F364206

General Info

Members Datasets Scaffolds Average Seq Length
253 182 506 116

Family's Representative Sequence

Representative Sequence 3300035115|Ga0373941_0524818|Ga0373941_0524818_10_408
Length 132
Sequence VAGLLSAPLMAETGPVVEMSQEDFESAVSDALDSVPAELAKLMNNVVVLVEDDAPPDAPDLLGLYEGTPLTERDDGWAAGSLPDRITIFRRPTLEYCRTPAEVVDEVRVTVIHEIAHHFGIDDDRLHDLGWA

Samples

Sample ID Description Type Environment
1 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
22 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
67 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
70 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
71 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
72 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
75 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
96 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
103 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
104 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
108 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
115 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
124 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
140 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
166 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
167 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
168 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2501939600 Micromonospora sp. L5 Isolate Unclassified
175 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
176 2643221561 Nocardioides sp. Root151 Isolate Unclassified
177 2643221572 Leifsonia sp. Root60 Isolate Unclassified
178 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
179 2643221696 Nocardioides sp. Root140 Isolate Unclassified
180 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
181 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
182 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 0
Isolates 3.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0.79
Rhizoplane 17.79
Rhizosphere 72.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373941_0524818 3300035115 Bacteria 507
2 JGI25406J46586_10072721 3300003203 Bacteria 1074
3 Ga0070683_100013759 3300005329 Bacteria 7064
4 Ga0070683_100350583 3300005329 Bacteria 1406
5 Ga0068869_100325694 3300005334 Bacteria 1247
6 Ga0070689_100902644 3300005340 Bacteria 782
7 Ga0070661_100462283 3300005344 Bacteria 1011
8 Ga0070659_100034729 3300005366 Bacteria 3923
9 Ga0070700_100136481 3300005441 Bacteria 1662
10 Ga0070684_100783981 3300005535 Bacteria 891
11 Ga0070684_101225031 3300005535 Bacteria 706
12 Ga0070664_100054358 3300005564 Bacteria 3397
13 Ga0068854_101052084 3300005578 Bacteria 723
14 Ga0068852_101833950 3300005616 Bacteria 629
15 Ga0068864_101016095 3300005618 Bacteria 823
16 Ga0068861_101388791 3300005719 Bacteria 686
17 Ga0068860_100344721 3300005843 Bacteria 1465
18 Ga0081455_10000125 3300005937 Bacteria 89043
19 Ga0081540_1003679 3300005983 Bacteria 12027
20 Ga0081539_10005632 3300005985 Bacteria 12600
21 Ga0081539_10020993 3300005985 Bacteria 4384
22 Ga0081539_10118943 3300005985 Bacteria 1316
23 Ga0075428_100967156 3300006844 Bacteria 902
24 Ga0068865_101031255 3300006881 Bacteria 722
25 Ga0099826_10254624 3300006948 Bacteria 923
26 Ga0105250_10451871 3300009092 Bacteria 577
27 Ga0105245_10036939 3300009098 Bacteria 4341
28 Ga0105245_12965887 3300009098 Bacteria 526
29 Ga0105247_11408332 3300009101 Bacteria 564
30 Ga0105242_10720533 3300009176 Bacteria 978
31 Ga0105248_10256061 3300009177 Bacteria 1970
32 Ga0105249_10439356 3300009553 Bacteria 1342
33 Ga0105249_11067363 3300009553 Bacteria 877
34 Ga0105249_11508846 3300009553 Bacteria 744
35 Ga0105239_10442791 3300010375 Bacteria 1473
36 Ga0157371_10321936 3300013102 Bacteria 1122
37 Ga0157370_11761860 3300013104 Bacteria 556
38 Ga0157369_11371112 3300013105 Bacteria 720
39 Ga0157378_11045771 3300013297 Bacteria 852
40 Ga0157378_11146939 3300013297 Bacteria 815
41 Ga0163162_10775260 3300013306 Bacteria 1077
42 Ga0163162_11169272 3300013306 Bacteria 873
43 Ga0157372_10023828 3300013307 Bacteria 6641
44 Ga0157372_10922496 3300013307 Bacteria 1013
45 Ga0157372_12449468 3300013307 Bacteria 599
46 Ga0157375_10034688 3300013308 Bacteria 4809
47 Ga0157375_10056834 3300013308 Bacteria 3866
48 Ga0157375_10130239 3300013308 Bacteria 2634
49 Ga0157375_11194078 3300013308 Bacteria 892
50 Ga0163163_10257296 3300014325 Bacteria 1797
51 Ga0163163_11541993 3300014325 Bacteria 726
52 Ga0157380_10430875 3300014326 Bacteria 1261
53 Ga0182008_10038880 3300014497 Bacteria 2378
54 Ga0207657_11120938 3300025919 Bacteria 601
55 Ga0207687_10024465 3300025927 Bacteria 4035
56 Ga0207700_11038450 3300025928 Bacteria 733
57 Ga0207700_12043940 3300025928 Bacteria 500
58 Ga0207669_11305093 3300025937 Bacteria 617
59 Ga0207704_11104647 3300025938 Bacteria 674
60 Ga0207711_11746501 3300025941 Bacteria 565
61 Ga0207689_10226037 3300025942 Bacteria 1547
62 Ga0207661_11436758 3300025944 Bacteria 633
63 Ga0207679_10212050 3300025945 Bacteria 1625
64 Ga0207679_11710706 3300025945 Bacteria 575
65 Ga0207712_10862271 3300025961 Bacteria 799
66 Ga0207677_11293214 3300026023 Bacteria 670
67 Ga0207639_11340254 3300026041 Bacteria 672
68 Ga0207708_10136344 3300026075 Bacteria 1922
69 Ga0207675_100881566 3300026118 Bacteria 911
70 Ga0209282_1297721 3300027666 Bacteria 687
71 Ga0268264_10308108 3300028381 Bacteria 1493
72 Ga0265328_10201669 3300031239 Bacteria 755
73 Ga0307513_10000248 3300031456 Bacteria 78312
74 Ga0307513_10832786 3300031456 Bacteria 629
75 Ga0307508_10430174 3300031616 Bacteria 912
76 Ga0307413_10791533 3300031824 Bacteria 796
77 Ga0307407_10777630 3300031903 Bacteria 727
78 Ga0307409_100564272 3300031995 Bacteria 1120
79 Ga0307409_100718645 3300031995 Bacteria 1000
80 Ga0307414_10835253 3300032004 Bacteria 842
81 Ga0316574_0486948 3300035398 Bacteria 770
82 Ga0316584_1017231 3300036712 Bacteria 553
83 Ga0395899_0173433 3300037312 Bacteria 1517
84 Ga0436363_0567365 3300039450 Bacteria 1239
85 Ga0451787_352704 3300041441 Bacteria 773
86 Ga0451800_0467692 3300041459 Bacteria 502
87 Ga0451807_2595440 3300041486 Bacteria 599
88 Ga0451837_0728029 3300041494 Bacteria 809
89 Ga0451839_1388787 3300041496 Bacteria 665
90 Ga0451845_0626289 3300041501 Bacteria 910
91 Ga0451849_1203268 3300041505 Bacteria 822
92 Ga0451843_1290900 3300041509 Bacteria 1137
93 Ga0451855_1955538 3300041511 Bacteria 608
94 Ga0451853_1910354 3300041512 Bacteria 2048
95 Ga0466969_0056941 3300044656 Bacteria 1907
96 Ga0466972_0021235 3300044658 Bacteria 3239
97 Ga0466965_0437311 3300044683 Bacteria 727
98 Ga0466966_0009241 3300044684 Bacteria 6527
99 Ga0466966_0029876 3300044684 Bacteria 3543
100 Ga0466966_0307251 3300044684 Bacteria 953
101 Ga0466966_0355796 3300044684 Bacteria 880
102 Ga0466961_0023119 3300044693 Bacteria 3997
103 Ga0466963_0395177 3300044694 Bacteria 975
104 Ga0466963_0480177 3300044694 Bacteria 877
105 Ga0466964_0065649 3300044706 Bacteria 1521
106 Ga0466971_0649309 3300044719 Bacteria 528
107 Ga0466968_0083427 3300044735 Bacteria 1408
108 Ga0466968_0226598 3300044735 Bacteria 882
109 Ga0466968_0238723 3300044735 Bacteria 860
110 Ga0466957_0307140 3300044842 Bacteria 1067
111 Ga0466957_1205450 3300044842 Bacteria 548
112 Ga0466960_0004796 3300044901 Bacteria 5312
113 Ga0466960_0097584 3300044901 Bacteria 1508
114 Ga0466960_0457992 3300044901 Bacteria 742
115 Ga0466960_0675805 3300044901 Bacteria 618
116 Ga0466959_0127182 3300045049 Bacteria 1808
117 Ga0466959_0245230 3300045049 Bacteria 1236
118 Ga0466959_0347041 3300045049 Bacteria 1012
119 Ga0466967_0453041 3300045976 Bacteria 1254
120 Ga0466967_1793733 3300045976 Bacteria 611
121 Ga0495592_0001651 3300046454 Bacteria 15642
122 Ga0495603_0038974 3300046455 Bacteria 2848
123 Ga0495629_0086233 3300046459 Bacteria 2190
124 Ga0495638_0064320 3300046460 Bacteria 2260
125 Ga0495641_0082442 3300046461 Bacteria 1440
126 Ga0495651_0047776 3300046462 Bacteria 3306
127 Ga0495653_0053199 3300046463 Bacteria 3098
128 Ga0495580_0031492 3300046472 Bacteria 3832
129 Ga0495662_0000427 3300046476 Bacteria 18850
130 Ga0495664_0036172 3300046477 Bacteria 2909
131 Ga0495594_0168804 3300046499 Bacteria 1244
132 Ga0495606_0008513 3300046507 Bacteria 8895
133 Ga0495608_0005817 3300046511 Bacteria 8785
134 Ga0495616_0071491 3300046513 Bacteria 1677
135 Ga0495618_0048648 3300046514 Bacteria 2677
136 Ga0495628_0013095 3300046516 Bacteria 6982
137 Ga0495630_0038966 3300046517 Bacteria 3554
138 Ga0495666_0004777 3300046526 Bacteria 6849
139 Ga0495666_0060901 3300046526 Bacteria 1803
140 Ga0495652_0014848 3300046529 Bacteria 6980
141 Ga0495665_0010821 3300046531 Bacteria 4936
142 Ga0495640_0016501 3300046533 Bacteria 5522
143 Ga0495586_0136028 3300046535 Bacteria 1377
144 Ga0495587_0042863 3300046536 Bacteria 2696
145 Ga0495622_0038894 3300046557 Bacteria 2214
146 Ga0495667_0003651 3300046559 Bacteria 10355
147 Ga0495668_0015583 3300046616 Bacteria 4435
148 Ga0495625_0054902 3300046660 Bacteria 2843
149 Ga0495635_0018322 3300046663 Bacteria 4885
150 Ga0495657_0005934 3300046675 Bacteria 9597
151 Ga0495599_0326023 3300046678 Bacteria 923
152 Ga0495623_0008297 3300046679 Bacteria 6757
153 Ga0495646_0024209 3300046680 Bacteria 3823
154 Ga0495613_0019230 3300046689 Bacteria 5092
155 Ga0495589_0044808 3300046794 Bacteria 2198
156 Ga0495581_0022720 3300047315 Bacteria 3633
157 Ga0495604_0000215 3300047317 Bacteria 52868
158 Ga0495674_0075407 3300047319 Bacteria 2902
159 Ga0495674_0381698 3300047319 Bacteria 1140
160 Ga0495676_0043084 3300047321 Bacteria 3697
161 Ga0495675_0115394 3300047444 Bacteria 1674
162 Ga0495593_0177373 3300047673 Bacteria 1073
163 Ga0495593_0415637 3300047673 Bacteria 673
164 Ga0495602_0017932 3300048088 Bacteria 7083
165 Ga0495614_0048620 3300048089 Bacteria 1818
166 Ga0495626_0005208 3300048091 Bacteria 7695
167 Ga0496100_0010953 3300048903 Bacteria 5145
168 Ga0496100_0048888 3300048903 Bacteria 2732
169 Ga0496100_0140864 3300048903 Bacteria 1709
170 Ga0496101_0044802 3300048904 Bacteria 3167
171 Ga0496101_0340720 3300048904 Bacteria 1177
172 Ga0496102_0042665 3300048905 Bacteria 4111
173 Ga0496102_0104924 3300048905 Bacteria 2629
174 Ga0496102_0658536 3300048905 Bacteria 970
175 Ga0496104_0031893 3300048907 Bacteria 4902
176 Ga0496104_1050880 3300048907 Bacteria 718
177 Ga0496105_0023996 3300048908 Bacteria 4954
178 Ga0496105_0188634 3300048908 Bacteria 1687
179 Ga0496105_0809265 3300048908 Bacteria 712
180 Ga0496106_0129578 3300048909 Bacteria 1978
181 Ga0496106_0157175 3300048909 Bacteria 1796
182 Ga0496106_0633808 3300048909 Bacteria 855
183 Ga0496106_0817711 3300048909 Bacteria 739
184 Ga0496107_0040402 3300048910 Bacteria 3348
185 Ga0496107_0093514 3300048910 Bacteria 2198
186 Ga0496108_0153709 3300048911 Bacteria 1986
187 Ga0496108_0756069 3300048911 Bacteria 840
188 Ga0496108_1068912 3300048911 Bacteria 687
189 Ga0496108_1258125 3300048911 Bacteria 624
190 Ga0496108_1324087 3300048911 Bacteria 605
191 Ga0496109_0074448 3300048912 Bacteria 3121
192 Ga0496109_0093327 3300048912 Bacteria 2785
193 Ga0496109_1704806 3300048912 Bacteria 564
194 Ga0496110_0122391 3300048913 Bacteria 2345
195 Ga0496110_0438154 3300048913 Bacteria 1191
196 Ga0496110_1416717 3300048913 Bacteria 604
197 Ga0496111_0356695 3300048914 Bacteria 1082
198 Ga0496111_0425744 3300048914 Bacteria 980
199 Ga0496112_0585726 3300048915 Bacteria 1048
200 Ga0496113_0050615 3300048916 Bacteria 3098
201 Ga0496113_0141734 3300048916 Bacteria 1891
202 Ga0496113_0695597 3300048916 Bacteria 811
203 Ga0496114_0025156 3300048917 Bacteria 4863
204 Ga0496114_0036322 3300048917 Bacteria 4072
205 Ga0496114_0051959 3300048917 Bacteria 3413
206 Ga0496115_0019271 3300048918 Bacteria 5249
207 Ga0496115_0304156 3300048918 Bacteria 1306
208 Ga0496115_0694648 3300048918 Bacteria 800
209 Ga0495682_0072238 3300049460 Bacteria 1242
210 Ga0501297_092624 3300049520 Bacteria 505
211 Ga0501031_0372325 3300049568 Bacteria 924
212 Ga0501039_0672477 3300049575 Bacteria 810
213 Ga0501040_1007108 3300049576 Bacteria 604
214 Ga0501041_0512864 3300049577 Bacteria 763
215 Ga0501041_0877845 3300049577 Bacteria 576
216 Ga0501047_0000016 3300049581 Bacteria 284621
217 Ga0501048_0455686 3300049582 Bacteria 916
218 Ga0501048_1187105 3300049582 Bacteria 549
219 Ga0501067_0146411 3300049583 Bacteria 1316
220 Ga0501070_0129668 3300049586 Bacteria 2083
221 Ga0501071_0914463 3300049587 Bacteria 677
222 Ga0501072_1110152 3300049588 Bacteria 615
223 Ga0501075_0924219 3300049591 Bacteria 663
224 Ga0501075_1135548 3300049591 Bacteria 593
225 Ga0501079_1028662 3300049741 Bacteria 649
226 Ga0501081_0878879 3300049743 Bacteria 676
227 Ga0501035_1504784 3300049822 Bacteria 513
228 Ga0501045_0251761 3300049824 Bacteria 1315
229 Ga0501045_0539138 3300049824 Bacteria 866
230 Ga0501045_0913584 3300049824 Bacteria 645
231 Ga0501045_1028191 3300049824 Bacteria 604
232 Ga0495601_0004246 3300053077 Bacteria 8274
233 Ga0495655_0044511 3300053083 Bacteria 1149
234 Ga0495595_0095991 3300053084 Bacteria 1427
235 Ga0495619_0034806 3300053085 Bacteria 3275
236 Ga0500556_0000907 3300053104 Bacteria 16423
237 Ga0500568_0184783 3300053139 Bacteria 766
238 Ga0500604_0068161 3300053151 Bacteria 1130
239 Ga0500616_0011743 3300053153 Bacteria 5155
240 Ga0466962_0104695 3300061719 Bacteria 1360
241 Ga0466962_0281462 3300061719 Bacteria 821
242 Ga0466962_0501326 3300061719 Bacteria 614
243 Ga0466962_0601316 3300061719 Bacteria 561
244 Ga0530510_1103123 3300061734 Bacteria 608
245 2501943694 2501939600 Bacteria 6907073
246 2515856190 2515154155 Bacteria 7985436
247 2643827236 2643221561 Bacteria 4984412
248 2643875508 2643221572 Bacteria 3614809
249 2644382563 2643221669 Bacteria 3611286
250 2644533937 2643221696 Bacteria 5431823
251 2856859591 2856858025 Bacteria 7255264
252 2895661597 2895660088 Bacteria 3782833
253 649816299 649633069 Bacteria 6962533
254 Ga0373941_0524818
255 JGI25406J46586_10072721
256 Ga0070683_100013759
257 Ga0070683_100350583
258 Ga0068869_100325694
259 Ga0070689_100902644
260 Ga0070661_100462283
261 Ga0070659_100034729
262 Ga0070700_100136481
263 Ga0070684_100783981
264 Ga0070684_101225031
265 Ga0070664_100054358
266 Ga0068854_101052084
267 Ga0068852_101833950
268 Ga0068864_101016095
269 Ga0068861_101388791
270 Ga0068860_100344721
271 Ga0081455_10000125
272 Ga0081540_1003679
273 Ga0081539_10005632
274 Ga0081539_10020993
275 Ga0081539_10118943
276 Ga0075428_100967156
277 Ga0068865_101031255
278 Ga0099826_10254624
279 Ga0105250_10451871
280 Ga0105245_10036939
281 Ga0105245_12965887
282 Ga0105247_11408332
283 Ga0105242_10720533
284 Ga0105248_10256061
285 Ga0105249_10439356
286 Ga0105249_11067363
287 Ga0105249_11508846
288 Ga0105239_10442791
289 Ga0157371_10321936
290 Ga0157370_11761860
291 Ga0157369_11371112
292 Ga0157378_11045771
293 Ga0157378_11146939
294 Ga0163162_10775260
295 Ga0163162_11169272
296 Ga0157372_10023828
297 Ga0157372_10922496
298 Ga0157372_12449468
299 Ga0157375_10034688
300 Ga0157375_10056834
301 Ga0157375_10130239
302 Ga0157375_11194078
303 Ga0163163_10257296
304 Ga0163163_11541993
305 Ga0157380_10430875
306 Ga0182008_10038880
307 Ga0207657_11120938
308 Ga0207687_10024465
309 Ga0207700_11038450
310 Ga0207700_12043940
311 Ga0207669_11305093
312 Ga0207704_11104647
313 Ga0207711_11746501
314 Ga0207689_10226037
315 Ga0207661_11436758
316 Ga0207679_10212050
317 Ga0207679_11710706
318 Ga0207712_10862271
319 Ga0207677_11293214
320 Ga0207639_11340254
321 Ga0207708_10136344
322 Ga0207675_100881566
323 Ga0209282_1297721
324 Ga0268264_10308108
325 Ga0265328_10201669
326 Ga0307513_10000248
327 Ga0307513_10832786
328 Ga0307508_10430174
329 Ga0307413_10791533
330 Ga0307407_10777630
331 Ga0307409_100564272
332 Ga0307409_100718645
333 Ga0307414_10835253
334 Ga0316574_0486948
335 Ga0316584_1017231
336 Ga0395899_0173433
337 Ga0436363_0567365
338 Ga0451787_352704
339 Ga0451800_0467692
340 Ga0451807_2595440
341 Ga0451837_0728029
342 Ga0451839_1388787
343 Ga0451845_0626289
344 Ga0451849_1203268
345 Ga0451843_1290900
346 Ga0451855_1955538
347 Ga0451853_1910354
348 Ga0466969_0056941
349 Ga0466972_0021235
350 Ga0466965_0437311
351 Ga0466966_0009241
352 Ga0466966_0029876
353 Ga0466966_0307251
354 Ga0466966_0355796
355 Ga0466961_0023119
356 Ga0466963_0395177
357 Ga0466963_0480177
358 Ga0466964_0065649
359 Ga0466971_0649309
360 Ga0466968_0083427
361 Ga0466968_0226598
362 Ga0466968_0238723
363 Ga0466957_0307140
364 Ga0466957_1205450
365 Ga0466960_0004796
366 Ga0466960_0097584
367 Ga0466960_0457992
368 Ga0466960_0675805
369 Ga0466959_0127182
370 Ga0466959_0245230
371 Ga0466959_0347041
372 Ga0466967_0453041
373 Ga0466967_1793733
374 Ga0495592_0001651
375 Ga0495603_0038974
376 Ga0495629_0086233
377 Ga0495638_0064320
378 Ga0495641_0082442
379 Ga0495651_0047776
380 Ga0495653_0053199
381 Ga0495580_0031492
382 Ga0495662_0000427
383 Ga0495664_0036172
384 Ga0495594_0168804
385 Ga0495606_0008513
386 Ga0495608_0005817
387 Ga0495616_0071491
388 Ga0495618_0048648
389 Ga0495628_0013095
390 Ga0495630_0038966
391 Ga0495666_0004777
392 Ga0495666_0060901
393 Ga0495652_0014848
394 Ga0495665_0010821
395 Ga0495640_0016501
396 Ga0495586_0136028
397 Ga0495587_0042863
398 Ga0495622_0038894
399 Ga0495667_0003651
400 Ga0495668_0015583
401 Ga0495625_0054902
402 Ga0495635_0018322
403 Ga0495657_0005934
404 Ga0495599_0326023
405 Ga0495623_0008297
406 Ga0495646_0024209
407 Ga0495613_0019230
408 Ga0495589_0044808
409 Ga0495581_0022720
410 Ga0495604_0000215
411 Ga0495674_0075407
412 Ga0495674_0381698
413 Ga0495676_0043084
414 Ga0495675_0115394
415 Ga0495593_0177373
416 Ga0495593_0415637
417 Ga0495602_0017932
418 Ga0495614_0048620
419 Ga0495626_0005208
420 Ga0496100_0010953
421 Ga0496100_0048888
422 Ga0496100_0140864
423 Ga0496101_0044802
424 Ga0496101_0340720
425 Ga0496102_0042665
426 Ga0496102_0104924
427 Ga0496102_0658536
428 Ga0496104_0031893
429 Ga0496104_1050880
430 Ga0496105_0023996
431 Ga0496105_0188634
432 Ga0496105_0809265
433 Ga0496106_0129578
434 Ga0496106_0157175
435 Ga0496106_0633808
436 Ga0496106_0817711
437 Ga0496107_0040402
438 Ga0496107_0093514
439 Ga0496108_0153709
440 Ga0496108_0756069
441 Ga0496108_1068912
442 Ga0496108_1258125
443 Ga0496108_1324087
444 Ga0496109_0074448
445 Ga0496109_0093327
446 Ga0496109_1704806
447 Ga0496110_0122391
448 Ga0496110_0438154
449 Ga0496110_1416717
450 Ga0496111_0356695
451 Ga0496111_0425744
452 Ga0496112_0585726
453 Ga0496113_0050615
454 Ga0496113_0141734
455 Ga0496113_0695597
456 Ga0496114_0025156
457 Ga0496114_0036322
458 Ga0496114_0051959
459 Ga0496115_0019271
460 Ga0496115_0304156
461 Ga0496115_0694648
462 Ga0495682_0072238
463 Ga0501297_092624
464 Ga0501031_0372325
465 Ga0501039_0672477
466 Ga0501040_1007108
467 Ga0501041_0512864
468 Ga0501041_0877845
469 Ga0501047_0000016
470 Ga0501048_0455686
471 Ga0501048_1187105
472 Ga0501067_0146411
473 Ga0501070_0129668
474 Ga0501071_0914463
475 Ga0501072_1110152
476 Ga0501075_0924219
477 Ga0501075_1135548
478 Ga0501079_1028662
479 Ga0501081_0878879
480 Ga0501035_1504784
481 Ga0501045_0251761
482 Ga0501045_0539138
483 Ga0501045_0913584
484 Ga0501045_1028191
485 Ga0495601_0004246
486 Ga0495655_0044511
487 Ga0495595_0095991
488 Ga0495619_0034806
489 Ga0500556_0000907
490 Ga0500568_0184783
491 Ga0500604_0068161
492 Ga0500616_0011743
493 Ga0466962_0104695
494 Ga0466962_0281462
495 Ga0466962_0501326
496 Ga0466962_0601316
497 Ga0530510_1103123
498 2501943694
499 2515856190
500 2643827236
501 2643875508
502 2644382563
503 2644533937
504 2856859591
505 2895661597
506 649816299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

43

131

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.8096 1 112
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.646 2 102
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6136 2 102
6tn3-assembly1.cif.gz_A crystal structure of aspergillus fumigatus udp-n-acetylglucosamine pyrophosphorylase in complex with glcnac-1p 0.5429 1 36
2ejq-assembly2.cif.gz_B conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.5428 2 113
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.8077 1 112 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7745 1 112 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.7261 1 104 3.30.2010.20
1or7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6685 1 26 1.10.10.10
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.662 1 104 3.30.2010.20
ID Description Score Start End GO Terms
AF-A0A1G3D095-F1-model_v4 Metallopeptidase family protein 0.9539 44 112
AF-A0A7V7WLC8-F1-model_v4 Metallopeptidase family protein 0.9521 1 112
AF-M1V0M2-F1-model_v4 Metallopeptidase family protein 0.9447 1 114
AF-A0A398D0C8-F1-model_v4 Metallopeptidase family protein 0.9353 1 110
AF-A0A7X8BIT1-F1-model_v4 Metallopeptidase family protein 0.935 1 112

Map