F364231

General Info

Members Datasets Scaffolds Average Seq Length
253 65 253 88

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0252102|Ga0395899_0252102_792_1070
Length 92
Sequence MEPMMQSDPTRRSALSVALLTHAGTRYEADCWMAGNGQPNGSVRYDTDRAWFTIQGRPAALRELAEGLLRCAELTEQTYPAPAAPVVEGVAG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
6 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
7 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
8 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
9 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
10 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
11 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
12 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
13 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
14 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
15 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
19 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
20 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
21 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
22 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
23 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
24 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
25 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
26 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
27 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
28 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
29 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
30 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
31 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
32 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
33 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
34 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
37 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
38 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
39 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
40 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
41 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
42 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
43 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
44 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
45 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
46 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
47 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
48 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
49 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
50 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
51 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
52 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
55 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
56 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
57 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
58 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
59 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
60 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
61 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
62 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
63 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
64 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
65 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10095175 3300003203 Bacteria 893
2 JGI25407J50210_10096324 3300003373 Bacteria 732
3 JGI25407J50210_10170957 3300003373 Bacteria 535
4 Ga0081538_10001824 3300005981 Bacteria 21449
5 Ga0081538_10002653 3300005981 Bacteria 17264
6 Ga0081538_10014231 3300005981 Bacteria 6240
7 Ga0081538_10020010 3300005981 Bacteria 4948
8 Ga0081538_10076308 3300005981 Bacteria 1812
9 Ga0081538_10165671 3300005981 Bacteria 973
10 Ga0081538_10304569 3300005981 Bacteria 584
11 Ga0081538_10371938 3300005981 Unclassified 516
12 Ga0081539_10003924 3300005985 Bacteria 17271
13 Ga0081539_10179031 3300005985 Bacteria 996
14 Ga0075432_10013344 3300006058 Bacteria 2792
15 Ga0075428_100040292 3300006844 Bacteria 5140
16 Ga0075428_100539340 3300006844 Unclassified 1247
17 Ga0075430_100023938 3300006846 Bacteria 5200
18 Ga0075430_100105222 3300006846 Unclassified 2355
19 Ga0075431_100019680 3300006847 Bacteria 6887
20 Ga0075431_100625795 3300006847 Unclassified 1058
21 Ga0075433_10008237 3300006852 Bacteria 8308
22 Ga0075433_10616818 3300006852 Unclassified 952
23 Ga0075434_100092530 3300006871 Bacteria 3026
24 Ga0075434_100161611 3300006871 Bacteria 2259
25 Ga0075434_100168133 3300006871 Bacteria 2212
26 Ga0075434_102141087 3300006871 Unclassified 564
27 Ga0075429_100259134 3300006880 Unclassified 1522
28 Ga0075429_100402085 3300006880 Bacteria 1199
29 Ga0075429_101907593 3300006880 Bacteria 515
30 Ga0075435_100094365 3300007076 Bacteria 2473
31 Ga0075435_100255302 3300007076 Unclassified 1493
32 Ga0111539_10053608 3300009094 Bacteria 4801
33 Ga0111539_12399618 3300009094 Bacteria 612
34 Ga0114129_10063675 3300009147 Bacteria 5148
35 Ga0114129_10395446 3300009147 Bacteria 1822
36 Ga0114129_10699526 3300009147 Bacteria 1303
37 Ga0114129_10792267 3300009147 Viruses 1210
38 Ga0114129_11300384 3300009147 Unclassified 901
39 Ga0114129_11451424 3300009147 Unclassified 845
40 Ga0114129_11941384 3300009147 Unclassified 713
41 Ga0114129_13047242 3300009147 Bacteria 549
42 Ga0114129_13076442 3300009147 Bacteria 546
43 Ga0105249_12863770 3300009553 Bacteria 554
44 Ga0182008_10550755 3300014497 Bacteria 641
45 Ga0182007_10193556 3300015262 Unclassified 708
46 Ga0207428_10028827 3300027907 Bacteria 4608
47 Ga0307408_100474498 3300031548 Bacteria 1090
48 Ga0307408_100526763 3300031548 Unclassified 1039
49 Ga0307408_100582836 3300031548 Unclassified 991
50 Ga0307408_101037101 3300031548 Bacteria 758
51 Ga0307408_101475521 3300031548 Bacteria 642
52 Ga0307405_10026942 3300031731 Bacteria 3325
53 Ga0307405_10049579 3300031731 Bacteria 2595
54 Ga0307405_10089855 3300031731 Bacteria 2030
55 Ga0307405_10155010 3300031731 Bacteria 1615
56 Ga0307405_10179648 3300031731 Unclassified 1518
57 Ga0307405_10362973 3300031731 Unclassified 1121
58 Ga0307405_10485070 3300031731 Bacteria 987
59 Ga0307405_10586495 3300031731 Unclassified 907
60 Ga0307405_10612403 3300031731 Bacteria 890
61 Ga0307405_10742735 3300031731 Unclassified 817
62 Ga0307405_10910352 3300031731 Bacteria 744
63 Ga0307413_10119206 3300031824 Bacteria 1783
64 Ga0307413_10131353 3300031824 Unclassified 1715
65 Ga0307413_10133523 3300031824 Bacteria 1703
66 Ga0307413_10238821 3300031824 Unclassified 1340
67 Ga0307413_10274159 3300031824 Unclassified 1265
68 Ga0307413_10899932 3300031824 Bacteria 752
69 Ga0307413_11050864 3300031824 Bacteria 701
70 Ga0307413_11769918 3300031824 Bacteria 552
71 Ga0307410_10013836 3300031852 Bacteria 4724
72 Ga0307410_10070710 3300031852 Unclassified 2418
73 Ga0307410_10079931 3300031852 Bacteria 2293
74 Ga0307410_10190759 3300031852 Unclassified 1558
75 Ga0307410_10292426 3300031852 Bacteria 1282
76 Ga0307410_10427867 3300031852 Bacteria 1075
77 Ga0307410_10544494 3300031852 Unclassified 961
78 Ga0307410_10573740 3300031852 Bacteria 938
79 Ga0307410_10796645 3300031852 Unclassified 803
80 Ga0307410_10804816 3300031852 Bacteria 799
81 Ga0307410_10911576 3300031852 Bacteria 753
82 Ga0307410_10986992 3300031852 Bacteria 726
83 Ga0307410_11325779 3300031852 Unclassified 630
84 Ga0307406_10011893 3300031901 Bacteria 4946
85 Ga0307406_10012374 3300031901 Bacteria 4867
86 Ga0307406_10289499 3300031901 Bacteria 1253
87 Ga0307406_10358363 3300031901 Unclassified 1142
88 Ga0307406_10830819 3300031901 Bacteria 782
89 Ga0307406_11452306 3300031901 Unclassified 602
90 Ga0307407_10002358 3300031903 Bacteria 7362
91 Ga0307407_10020069 3300031903 Bacteria 3416
92 Ga0307407_10024642 3300031903 Bacteria 3158
93 Ga0307407_10044193 3300031903 Unclassified 2509
94 Ga0307407_10271307 3300031903 Bacteria 1171
95 Ga0307407_10287078 3300031903 Unclassified 1142
96 Ga0307407_10574387 3300031903 Bacteria 836
97 Ga0307407_10733590 3300031903 Unclassified 747
98 Ga0307407_10863645 3300031903 Unclassified 692
99 Ga0307407_10991992 3300031903 Unclassified 649
100 Ga0307407_11012964 3300031903 Bacteria 642
101 Ga0307407_11396663 3300031903 Bacteria 551
102 Ga0307412_10085635 3300031911 Bacteria 2191
103 Ga0307412_10121654 3300031911 Bacteria 1880
104 Ga0307412_10134401 3300031911 Bacteria 1802
105 Ga0307412_10184559 3300031911 Bacteria 1572
106 Ga0307412_10218338 3300031911 Bacteria 1460
107 Ga0307412_10475610 3300031911 Unclassified 1035
108 Ga0307412_10560552 3300031911 Unclassified 961
109 Ga0307412_10686654 3300031911 Bacteria 877
110 Ga0307412_10744018 3300031911 Bacteria 846
111 Ga0307412_10920643 3300031911 Bacteria 767
112 Ga0307409_100032371 3300031995 Bacteria 3790
113 Ga0307409_100040696 3300031995 Bacteria 3463
114 Ga0307409_100042428 3300031995 Bacteria 3407
115 Ga0307409_100092253 3300031995 Bacteria 2484
116 Ga0307409_100165283 3300031995 Unclassified 1941
117 Ga0307409_100243644 3300031995 Bacteria 1638
118 Ga0307409_100289029 3300031995 Bacteria 1519
119 Ga0307409_100289060 3300031995 Unclassified 1519
120 Ga0307409_100324698 3300031995 Bacteria 1442
121 Ga0307409_100507086 3300031995 Bacteria 1176
122 Ga0307409_100534373 3300031995 Bacteria 1148
123 Ga0307409_100956945 3300031995 Bacteria 872
124 Ga0307409_101036808 3300031995 Unclassified 839
125 Ga0307409_101254827 3300031995 Bacteria 765
126 Ga0307409_101483438 3300031995 Bacteria 705
127 Ga0307409_101570809 3300031995 Bacteria 686
128 Ga0307409_101675473 3300031995 Unclassified 664
129 Ga0307416_100008811 3300032002 Bacteria 6543
130 Ga0307416_100014324 3300032002 Bacteria 5429
131 Ga0307416_100014766 3300032002 Bacteria 5367
132 Ga0307416_100022599 3300032002 Bacteria 4543
133 Ga0307416_100029388 3300032002 Bacteria 4105
134 Ga0307416_100036936 3300032002 Bacteria 3753
135 Ga0307416_100059827 3300032002 Bacteria 3098
136 Ga0307416_100091271 3300032002 Bacteria 2616
137 Ga0307416_100115730 3300032002 Bacteria 2375
138 Ga0307416_100129616 3300032002 Bacteria 2267
139 Ga0307416_100338099 3300032002 Unclassified 1517
140 Ga0307416_100387041 3300032002 Bacteria 1431
141 Ga0307416_100437185 3300032002 Bacteria 1357
142 Ga0307416_100509832 3300032002 Bacteria 1269
143 Ga0307416_100529601 3300032002 Unclassified 1248
144 Ga0307416_100565404 3300032002 Unclassified 1212
145 Ga0307416_100581226 3300032002 Unclassified 1197
146 Ga0307416_100833040 3300032002 Bacteria 1020
147 Ga0307416_101215890 3300032002 Bacteria 859
148 Ga0307416_101528285 3300032002 Bacteria 773
149 Ga0307416_101687380 3300032002 Bacteria 738
150 Ga0307416_103076529 3300032002 Bacteria 558
151 Ga0307416_103268242 3300032002 Bacteria 542
152 Ga0307416_103624336 3300032002 Bacteria 517
153 Ga0307414_10187745 3300032004 Bacteria 1669
154 Ga0307414_10307205 3300032004 Bacteria 1345
155 Ga0307414_10978292 3300032004 Unclassified 778
156 Ga0307414_11066210 3300032004 Bacteria 745
157 Ga0307414_11762099 3300032004 Unclassified 578
158 Ga0307411_10092438 3300032005 Bacteria 2116
159 Ga0307411_10191715 3300032005 Unclassified 1561
160 Ga0307411_10301026 3300032005 Bacteria 1286
161 Ga0307411_10740332 3300032005 Bacteria 860
162 Ga0307415_100003941 3300032126 Bacteria 7627
163 Ga0307415_100004252 3300032126 Bacteria 7403
164 Ga0307415_100021854 3300032126 Bacteria 3940
165 Ga0307415_100022331 3300032126 Unclassified 3902
166 Ga0307415_100024288 3300032126 Bacteria 3780
167 Ga0307415_100029849 3300032126 Unclassified 3490
168 Ga0307415_100077190 3300032126 Bacteria 2364
169 Ga0307415_100128379 3300032126 Bacteria 1914
170 Ga0307415_100235154 3300032126 Unclassified 1478
171 Ga0307415_100263794 3300032126 Bacteria 1407
172 Ga0307415_100338591 3300032126 Bacteria 1261
173 Ga0307415_100374253 3300032126 Bacteria 1207
174 Ga0307415_100406421 3300032126 Unclassified 1164
175 Ga0307415_100448918 3300032126 Bacteria 1114
176 Ga0307415_100814860 3300032126 Unclassified 853
177 Ga0307415_100836836 3300032126 Unclassified 843
178 Ga0307415_100910667 3300032126 Bacteria 811
179 Ga0307415_100950343 3300032126 Unclassified 795
180 Ga0307415_101128041 3300032126 Bacteria 735
181 Ga0307415_101145023 3300032126 Bacteria 730
182 Ga0307415_101294654 3300032126 Unclassified 690
183 Ga0307415_101630967 3300032126 Bacteria 620
184 Ga0395899_0252102 3300037312 Bacteria 1211
185 Ga0395900_0312962 3300037418 Unclassified 1553
186 Ga0395900_0750663 3300037418 Bacteria 906
187 Ga0395900_0915696 3300037418 Unclassified 800
188 Ga0395900_1420606 3300037418 Bacteria 607
189 Ga0395898_0104764 3300037466 Unclassified 2713
190 Ga0395898_0779159 3300037466 Bacteria 897
191 Ga0395898_1269935 3300037466 Unclassified 666
192 Ga0395898_1373004 3300037466 Unclassified 635
193 Ga0395905_0131074 3300037471 Unclassified 2358
194 Ga0395905_1072768 3300037471 Bacteria 709
195 Ga0395901_0010414 3300038443 Bacteria 9419
196 Ga0395901_1344933 3300038443 Unclassified 675
197 Ga0395901_1995885 3300038443 Unclassified 526
198 Ga0439443_096098 3300042003 Bacteria 564
199 Ga0439448_0038203 3300042005 Unclassified 1545
200 Ga0439448_0041105 3300042005 Unclassified 1495
201 Ga0439448_0073356 3300042005 Bacteria 1142
202 Ga0439450_146093 3300042008 Bacteria 618
203 Ga0439450_160786 3300042008 Bacteria 592
204 Ga0439451_133880 3300042009 Bacteria 507
205 Ga0439454_019400 3300042011 Bacteria 989
206 Ga0439454_077844 3300042011 Unclassified 597
207 Ga0439454_100955 3300042011 Bacteria 542
208 Ga0439455_0072276 3300042012 Unclassified 929
209 Ga0439455_0249691 3300042012 Bacteria 519
210 Ga0439463_034703 3300042016 Bacteria 1276
211 Ga0439463_177882 3300042016 Bacteria 552
212 Ga0450912_037287 3300042116 Bacteria 520
213 Ga0439458_0170933 3300042157 Unclassified 588
214 Ga0439444_0018059 3300042437 Bacteria 1218
215 Ga0439459_0080065 3300042438 Bacteria 770
216 Ga0439464_0049634 3300042439 Bacteria 1211
217 Ga0439464_0076692 3300042439 Unclassified 994
218 Ga0439460_0115331 3300042461 Bacteria 875
219 Ga0450893_0056618 3300042532 Bacteria 743
220 Ga0439440_0075358 3300042993 Bacteria 885
221 Ga0439440_0112276 3300042993 Bacteria 751
222 Ga0439440_0191947 3300042993 Unclassified 602
223 Ga0439440_0231226 3300042993 Bacteria 558
224 Ga0495663_0280189 3300046525 Unclassified 597
225 Ga0495589_0571615 3300046794 Unclassified 515
226 Ga0501039_1171971 3300049575 Bacteria 595
227 Ga0501042_0431928 3300049578 Bacteria 955
228 Ga0501076_0815133 3300049592 Bacteria 770
229 nmdc:mga05p37_1208031_c1 3300050507 Bacteria 780
230 nmdc:mga05p37_196001_c1 3300050507 Unclassified 2449
231 nmdc:mga05p37_279325_c1 3300050507 Bacteria 1992
232 nmdc:mga05p37_37023_c1 3300050507 Bacteria 5985
233 nmdc:mga05p37_49329_c1 3300050507 Bacteria 5178
234 nmdc:mga05p37_761359_c1 3300050507 Bacteria 1066
235 nmdc:mga09592_1241592_c1 3300050508 Unclassified 615
236 nmdc:mga09592_18079_c1 3300050508 Bacteria 5780
237 nmdc:mga09592_675423_c1 3300050508 Bacteria 880
238 nmdc:mga0qj67_1523636_c1 3300050509 Unclassified 514
239 nmdc:mga0qj67_26839_c1 3300050509 Bacteria 4460
240 nmdc:mga0qj67_80356_c1 3300050509 Unclassified 2612
241 nmdc:mga06r32_24105_c1 3300050510 Bacteria 5642
242 nmdc:mga06r32_46215_c1 3300050510 Bacteria 4155
243 nmdc:mga08y16_1316645_c1 3300050511 Bacteria 688
244 nmdc:mga08y16_1597750_c1 3300050511 Unclassified 610
245 nmdc:mga08y16_38908_c1 3300050511 Bacteria 4992
246 nmdc:mga08y16_467320_c1 3300050511 Bacteria 1285
247 nmdc:mga0n895_34702_c1 3300050512 Bacteria 2261
248 nmdc:mga0n895_348479_c1 3300050512 Bacteria 1500
249 nmdc:mga0rr50_135013_c1 3300050513 Bacteria 1979
250 nmdc:mga0rr50_623675_c1 3300050513 Unclassified 920
251 nmdc:mga0a205_29579_c1 3300050515 Bacteria 5243
252 Ga0501082_0413895 3300060353 Bacteria 1177
253 Ga0530510_0584771 3300061734 Bacteria 849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042012 Ga0439455_0072276 Ga0439455_0072276_169_393 74
2 3300042439 Ga0439464_0049634 Ga0439464_0049634_36_260 74
3 3300006871 Ga0075434_100168133 Ga0075434_1001681335 75
4 3300009147 Ga0114129_10792267 Ga0114129_107922671 76
5 3300014497 Ga0182008_10550755 Ga0182008_105507552 76
6 3300038443 Ga0395901_1344933 Ga0395901_1344933_16_246 76
7 3300049575 Ga0501039_1171971 Ga0501039_1171971_211_441 76
8 3300049578 Ga0501042_0431928 Ga0501042_0431928_696_926 76
9 3300050507 nmdc:mga05p37_279325_c1 nmdc:mga05p37_279325_c1_328_558 76
10 3300050507 nmdc:mga05p37_761359_c1 nmdc:mga05p37_761359_c1_252_482 76
11 3300050509 nmdc:mga0qj67_1523636_c1 nmdc:mga0qj67_1523636_c1_11_241 76
12 3300060353 Ga0501082_0413895 Ga0501082_0413895_36_266 76
13 3300005981 Ga0081538_10076308 Ga0081538_100763082 79
14 3300031731 Ga0307405_10089855 Ga0307405_100898553 86
15 3300031852 Ga0307410_10070710 Ga0307410_100707103 86
16 3300031903 Ga0307407_10287078 Ga0307407_102870781 86
17 3300031911 Ga0307412_10560552 Ga0307412_105605522 86
18 3300031995 Ga0307409_100289060 Ga0307409_1002890601 86
19 3300032002 Ga0307416_100022599 Ga0307416_1000225993 86
20 3300032126 Ga0307415_100021854 Ga0307415_1000218544 86
21 3300037471 Ga0395905_1072768 Ga0395905_1072768_171_440 86
22 3300005981 Ga0081538_10304569 Ga0081538_103045691 87
23 3300005981 Ga0081538_10371938 Ga0081538_103719381 87
24 3300006844 Ga0075428_100040292 Ga0075428_1000402926 87
25 3300006846 Ga0075430_100105222 Ga0075430_1001052222 87
26 3300006847 Ga0075431_100019680 Ga0075431_1000196802 87
27 3300006880 Ga0075429_100402085 Ga0075429_1004020852 87
28 3300009094 Ga0111539_12399618 Ga0111539_123996181 87
29 3300009147 Ga0114129_10063675 Ga0114129_100636756 87
30 3300009147 Ga0114129_11300384 Ga0114129_113003842 87
31 3300009147 Ga0114129_13076442 Ga0114129_130764422 87
32 3300015262 Ga0182007_10193556 Ga0182007_101935562 87
33 3300031731 Ga0307405_10026942 Ga0307405_100269423 87
34 3300031911 Ga0307412_10744018 Ga0307412_107440182 87
35 3300031995 Ga0307409_100289029 Ga0307409_1002890293 87
36 3300032002 Ga0307416_100029388 Ga0307416_1000293886 87
37 3300032002 Ga0307416_103624336 Ga0307416_1036243362 87
38 3300032126 Ga0307415_100338591 Ga0307415_1003385912 87
39 3300032126 Ga0307415_100910667 Ga0307415_1009106672 87
40 3300037418 Ga0395900_0915696 Ga0395900_0915696_520_783 87
41 3300038443 Ga0395901_1995885 Ga0395901_1995885_108_371 87
42 3300042009 Ga0439451_133880 Ga0439451_133880_141_413 87
43 3300042011 Ga0439454_019400 Ga0439454_019400_434_697 87
44 3300042011 Ga0439454_100955 Ga0439454_100955_135_398 87
45 3300042016 Ga0439463_177882 Ga0439463_177882_255_527 87
46 3300042116 Ga0450912_037287 Ga0450912_037287_209_481 87
47 3300042437 Ga0439444_0018059 Ga0439444_0018059_789_1052 87
48 3300042438 Ga0439459_0080065 Ga0439459_0080065_444_707 87
49 3300042993 Ga0439440_0075358 Ga0439440_0075358_79_342 87
50 3300042993 Ga0439440_0112276 Ga0439440_0112276_464_727 87
51 3300050507 nmdc:mga05p37_37023_c1 nmdc:mga05p37_37023_c1_1146_1409 87
52 3300050508 nmdc:mga09592_18079_c1 nmdc:mga09592_18079_c1_941_1204 87
53 3300050509 nmdc:mga0qj67_80356_c1 nmdc:mga0qj67_80356_c1_1527_1790 87
54 3300050510 nmdc:mga06r32_24105_c1 nmdc:mga06r32_24105_c1_4453_4716 87
55 3300050511 nmdc:mga08y16_1316645_c1 nmdc:mga08y16_1316645_c1_405_668 87
56 3300031852 Ga0307410_10986992 Ga0307410_109869922 88
57 3300031903 Ga0307407_11396663 Ga0307407_113966632 88
58 3300031911 Ga0307412_10475610 Ga0307412_104756103 88
59 3300031995 Ga0307409_100507086 Ga0307409_1005070862 88
60 3300031995 Ga0307409_101570809 Ga0307409_1015708092 88
61 3300032002 Ga0307416_100387041 Ga0307416_1003870413 88
62 3300032004 Ga0307414_10978292 Ga0307414_109782922 88
63 3300032126 Ga0307415_101294654 Ga0307415_1012946541 88
64 3300003203 JGI25406J46586_10095175 JGI25406J46586_100951752 89
65 3300003373 JGI25407J50210_10096324 JGI25407J50210_100963243 89
66 3300003373 JGI25407J50210_10170957 JGI25407J50210_101709571 89
67 3300005981 Ga0081538_10001824 Ga0081538_100018245 89
68 3300005981 Ga0081538_10002653 Ga0081538_100026532 89
69 3300005981 Ga0081538_10014231 Ga0081538_100142317 89
70 3300005981 Ga0081538_10020010 Ga0081538_100200108 89
71 3300005981 Ga0081538_10165671 Ga0081538_101656712 89
72 3300005985 Ga0081539_10003924 Ga0081539_1000392416 89
73 3300005985 Ga0081539_10179031 Ga0081539_101790313 89
74 3300006058 Ga0075432_10013344 Ga0075432_100133444 89
75 3300006844 Ga0075428_100539340 Ga0075428_1005393401 89
76 3300006846 Ga0075430_100023938 Ga0075430_1000239382 89
77 3300006847 Ga0075431_100625795 Ga0075431_1006257953 89
78 3300006852 Ga0075433_10008237 Ga0075433_100082372 89
79 3300006852 Ga0075433_10616818 Ga0075433_106168182 89
80 3300006871 Ga0075434_100092530 Ga0075434_1000925303 89
81 3300006871 Ga0075434_100161611 Ga0075434_1001616114 89
82 3300006871 Ga0075434_102141087 Ga0075434_1021410872 89
83 3300006880 Ga0075429_100259134 Ga0075429_1002591342 89
84 3300006880 Ga0075429_101907593 Ga0075429_1019075931 89
85 3300007076 Ga0075435_100094365 Ga0075435_1000943654 89
86 3300007076 Ga0075435_100255302 Ga0075435_1002553022 89
87 3300009094 Ga0111539_10053608 Ga0111539_100536081 89
88 3300009147 Ga0114129_10395446 Ga0114129_103954463 89
89 3300009147 Ga0114129_10699526 Ga0114129_106995262 89
90 3300009147 Ga0114129_11451424 Ga0114129_114514242 89
91 3300009147 Ga0114129_11941384 Ga0114129_119413842 89
92 3300009147 Ga0114129_13047242 Ga0114129_130472421 89
93 3300009553 Ga0105249_12863770 Ga0105249_128637702 89
94 3300027907 Ga0207428_10028827 Ga0207428_100288276 89
95 3300031548 Ga0307408_100474498 Ga0307408_1004744983 89
96 3300031548 Ga0307408_100526763 Ga0307408_1005267633 89
97 3300031548 Ga0307408_100582836 Ga0307408_1005828362 89
98 3300031548 Ga0307408_101037101 Ga0307408_1010371012 89
99 3300031548 Ga0307408_101475521 Ga0307408_1014755212 89
100 3300031731 Ga0307405_10049579 Ga0307405_100495792 89
101 3300031731 Ga0307405_10155010 Ga0307405_101550103 89
102 3300031731 Ga0307405_10179648 Ga0307405_101796482 89
103 3300031731 Ga0307405_10362973 Ga0307405_103629732 89
104 3300031731 Ga0307405_10485070 Ga0307405_104850702 89
105 3300031731 Ga0307405_10586495 Ga0307405_105864952 89
106 3300031731 Ga0307405_10612403 Ga0307405_106124033 89
107 3300031731 Ga0307405_10742735 Ga0307405_107427353 89
108 3300031731 Ga0307405_10910352 Ga0307405_109103521 89
109 3300031824 Ga0307413_10119206 Ga0307413_101192062 89
110 3300031824 Ga0307413_10131353 Ga0307413_101313533 89
111 3300031824 Ga0307413_10133523 Ga0307413_101335233 89
112 3300031824 Ga0307413_10238821 Ga0307413_102388212 89
113 3300031824 Ga0307413_10274159 Ga0307413_102741593 89
114 3300031824 Ga0307413_10899932 Ga0307413_108999322 89
115 3300031824 Ga0307413_11050864 Ga0307413_110508642 89
116 3300031824 Ga0307413_11769918 Ga0307413_117699181 89
117 3300031852 Ga0307410_10013836 Ga0307410_100138364 89
118 3300031852 Ga0307410_10079931 Ga0307410_100799314 89
119 3300031852 Ga0307410_10190759 Ga0307410_101907593 89
120 3300031852 Ga0307410_10292426 Ga0307410_102924261 89
121 3300031852 Ga0307410_10427867 Ga0307410_104278673 89
122 3300031852 Ga0307410_10544494 Ga0307410_105444943 89
123 3300031852 Ga0307410_10573740 Ga0307410_105737403 89
124 3300031852 Ga0307410_10796645 Ga0307410_107966452 89
125 3300031852 Ga0307410_10804816 Ga0307410_108048162 89
126 3300031852 Ga0307410_10911576 Ga0307410_109115763 89
127 3300031852 Ga0307410_11325779 Ga0307410_113257792 89
128 3300031901 Ga0307406_10011893 Ga0307406_100118936 89
129 3300031901 Ga0307406_10012374 Ga0307406_100123745 89
130 3300031901 Ga0307406_10289499 Ga0307406_102894992 89
131 3300031901 Ga0307406_10358363 Ga0307406_103583631 89
132 3300031901 Ga0307406_10830819 Ga0307406_108308192 89
133 3300031901 Ga0307406_11452306 Ga0307406_114523062 89
134 3300031903 Ga0307407_10002358 Ga0307407_100023588 89
135 3300031903 Ga0307407_10020069 Ga0307407_100200693 89
136 3300031903 Ga0307407_10024642 Ga0307407_100246424 89
137 3300031903 Ga0307407_10044193 Ga0307407_100441933 89
138 3300031903 Ga0307407_10271307 Ga0307407_102713072 89
139 3300031903 Ga0307407_10574387 Ga0307407_105743871 89
140 3300031903 Ga0307407_10733590 Ga0307407_107335901 89
141 3300031903 Ga0307407_10863645 Ga0307407_108636452 89
142 3300031903 Ga0307407_10991992 Ga0307407_109919921 89
143 3300031903 Ga0307407_11012964 Ga0307407_110129642 89
144 3300031911 Ga0307412_10085635 Ga0307412_100856353 89
145 3300031911 Ga0307412_10121654 Ga0307412_101216543 89
146 3300031911 Ga0307412_10134401 Ga0307412_101344011 89
147 3300031911 Ga0307412_10184559 Ga0307412_101845592 89
148 3300031911 Ga0307412_10218338 Ga0307412_102183383 89
149 3300031911 Ga0307412_10686654 Ga0307412_106866543 89
150 3300031911 Ga0307412_10920643 Ga0307412_109206433 89
151 3300031995 Ga0307409_100032371 Ga0307409_1000323714 89
152 3300031995 Ga0307409_100040696 Ga0307409_1000406965 89
153 3300031995 Ga0307409_100042428 Ga0307409_1000424285 89
154 3300031995 Ga0307409_100092253 Ga0307409_1000922532 89
155 3300031995 Ga0307409_100165283 Ga0307409_1001652832 89
156 3300031995 Ga0307409_100243644 Ga0307409_1002436442 89
157 3300031995 Ga0307409_100324698 Ga0307409_1003246983 89
158 3300031995 Ga0307409_100534373 Ga0307409_1005343732 89
159 3300031995 Ga0307409_100956945 Ga0307409_1009569451 89
160 3300031995 Ga0307409_101036808 Ga0307409_1010368082 89
161 3300031995 Ga0307409_101254827 Ga0307409_1012548271 89
162 3300031995 Ga0307409_101483438 Ga0307409_1014834382 89
163 3300031995 Ga0307409_101675473 Ga0307409_1016754732 89
164 3300032002 Ga0307416_100008811 Ga0307416_1000088118 89
165 3300032002 Ga0307416_100014324 Ga0307416_1000143246 89
166 3300032002 Ga0307416_100014766 Ga0307416_1000147667 89
167 3300032002 Ga0307416_100036936 Ga0307416_1000369365 89
168 3300032002 Ga0307416_100059827 Ga0307416_1000598271 89
169 3300032002 Ga0307416_100091271 Ga0307416_1000912713 89
170 3300032002 Ga0307416_100115730 Ga0307416_1001157303 89
171 3300032002 Ga0307416_100129616 Ga0307416_1001296162 89
172 3300032002 Ga0307416_100338099 Ga0307416_1003380993 89
173 3300032002 Ga0307416_100437185 Ga0307416_1004371853 89
174 3300032002 Ga0307416_100509832 Ga0307416_1005098322 89
175 3300032002 Ga0307416_100529601 Ga0307416_1005296013 89
176 3300032002 Ga0307416_100565404 Ga0307416_1005654042 89
177 3300032002 Ga0307416_100581226 Ga0307416_1005812263 89
178 3300032002 Ga0307416_100833040 Ga0307416_1008330402 89
179 3300032002 Ga0307416_101215890 Ga0307416_1012158903 89
180 3300032002 Ga0307416_101528285 Ga0307416_1015282853 89
181 3300032002 Ga0307416_101687380 Ga0307416_1016873803 89
182 3300032002 Ga0307416_103076529 Ga0307416_1030765292 89
183 3300032002 Ga0307416_103268242 Ga0307416_1032682421 89
184 3300032004 Ga0307414_10187745 Ga0307414_101877453 89
185 3300032004 Ga0307414_10307205 Ga0307414_103072053 89
186 3300032004 Ga0307414_11066210 Ga0307414_110662102 89
187 3300032004 Ga0307414_11762099 Ga0307414_117620991 89
188 3300032005 Ga0307411_10092438 Ga0307411_100924383 89
189 3300032005 Ga0307411_10191715 Ga0307411_101917153 89
190 3300032005 Ga0307411_10301026 Ga0307411_103010261 89
191 3300032005 Ga0307411_10740332 Ga0307411_107403321 89
192 3300032126 Ga0307415_100003941 Ga0307415_1000039416 89
193 3300032126 Ga0307415_100004252 Ga0307415_10000425210 89
194 3300032126 Ga0307415_100022331 Ga0307415_1000223315 89
195 3300032126 Ga0307415_100024288 Ga0307415_1000242883 89
196 3300032126 Ga0307415_100029849 Ga0307415_1000298494 89
197 3300032126 Ga0307415_100077190 Ga0307415_1000771902 89
198 3300032126 Ga0307415_100128379 Ga0307415_1001283793 89
199 3300032126 Ga0307415_100235154 Ga0307415_1002351543 89
200 3300032126 Ga0307415_100263794 Ga0307415_1002637943 89
201 3300032126 Ga0307415_100374253 Ga0307415_1003742533 89
202 3300032126 Ga0307415_100406421 Ga0307415_1004064213 89
203 3300032126 Ga0307415_100448918 Ga0307415_1004489181 89
204 3300032126 Ga0307415_100814860 Ga0307415_1008148602 89
205 3300032126 Ga0307415_100836836 Ga0307415_1008368362 89
206 3300032126 Ga0307415_100950343 Ga0307415_1009503432 89
207 3300032126 Ga0307415_101128041 Ga0307415_1011280412 89
208 3300032126 Ga0307415_101145023 Ga0307415_1011450231 89
209 3300032126 Ga0307415_101630967 Ga0307415_1016309672 89
210 3300037312 Ga0395899_0252102 Ga0395899_0252102_792_1070 89
211 3300037418 Ga0395900_0312962 Ga0395900_0312962_943_1221 89
212 3300037418 Ga0395900_0750663 Ga0395900_0750663_38_316 89
213 3300037418 Ga0395900_1420606 Ga0395900_1420606_269_547 89
214 3300037466 Ga0395898_0104764 Ga0395898_0104764_781_1059 89
215 3300037466 Ga0395898_0779159 Ga0395898_0779159_77_355 89
216 3300037466 Ga0395898_1269935 Ga0395898_1269935_340_609 89
217 3300037466 Ga0395898_1373004 Ga0395898_1373004_142_411 89
218 3300037471 Ga0395905_0131074 Ga0395905_0131074_1536_1805 89
219 3300038443 Ga0395901_0010414 Ga0395901_0010414_1584_1853 89
220 3300042003 Ga0439443_096098 Ga0439443_096098_235_513 89
221 3300042005 Ga0439448_0038203 Ga0439448_0038203_1137_1415 89
222 3300042005 Ga0439448_0041105 Ga0439448_0041105_1051_1320 89
223 3300042005 Ga0439448_0073356 Ga0439448_0073356_618_887 89
224 3300042008 Ga0439450_146093 Ga0439450_146093_73_342 89
225 3300042008 Ga0439450_160786 Ga0439450_160786_306_575 89
226 3300042011 Ga0439454_077844 Ga0439454_077844_292_570 89
227 3300042012 Ga0439455_0249691 Ga0439455_0249691_97_366 89
228 3300042016 Ga0439463_034703 Ga0439463_034703_144_413 89
229 3300042157 Ga0439458_0170933 Ga0439458_0170933_123_401 89
230 3300042439 Ga0439464_0076692 Ga0439464_0076692_694_963 89
231 3300042461 Ga0439460_0115331 Ga0439460_0115331_591_860 89
232 3300042532 Ga0450893_0056618 Ga0450893_0056618_46_315 89
233 3300042993 Ga0439440_0191947 Ga0439440_0191947_299_568 89
234 3300042993 Ga0439440_0231226 Ga0439440_0231226_64_333 89
235 3300046525 Ga0495663_0280189 Ga0495663_0280189_180_449 89
236 3300046794 Ga0495589_0571615 Ga0495589_0571615_191_460 89
237 3300049592 Ga0501076_0815133 Ga0501076_0815133_91_369 89
238 3300050507 nmdc:mga05p37_1208031_c1 nmdc:mga05p37_1208031_c1_458_736 89
239 3300050507 nmdc:mga05p37_196001_c1 nmdc:mga05p37_196001_c1_1121_1390 89
240 3300050507 nmdc:mga05p37_49329_c1 nmdc:mga05p37_49329_c1_189_458 89
241 3300050508 nmdc:mga09592_1241592_c1 nmdc:mga09592_1241592_c1_281_550 89
242 3300050508 nmdc:mga09592_675423_c1 nmdc:mga09592_675423_c1_431_709 89
243 3300050509 nmdc:mga0qj67_26839_c1 nmdc:mga0qj67_26839_c1_80_349 89
244 3300050510 nmdc:mga06r32_46215_c1 nmdc:mga06r32_46215_c1_3821_4090 89
245 3300050511 nmdc:mga08y16_1597750_c1 nmdc:mga08y16_1597750_c1_78_356 89
246 3300050511 nmdc:mga08y16_38908_c1 nmdc:mga08y16_38908_c1_346_615 89
247 3300050511 nmdc:mga08y16_467320_c1 nmdc:mga08y16_467320_c1_858_1127 89
248 3300050512 nmdc:mga0n895_34702_c1 nmdc:mga0n895_34702_c1_305_574 89
249 3300050512 nmdc:mga0n895_348479_c1 nmdc:mga0n895_348479_c1_1036_1305 89
250 3300050513 nmdc:mga0rr50_135013_c1 nmdc:mga0rr50_135013_c1_1669_1947 89
251 3300050513 nmdc:mga0rr50_623675_c1 nmdc:mga0rr50_623675_c1_608_877 89
252 3300050515 nmdc:mga0a205_29579_c1 nmdc:mga0a205_29579_c1_4719_4988 89
253 3300061734 Ga0530510_0584771 Ga0530510_0584771_97_366 89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ion-assembly1.cif.gz_A the complex of c4.4a with its antibody 11h10 fab fragment 0.6723 1 54
3u74-assembly1.cif.gz_U crystal structure of stabilized human upar mutant 0.6621 6 54
1ywh-assembly2.cif.gz_C crystal structure of urokinase plasminogen activator receptor 0.6388 1 54
1ywh-assembly2.cif.gz_G crystal structure of urokinase plasminogen activator receptor 0.6271 1 54
7bps-assembly2.cif.gz_B crystal structure of mouse tex101 0.6094 3 54
ID Description Score Start End Superfamily
af_Q9D262_27_106_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.7182 9 54 2.10.60.10
af_Q09098_24_98_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.7124 6 54 2.10.60.10
af_H9LAA7_26_104_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.7085 9 54 2.10.60.10
af_H8Y6J1_25_103_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.697 9 55 2.10.60.10
af_Q3UW02_23_101_2.10.60.10 Mainly Beta;Ribbon;CD59;CD59 0.6963 7 55 2.10.60.10
ID Description Score Start End GO Terms
AF-A0A821F2E6-F1-model_v4 deleted 0.7979 9 54
AF-A0A813NQX3-F1-model_v4 UPAR/Ly6 domain-containing protein 0.7854 6 54
AF-A0A814DSB1-F1-model_v4 UPAR/Ly6 domain-containing protein 0.7812 6 54
AF-A0A2K5NGR4-F1-model_v4 Prostate and testis expressed 4 0.7801 2 54
AF-A0A6P7WXL4-F1-model_v4 Lymphocyte antigen 6E-like 0.7791 5 54 GO:0005886

Feature Viewer

pLDDT pTM Quality
73.04 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map