0501034_0059926 3300049571 Bacteria 3823
188 Ga0501034_0093285 3300049571 Bacteria 3007
189 Ga0501034_0180259 3300049571 Bacteria 2077
190 Ga0501034_0372115 3300049571 Bacteria 1355
191 Ga0501034_0869123 3300049571 Bacteria 791
192 Ga0501034_0924761 3300049571 Unclassified 759
193 Ga0501036_0317581 3300049572 Bacteria 1302
194 Ga0501036_0721535 3300049572 Bacteria 823
195 Ga0501040_0634266 3300049576 Bacteria 772
196 Ga0501042_0317388 3300049578 Bacteria 1126
197 Ga0501043_0042680 3300049579 Bacteria 3564
198 Ga0501043_0094465 3300049579 Unclassified 2351
199 Ga0501043_0169629 3300049579 Bacteria 1703
200 Ga0501046_0013085 3300049580 Bacteria 7043
201 Ga0501046_0100737 3300049580 Unclassified 2216
202 Ga0501047_0011113 3300049581 Bacteria 8521
203 Ga0501047_0539303 3300049581 Bacteria 991
204 Ga0501048_0055886 3300049582 Bacteria 2802
205 Ga0501048_0226700 3300049582 Bacteria 1326
206 Ga0501048_0583707 3300049582 Bacteria 802
207 Ga0501068_0648078 3300049584 Bacteria 689
208 Ga0501070_0000721 3300049586 Bacteria 30136
209 Ga0501070_0681223 3300049586 Bacteria 814
210 Ga0501071_1137104 3300049587 Bacteria 603
211 Ga0501071_1197591 3300049587 Bacteria 587
212 Ga0501074_0603970 3300049590 Bacteria 776
213 Ga0501075_0202011 3300049591 Bacteria 1516
214 Ga0501075_0207809 3300049591 Unclassified 1493
215 Ga0501075_0292807 3300049591 Bacteria 1240
216 Ga0501075_0416565 3300049591 Unclassified 1024
217 Ga0501076_0060561 3300049592 Bacteria 3012
218 Ga0501076_0469129 3300049592 Bacteria 1037
219 Ga0501076_1294342 3300049592 Bacteria 599
220 Ga0501079_0239969 3300049741 Unclassified 1416
221 Ga0501080_1076138 3300049742 Bacteria 695
222 Ga0501081_0414832 3300049743 Bacteria 998
223 Ga0501083_0166160 3300049744 Bacteria 1442
224 Ga0501035_0080440 3300049822 Bacteria 2877
225 Ga0501035_0263363 3300049822 Bacteria 1461
226 Ga0501044_0063949 3300049823 Bacteria 3757
227 Ga0501044_0068523 3300049823 Unclassified 3614
228 Ga0501044_0069273 3300049823 Bacteria 3592
229 Ga0501044_0164819 3300049823 Bacteria 2191
230 Ga0501044_0830342 3300049823 Bacteria 802
231 Ga0501044_1041955 3300049823 Unclassified 689
232 nmdc:mga05p37_1076173_c1 3300050507 Bacteria 845
233 nmdc:mga09592_399320_c1 3300050508 Bacteria 1188
234 nmdc:mga08y16_266228_c1 3300050511 Bacteria 1769
235 nmdc:mga08y16_376686_c1 3300050511 Bacteria 1455
236 nmdc:mga08y16_663923_c1 3300050511 Bacteria 1045
237 Ga0495601_0284111 3300053077 Bacteria 1079
238 Ga0495601_0426403 3300053077 Bacteria 859
239 Ga0495595_0331487 3300053084 Bacteria 767
240 Ga0495619_0396725 3300053085 Bacteria 953
241 Ga0587077_065809 3300059493 Bacteria 797
242 Ga0587106_023981 3300059605 Unclassified 930
243 Ga0587128_041905 3300059630 Bacteria 804
244 Ga0587069_011199 3300059642 Bacteria 1194
245 Ga0587107_035868 3300059652 Bacteria 778
246 Ga0501082_0560006 3300060353 Bacteria 1000
247 Ga0501082_0890306 3300060353 Bacteria 779
248 Ga0530510_0258618 3300061734 Bacteria 1298
249 Ga0530510_0697962 3300061734 Bacteria 773
250 2688070439 2687453257 Bacteria 6784659
251 2688393015 2687453341 Bacteria 6534136
252 2889416156 2889415604 Bacteria 8048700
253 2920110625 2920107658 Bacteria 10042636
254 Ga0436362_0525893
255 Ga0007409J51694_1052124
256 Ga0058863_10034875
257 Ga0058861_11990819
258 Ga0058862_12559861
259 Ga0058862_12621720
260 Ga0058862_12707046
261 Ga0058862_12754334
262 Ga0065704_10075282
263 Ga0065707_10111934
264 Ga0070689_100216452
265 Ga0070675_100425321
266 Ga0070659_101203259
267 Ga0070711_100814053
268 Ga0070663_101863553
269 Ga0070685_10424951
270 Ga0070698_100228484
271 Ga0070679_100493219
272 Ga0070679_102095083
273 Ga0070684_101389790
274 Ga0070665_100000526
275 Ga0070665_100342122
276 Ga0070665_100407825
277 Ga0070665_101261983
278 Ga0068852_102219790
279 Ga0068864_100289171
280 Ga0068864_101007811
281 Ga0068866_10808684
282 Ga0068861_101457326
283 Ga0068858_100810079
284 Ga0068858_100848452
285 Ga0081455_10041773
286 Ga0081455_10415271
287 Ga0081455_10725837
288 Ga0075367_10564034
289 Ga0075428_100012543
290 Ga0075428_100049400
291 Ga0075430_101000119
292 Ga0111539_10312307
293 Ga0111539_11317220
294 Ga0105245_11614143
295 Ga0105247_10124349
296 Ga0114129_11567911
297 Ga0105243_11151871
298 Ga0105241_11445859
299 Ga0105248_10103797
300 Ga0105248_12369796
301 Ga0105249_10085873
302 Ga0105249_10283643
303 Ga0105249_11019438
304 Ga0105249_11203910
305 Ga0105249_13357771
306 Ga0105246_10544545
307 Ga0157370_10668199
308 Ga0163162_10609856
309 Ga0163162_11854015
310 Ga0163163_10738055
311 Ga0163163_11090180
312 Ga0163163_12261362
313 Ga0157379_10197340
314 Ga0157379_10882091
315 Ga0184598_102649
316 Ga0184603_150075
317 Ga0197907_10039850
318 Ga0197907_11370134
319 Ga0206356_10012457
320 Ga0206356_11033613
321 Ga0206356_11768122
322 Ga0206356_11861004
323 Ga0206355_1389115
324 Ga0206351_10477103
325 Ga0206352_10213137
326 Ga0206352_10319017
327 Ga0206352_10412720
328 Ga0206352_10524694
329 Ga0206352_10940304
330 Ga0206350_10067242
331 Ga0206350_10157144
332 Ga0206350_10274563
333 Ga0206350_10499831
334 Ga0206350_11615006
335 Ga0206354_10343835
336 Ga0206354_10893289
337 Ga0206354_11231288
338 Ga0206354_11286917
339 Ga0206354_11472281
340 Ga0206353_10021370
341 Ga0206353_10384697
342 Ga0206353_10451886
343 Ga0154015_1564251
344 Ga0154015_1610328
345 Ga0213872_10015091
346 Ga0213871_10005627
347 Ga0213871_10127329
348 Ga0224712_10003731
349 Ga0224712_10040502
350 Ga0224712_10040768
351 Ga0224712_10044139
352 Ga0224712_10069300
353 Ga0224712_10085213
354 Ga0224712_10120117
355 Ga0224712_10244160
356 Ga0224712_10398254
357 Ga0207642_10722646
358 Ga0207684_10987414
359 Ga0207652_10537573
360 Ga0207670_10306756
361 Ga0207711_10282641
362 Ga0207651_10896231
363 Ga0207712_10114036
364 Ga0207668_11025847
365 Ga0207677_10708812
366 Ga0207703_10719828
367 Ga0207708_10726919
368 Ga0207676_11054745
369 Ga0207676_11097835
370 Ga0209998_10072206
371 Ga0268266_10000700
372 Ga0268266_10298801
373 Ga0268266_10360934
374 Ga0268266_11135493
375 Ga0265318_10141944
376 Ga0265325_10017935
377 Ga0265331_10188159
378 Ga0265314_10542393
379 Ga0307405_11084075
380 Ga0307405_11345356
381 Ga0307413_11178985
382 Ga0307409_100166882
383 Ga0307416_101453712
384 Ga0307416_103260191
385 Ga0373933_0871467
386 Ga0373947_0371535
387 Ga0373937_0288284
388 Ga0373937_0663772
389 Ga0373937_0702831
390 Ga0265778_023623
391 Ga0436364_0483840
392 Ga0436364_1467190
393 Ga0436365_0253789
394 Ga0436365_0294430
395 Ga0436365_0773028
396 Ga0436360_0360865
397 Ga0436360_0414864
398 Ga0436360_0437085
399 Ga0436360_0876133
400 Ga0436360_1365573
401 Ga0436361_0322874
402 Ga0436361_0364673
403 Ga0436361_0878828
404 Ga0436361_1157939
405 Ga0436361_1197194
406 Ga0436363_0018634
407 Ga0436363_0483030
408 Ga0436363_1031033
409 Ga0436363_1370023
410 Ga0436363_1554178
411 Ga0436362_0133888
412 Ga0436362_0540416
413 Ga0451789_1219512
414 Ga0451798_0968918
415 Ga0451800_1261806
416 Ga0451800_1421320
417 Ga0451851_0695148
418 Ga0466963_0615265
419 Ga0466958_0604115
420 Ga0495653_0825311
421 Ga0495630_0465663
422 Ga0495646_0532533
423 Ga0495613_0094997
424 Ga0495602_0181999
425 Ga0496103_0799819
426 Ga0496105_0273458
427 Ga0496105_0939994
428 Ga0496108_0654097
429 Ga0496109_0503046
430 Ga0496114_1069554
431 Ga0496115_0088075
432 Ga0496115_0761803
433 Ga0501033_0032088
434 Ga0501034_0003263
435 Ga0501034_0005724
436 Ga0501034_0008674
437 Ga0501034_0036381
438 Ga0501034_0041915
439 Ga0501034_0045706
440 Ga0501034_0059926
441 Ga0501034_0093285
442 Ga0501034_0180259
443 Ga0501034_0372115
444 Ga0501034_0869123
445 Ga0501034_0924761
446 Ga0501036_0317581
447 Ga0501036_0721535
448 Ga0501040_0634266
449 Ga0501042_0317388
450 Ga0501043_0042680
451 Ga0501043_0094465
452 Ga0501043_0169629
453 Ga0501046_0013085
454 Ga0501046_0100737
455 Ga0501047_0011113
456 Ga0501047_0539303
457 Ga0501048_0055886
458 Ga0501048_0226700
459 Ga0501048_0583707
460 Ga0501068_0648078
461 Ga0501070_0000721
462 Ga0501070_0681223
463 Ga0501071_1137104
464 Ga0501071_1197591
465 Ga0501074_0603970
466 Ga0501075_0202011
467 Ga0501075_0207809
468 Ga0501075_0292807
469 Ga0501075_0416565
470 Ga0501076_0060561
471 Ga0501076_0469129
472 Ga0501076_1294342
473 Ga0501079_0239969
474 Ga0501080_1076138
475 Ga0501081_0414832
476 Ga0501083_0166160
477 Ga0501035_0080440
478 Ga0501035_0263363
479 Ga0501044_0063949
480 Ga0501044_0068523
481 Ga0501044_0069273
482 Ga0501044_0164819
483 Ga0501044_0830342
484 Ga0501044_1041955
485 nmdc:mga05p37_1076173_c1
486 nmdc:mga09592_399320_c1
487 nmdc:mga08y16_266228_c1
488 nmdc:mga08y16_376686_c1
489 nmdc:mga08y16_663923_c1
490 Ga0495601_0284111
491 Ga0495601_0426403
492 Ga0495595_0331487
493 Ga0495619_0396725
494 Ga0587077_065809
495 Ga0587106_023981
496 Ga0587128_041905
497 Ga0587069_011199
498 Ga0587107_035868
499 Ga0501082_0560006
500 Ga0501082_0890306
501 Ga0530510_0258618
502 Ga0530510_0697962
503 2688070439
504 2688393015
505 2889416156
506 2920110625

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00359

PTS_EIIA_2

Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

39

185

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3urr-assembly1.cif.gz_B structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9392 1 148
3urr-assembly1.cif.gz_A structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9182 1 156
4gqx-assembly1.cif.gz_B crystal structure of eiia(ntr) from burkholderia pseudomallei 0.9165 3 156
2a0j-assembly1.cif.gz_A crystal structure of nitrogen regulatory protein iia-ntr from neisseria meningitidis 0.9028 3 148
3urr-assembly1.cif.gz_A structure of pts iia-like nitrogen-regulatory protein ptsn (bth_i0484) (ptsn) 0.9012 1 156
ID Description Score Start End Superfamily
af_Q2G239_1_154_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9465 1 156 3.40.930.10
af_Q2G239_1_154_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9407 1 156 3.40.930.10
af_Q2FUX0_504_650_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9355 4 150 3.40.930.10
3urrA00 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9182 1 156 3.40.930.10
af_P54745_16_174_3.40.930.10 Alpha Beta;3-Layer(aba) Sandwich;Mannitol-specific EII; Chain A;Mannitol-specific EII; Chain A 0.9179 1 150 3.40.930.10
ID Description Score Start End GO Terms
AF-X0U083-F1-model_v4 PTS EIIA type-2 domain-containing protein 0.9929 17 154
AF-X0WSM0-F1-model_v4 PTS EIIA type-2 domain-containing protein 0.9925 1 127
AF-A0A2E8AXM0-F1-model_v4 PTS fructose transporter subunit IIA 0.9921 1 153
AF-A0A3L7T8A9-F1-model_v4 PTS sugar transporter subunit IIA 0.989 1 153
AF-A0A1G3CI91-F1-model_v4 PTS fructose transporter subunit IIA 0.9886 1 152 GO:0008982
GO:0009401
GO:0016020

Map