F364190

General Info

Members Datasets Scaffolds Average Seq Length
253 144 506 240

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10003171|Ga0307410_100031712
Length 277
Sequence MAEIAVVSLSSYIAAPGSGRGKGAGPDGVRVAEGSLGSGTVQSYPAPAKLTVSLRVTGRRADGYHLLDAEMVTLDLADELRFSDGDGLEVVAAGSGLAVPVGDDNLVRRALAAVGRAAHVRLTKRIPAGAGLGGGSADAAAVFRWAGVDDLDLAASIGADVPFCVRGGRARVRGIGERVDALPHVPRTFTLLVPPLGCSTPAVYRAWDDLGGPTADGPNDLEPAALRVEPRLAEWRDRLGDATGQVPVLAGSGSSWFVEGAFPGDGRIVARTRPAPA

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
46 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
47 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
55 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
56 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
57 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
58 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
70 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
71 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
72 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
73 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
74 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
113 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
114 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
139 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
140 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
141 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
142 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.88
Nodule 0
Rhizoplane 0.79
Rhizosphere 86.56
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10003171 3300031852 Bacteria 8187
2 JGI25407J50210_10004362 3300003373 Bacteria 3438
3 Ga0068868_100113460 3300005338 Bacteria 2204
4 Ga0070671_100021124 3300005355 Bacteria 5316
5 Ga0070671_100327747 3300005355 Bacteria 1305
6 Ga0070711_100560147 3300005439 Bacteria 949
7 Ga0070708_100002097 3300005445 Bacteria 15382
8 Ga0070678_100524079 3300005456 Bacteria 1049
9 Ga0068867_100088978 3300005459 Bacteria 2341
10 Ga0068867_100272366 3300005459 Bacteria 1385
11 Ga0070698_100537242 3300005471 Bacteria 1108
12 Ga0068855_100618773 3300005563 Bacteria 1166
13 Ga0068864_100670123 3300005618 Unclassified 1011
14 Ga0068861_100117674 3300005719 Unclassified 2139
15 Ga0068858_100002983 3300005842 Bacteria 16989
16 Ga0068860_100035524 3300005843 Bacteria 4780
17 Ga0081455_10001828 3300005937 Bacteria 25614
18 Ga0081455_10009918 3300005937 Bacteria 9744
19 Ga0081538_10000640 3300005981 Bacteria 38750
20 Ga0081538_10000662 3300005981 Bacteria 38052
21 Ga0081538_10056198 3300005981 Bacteria 2308
22 Ga0081539_10125104 3300005985 Bacteria 1271
23 Ga0075365_10023601 3300006038 Bacteria 3870
24 Ga0075365_10029362 3300006038 Bacteria 3514
25 Ga0075365_10033897 3300006038 Unclassified 3294
26 Ga0075365_10050367 3300006038 Bacteria 2747
27 Ga0075365_10095280 3300006038 Bacteria 2033
28 Ga0075365_10259542 3300006038 Bacteria 1221
29 Ga0075365_10280707 3300006038 Bacteria 1172
30 Ga0075365_10301171 3300006038 Bacteria 1128
31 Ga0075363_100077025 3300006048 Bacteria 1819
32 Ga0075364_10035397 3300006051 Bacteria 3226
33 Ga0075364_10042333 3300006051 Bacteria 2958
34 Ga0075364_10081232 3300006051 Bacteria 2143
35 Ga0075367_10394397 3300006178 Bacteria 875
36 Ga0075428_100010356 3300006844 Bacteria 10348
37 Ga0075428_100051340 3300006844 Bacteria 4522
38 Ga0075428_100234237 3300006844 Bacteria 1981
39 Ga0075428_100802113 3300006844 Bacteria 1001
40 Ga0075430_100003730 3300006846 Bacteria 12802
41 Ga0075430_100004823 3300006846 Bacteria 11352
42 Ga0075430_100060187 3300006846 Bacteria 3192
43 Ga0075430_100116832 3300006846 Bacteria 2223
44 Ga0075430_100117405 3300006846 Bacteria 2218
45 Ga0075430_100191532 3300006846 Bacteria 1699
46 Ga0075431_100015198 3300006847 Bacteria 7800
47 Ga0075431_100162854 3300006847 Bacteria 2293
48 Ga0075431_100184615 3300006847 Bacteria 2139
49 Ga0075429_100010455 3300006880 Bacteria 8029
50 Ga0075429_100065343 3300006880 Bacteria 3167
51 Ga0068865_100682921 3300006881 Bacteria 876
52 Ga0111539_10000408 3300009094 Bacteria 53635
53 Ga0111539_10213421 3300009094 Bacteria 2249
54 Ga0111539_10220133 3300009094 Bacteria 2211
55 Ga0111539_10321242 3300009094 Bacteria 1801
56 Ga0111539_10742678 3300009094 Bacteria 1142
57 Ga0105245_10000789 3300009098 Bacteria 28722
58 Ga0105245_10093058 3300009098 Bacteria 2777
59 Ga0114129_10003082 3300009147 Bacteria 23393
60 Ga0114129_10018796 3300009147 Bacteria 9841
61 Ga0114129_10133896 3300009147 Bacteria 3402
62 Ga0114129_10449556 3300009147 Bacteria 1690
63 Ga0114129_11236608 3300009147 Bacteria 928
64 Ga0105242_10075410 3300009176 Bacteria 2808
65 Ga0105249_10737219 3300009553 Bacteria 1047
66 Ga0157375_10686646 3300013308 Bacteria 1178
67 Ga0157379_10139514 3300014968 Bacteria 2185
68 Ga0206353_10416746 3300020082 Bacteria 1190
69 Ga0224572_1010345 3300024225 Bacteria 1752
70 Ga0207652_10607430 3300025921 Bacteria 980
71 Ga0207650_10369573 3300025925 Bacteria 1183
72 Ga0207687_10002249 3300025927 Bacteria 13152
73 Ga0207687_10003927 3300025927 Bacteria 9959
74 Ga0207686_10149015 3300025934 Bacteria 1626
75 Ga0207703_10449599 3300026035 Bacteria 1203
76 Ga0207675_100414552 3300026118 Bacteria 1329
77 Ga0207683_10366032 3300026121 Bacteria 1324
78 Ga0207428_10267510 3300027907 Bacteria 1272
79 Ga0207428_10312452 3300027907 Bacteria 1162
80 Ga0268264_10014665 3300028381 Bacteria 6439
81 Ga0316579_10042888 3300031691 Bacteria 2103
82 Ga0316576_10058119 3300031727 Bacteria 2828
83 Ga0316578_10079580 3300031728 Bacteria 1949
84 Ga0316578_10261528 3300031728 Bacteria 1037
85 Ga0307405_10061207 3300031731 Bacteria 2379
86 Ga0307406_10466726 3300031901 Bacteria 1016
87 Ga0307407_10032089 3300031903 Bacteria 2852
88 Ga0307407_10552124 3300031903 Bacteria 852
89 Ga0307409_100086285 3300031995 Bacteria 2554
90 Ga0307416_100067146 3300032002 Bacteria 2956
91 Ga0307416_100096609 3300032002 Bacteria 2556
92 Ga0307411_10030666 3300032005 Bacteria 3299
93 Ga0307411_10123838 3300032005 Bacteria 1876
94 Ga0307415_100147832 3300032126 Bacteria 1804
95 Ga0307415_100396060 3300032126 Bacteria 1177
96 Ga0373930_0012217 3300034816 Bacteria 1563
97 Ga0373930_0046252 3300034816 Bacteria 939
98 Ga0373928_0001244 3300035084 Bacteria 5006
99 Ga0373951_0037257 3300035091 Bacteria 1163
100 Ga0373932_0000328 3300035112 Bacteria 14536
101 Ga0316574_0038014 3300035398 Bacteria 2954
102 Ga0373931_0000032 3300035691 Bacteria 96498
103 Ga0373931_0000146 3300035691 Bacteria 30952
104 Ga0373937_0832489 3300036401 Bacteria 871
105 Ga0316584_0159933 3300036712 Bacteria 1673
106 Ga0400483_006266 3300039062 Bacteria 1633
107 Ga0400483_134327 3300039062 Bacteria 3876
108 Ga0400483_157387 3300039062 Bacteria 7407
109 Ga0400483_183765 3300039062 Bacteria 1620
110 Ga0400483_270663 3300039062 Bacteria 1465
111 Ga0436365_1279579 3300039437 Bacteria 6621
112 Ga0436361_1099874 3300039447 Bacteria 1767
113 Ga0436362_0003653 3300039453 Bacteria 2125
114 Ga0451843_0806122 3300041509 Bacteria 3756
115 Ga0439448_0044145 3300042005 Bacteria 1449
116 Ga0439451_016374 3300042009 Bacteria 1494
117 Ga0439452_028094 3300042010 Bacteria 1407
118 Ga0439456_049457 3300042013 Bacteria 918
119 Ga0439463_048729 3300042016 Bacteria 1080
120 Ga0439434_0022638 3300042435 Bacteria 1889
121 Ga0439460_0033210 3300042461 Bacteria 1481
122 Ga0466965_0067657 3300044683 Bacteria 1793
123 Ga0466966_0021346 3300044684 Bacteria 4252
124 Ga0466966_0046618 3300044684 Bacteria 2766
125 Ga0466959_0221912 3300045049 Bacteria 1310
126 Ga0466967_0624161 3300045976 Bacteria 1065
127 Ga0495629_0158985 3300046459 Bacteria 1570
128 Ga0495651_0221411 3300046462 Bacteria 1309
129 Ga0495582_0432992 3300046473 Bacteria 759
130 Ga0495664_0342550 3300046477 Bacteria 901
131 Ga0495608_0035392 3300046511 Bacteria 3368
132 Ga0495608_0147933 3300046511 Bacteria 1498
133 Ga0495586_0022662 3300046535 Bacteria 3351
134 Ga0495667_0001314 3300046559 Bacteria 16316
135 Ga0495634_0061372 3300046642 Bacteria 2499
136 Ga0495657_0032418 3300046675 Bacteria 3645
137 Ga0495647_0013328 3300046681 Bacteria 2847
138 Ga0495658_0420343 3300046683 Bacteria 853
139 Ga0495613_0001112 3300046689 Bacteria 20525
140 Ga0495613_0231653 3300046689 Bacteria 1294
141 Ga0495600_0098656 3300046809 Bacteria 1904
142 Ga0495604_0128196 3300047317 Bacteria 1826
143 Ga0495604_0297272 3300047317 Bacteria 1085
144 Ga0495680_0085048 3300047322 Bacteria 2382
145 Ga0495675_0047406 3300047444 Bacteria 2734
146 Ga0495602_0149610 3300048088 Bacteria 1837
147 Ga0495614_0069134 3300048089 Bacteria 1521
148 Ga0496109_0168100 3300048912 Bacteria 2057
149 Ga0496113_0212912 3300048916 Bacteria 1539
150 Ga0501033_0009121 3300049570 Bacteria 7651
151 Ga0501033_0024089 3300049570 Bacteria 4593
152 Ga0501034_0003069 3300049571 Bacteria 19267
153 Ga0501034_0172293 3300049571 Bacteria 2131
154 Ga0501036_0007693 3300049572 Bacteria 8801
155 Ga0501037_0003212 3300049573 Bacteria 11846
156 Ga0501037_0047442 3300049573 Bacteria 3148
157 Ga0501038_0046038 3300049574 Bacteria 3784
158 Ga0501039_0024010 3300049575 Bacteria 4682
159 Ga0501040_0002806 3300049576 Bacteria 11234
160 Ga0501040_0014103 3300049576 Bacteria 5261
161 Ga0501041_0021117 3300049577 Bacteria 3901
162 Ga0501041_0022890 3300049577 Bacteria 3744
163 Ga0501042_0032744 3300049578 Bacteria 3682
164 Ga0501046_0022493 3300049580 Bacteria 5194
165 Ga0501046_0097228 3300049580 Bacteria 2262
166 Ga0501048_0070497 3300049582 Bacteria 2468
167 Ga0501067_0226681 3300049583 Bacteria 1040
168 Ga0501068_0000627 3300049584 Bacteria 18034
169 Ga0501068_0038581 3300049584 Bacteria 2862
170 Ga0501068_0102261 3300049584 Bacteria 1777
171 Ga0501069_0092285 3300049585 Bacteria 1713
172 Ga0501070_0000085 3300049586 Bacteria 79090
173 Ga0501070_0029988 3300049586 Bacteria 4557
174 Ga0501070_0077516 3300049586 Bacteria 2751
175 Ga0501070_0277794 3300049586 Bacteria 1367
176 Ga0501071_0006795 3300049587 Bacteria 7451
177 Ga0501071_0019355 3300049587 Bacteria 4723
178 Ga0501071_0074015 3300049587 Bacteria 2486
179 Ga0501071_0080402 3300049587 Bacteria 2383
180 Ga0501072_0010529 3300049588 Bacteria 7040
181 Ga0501072_0013786 3300049588 Bacteria 6189
182 Ga0501072_0024299 3300049588 Bacteria 4713
183 Ga0501072_0081861 3300049588 Bacteria 2559
184 Ga0501072_0159458 3300049588 Bacteria 1799
185 Ga0501073_0008003 3300049589 Bacteria 7848
186 Ga0501073_0012739 3300049589 Bacteria 6134
187 Ga0501074_0000098 3300049590 Bacteria 42189
188 Ga0501074_0014255 3300049590 Bacteria 5781
189 Ga0501074_0049510 3300049590 Bacteria 3034
190 Ga0501074_0210663 3300049590 Bacteria 1385
191 Ga0501075_0108303 3300049591 Bacteria 2112
192 Ga0501075_0234441 3300049591 Bacteria 1399
193 Ga0501076_0007907 3300049592 Bacteria 7754
194 Ga0501076_0048404 3300049592 Bacteria 3361
195 Ga0501077_0008898 3300049593 Bacteria 6230
196 Ga0501079_0040554 3300049741 Bacteria 3592
197 Ga0501079_0053066 3300049741 Bacteria 3128
198 Ga0501079_0091753 3300049741 Bacteria 2353
199 Ga0501080_0001891 3300049742 Bacteria 18030
200 Ga0501080_0016803 3300049742 Bacteria 6757
201 Ga0501080_0038641 3300049742 Bacteria 4456
202 Ga0501080_0134801 3300049742 Bacteria 2285
203 Ga0501080_0150187 3300049742 Bacteria 2154
204 Ga0501080_0556251 3300049742 Bacteria 1021
205 Ga0501081_0008992 3300049743 Bacteria 6494
206 Ga0501081_0065656 3300049743 Bacteria 2523
207 Ga0501083_0000855 3300049744 Bacteria 20049
208 Ga0501083_0039582 3300049744 Bacteria 3201
209 Ga0501083_0043200 3300049744 Bacteria 3054
210 Ga0501044_0000642 3300049823 Bacteria 42224
211 Ga0501044_0377665 3300049823 Bacteria 1333
212 Ga0501044_0415518 3300049823 Bacteria 1256
213 Ga0501045_0008418 3300049824 Bacteria 7189
214 Ga0501045_0018840 3300049824 Bacteria 4913
215 nmdc:mga03n38_213338_c1 3300050490 Bacteria 1004
216 nmdc:mga00v17_12504_c1 3300050491 Bacteria 4687
217 nmdc:mga00v17_77021_c1 3300050491 Bacteria 2076
218 nmdc:mga0yw44_10565_c1 3300050492 Bacteria 4723
219 nmdc:mga0yw44_107984_c1 3300050492 Bacteria 1780
220 nmdc:mga0yw44_28411_c1 3300050492 Bacteria 3216
221 nmdc:mga0yw44_39539_c1 3300050492 Bacteria 2798
222 nmdc:mga0yw44_40065_c1 3300050492 Bacteria 2781
223 nmdc:mga05p37_128881_c1 3300050507 Bacteria 3106
224 nmdc:mga05p37_51260_c1 3300050507 Bacteria 5076
225 nmdc:mga05p37_5809_c1 3300050507 Bacteria 14506
226 nmdc:mga09592_156909_c1 3300050508 Bacteria 1965
227 nmdc:mga09592_17233_c1 3300050508 Bacteria 5915
228 nmdc:mga09592_54719_c1 3300050508 Bacteria 3371
229 nmdc:mga09592_584621_c1 3300050508 Bacteria 958
230 nmdc:mga0qj67_280146_c1 3300050509 Bacteria 1351
231 nmdc:mga0qj67_31977_c1 3300050509 Bacteria 4102
232 nmdc:mga0qj67_49500_c1 3300050509 Bacteria 3321
233 nmdc:mga0qj67_60246_c1 3300050509 Bacteria 3012
234 nmdc:mga06r32_1558_c1 3300050510 Bacteria 20688
235 nmdc:mga06r32_161498_c1 3300050510 Bacteria 2223
236 nmdc:mga06r32_18138_c1 3300050510 Bacteria 6438
237 nmdc:mga08y16_239570_c1 3300050511 Bacteria 1875
238 nmdc:mga08y16_313205_c1 3300050511 Bacteria 1616
239 nmdc:mga08y16_53833_c1 3300050511 Bacteria 4206
240 nmdc:mga0n895_342026_c1 3300050512 Bacteria 1515
241 Ga0495612_0159650 3300053078 Unclassified 984
242 Ga0495619_0099433 3300053085 Bacteria 1978
243 Ga0500566_0005107 3300053094 Bacteria 7824
244 Ga0500555_080786 3300053103 Bacteria 846
245 Ga0500568_0000031 3300053139 Bacteria 153522
246 Ga0500616_0085814 3300053153 Bacteria 1571
247 Ga0501084_0003943 3300054114 Bacteria 12089
248 Ga0501084_0090773 3300054114 Bacteria 2565
249 Ga0501082_0018650 3300060353 Bacteria 5978
250 Ga0501082_0166737 3300060353 Bacteria 1914
251 Ga0501082_0284492 3300060353 Bacteria 1439
252 Ga0530510_0081047 3300061734 Bacteria 2362
253 Ga0530510_0226501 3300061734 Bacteria 1390
254 Ga0307410_10003171
255 JGI25407J50210_10004362
256 Ga0068868_100113460
257 Ga0070671_100021124
258 Ga0070671_100327747
259 Ga0070711_100560147
260 Ga0070708_100002097
261 Ga0070678_100524079
262 Ga0068867_100088978
263 Ga0068867_100272366
264 Ga0070698_100537242
265 Ga0068855_100618773
266 Ga0068864_100670123
267 Ga0068861_100117674
268 Ga0068858_100002983
269 Ga0068860_100035524
270 Ga0081455_10001828
271 Ga0081455_10009918
272 Ga0081538_10000640
273 Ga0081538_10000662
274 Ga0081538_10056198
275 Ga0081539_10125104
276 Ga0075365_10023601
277 Ga0075365_10029362
278 Ga0075365_10033897
279 Ga0075365_10050367
280 Ga0075365_10095280
281 Ga0075365_10259542
282 Ga0075365_10280707
283 Ga0075365_10301171
284 Ga0075363_100077025
285 Ga0075364_10035397
286 Ga0075364_10042333
287 Ga0075364_10081232
288 Ga0075367_10394397
289 Ga0075428_100010356
290 Ga0075428_100051340
291 Ga0075428_100234237
292 Ga0075428_100802113
293 Ga0075430_100003730
294 Ga0075430_100004823
295 Ga0075430_100060187
296 Ga0075430_100116832
297 Ga0075430_100117405
298 Ga0075430_100191532
299 Ga0075431_100015198
300 Ga0075431_100162854
301 Ga0075431_100184615
302 Ga0075429_100010455
303 Ga0075429_100065343
304 Ga0068865_100682921
305 Ga0111539_10000408
306 Ga0111539_10213421
307 Ga0111539_10220133
308 Ga0111539_10321242
309 Ga0111539_10742678
310 Ga0105245_10000789
311 Ga0105245_10093058
312 Ga0114129_10003082
313 Ga0114129_10018796
314 Ga0114129_10133896
315 Ga0114129_10449556
316 Ga0114129_11236608
317 Ga0105242_10075410
318 Ga0105249_10737219
319 Ga0157375_10686646
320 Ga0157379_10139514
321 Ga0206353_10416746
322 Ga0224572_1010345
323 Ga0207652_10607430
324 Ga0207650_10369573
325 Ga0207687_10002249
326 Ga0207687_10003927
327 Ga0207686_10149015
328 Ga0207703_10449599
329 Ga0207675_100414552
330 Ga0207683_10366032
331 Ga0207428_10267510
332 Ga0207428_10312452
333 Ga0268264_10014665
334 Ga0316579_10042888
335 Ga0316576_10058119
336 Ga0316578_10079580
337 Ga0316578_10261528
338 Ga0307405_10061207
339 Ga0307406_10466726
340 Ga0307407_10032089
341 Ga0307407_10552124
342 Ga0307409_100086285
343 Ga0307416_100067146
344 Ga0307416_100096609
345 Ga0307411_10030666
346 Ga0307411_10123838
347 Ga0307415_100147832
348 Ga0307415_100396060
349 Ga0373930_0012217
350 Ga0373930_0046252
351 Ga0373928_0001244
352 Ga0373951_0037257
353 Ga0373932_0000328
354 Ga0316574_0038014
355 Ga0373931_0000032
356 Ga0373931_0000146
357 Ga0373937_0832489
358 Ga0316584_0159933
359 Ga0400483_006266
360 Ga0400483_134327
361 Ga0400483_157387
362 Ga0400483_183765
363 Ga0400483_270663
364 Ga0436365_1279579
365 Ga0436361_1099874
366 Ga0436362_0003653
367 Ga0451843_0806122
368 Ga0439448_0044145
369 Ga0439451_016374
370 Ga0439452_028094
371 Ga0439456_049457
372 Ga0439463_048729
373 Ga0439434_0022638
374 Ga0439460_0033210
375 Ga0466965_0067657
376 Ga0466966_0021346
377 Ga0466966_0046618
378 Ga0466959_0221912
379 Ga0466967_0624161
380 Ga0495629_0158985
381 Ga0495651_0221411
382 Ga0495582_0432992
383 Ga0495664_0342550
384 Ga0495608_0035392
385 Ga0495608_0147933
386 Ga0495586_0022662
387 Ga0495667_0001314
388 Ga0495634_0061372
389 Ga0495657_0032418
390 Ga0495647_0013328
391 Ga0495658_0420343
392 Ga0495613_0001112
393 Ga0495613_0231653
394 Ga0495600_0098656
395 Ga0495604_0128196
396 Ga0495604_0297272
397 Ga0495680_0085048
398 Ga0495675_0047406
399 Ga0495602_0149610
400 Ga0495614_0069134
401 Ga0496109_0168100
402 Ga0496113_0212912
403 Ga0501033_0009121
404 Ga0501033_0024089
405 Ga0501034_0003069
406 Ga0501034_0172293
407 Ga0501036_0007693
408 Ga0501037_0003212
409 Ga0501037_0047442
410 Ga0501038_0046038
411 Ga0501039_0024010
412 Ga0501040_0002806
413 Ga0501040_0014103
414 Ga0501041_0021117
415 Ga0501041_0022890
416 Ga0501042_0032744
417 Ga0501046_0022493
418 Ga0501046_0097228
419 Ga0501048_0070497
420 Ga0501067_0226681
421 Ga0501068_0000627
422 Ga0501068_0038581
423 Ga0501068_0102261
424 Ga0501069_0092285
425 Ga0501070_0000085
426 Ga0501070_0029988
427 Ga0501070_0077516
428 Ga0501070_0277794
429 Ga0501071_0006795
430 Ga0501071_0019355
431 Ga0501071_0074015
432 Ga0501071_0080402
433 Ga0501072_0010529
434 Ga0501072_0013786
435 Ga0501072_0024299
436 Ga0501072_0081861
437 Ga0501072_0159458
438 Ga0501073_0008003
439 Ga0501073_0012739
440 Ga0501074_0000098
441 Ga0501074_0014255
442 Ga0501074_0049510
443 Ga0501074_0210663
444 Ga0501075_0108303
445 Ga0501075_0234441
446 Ga0501076_0007907
447 Ga0501076_0048404
448 Ga0501077_0008898
449 Ga0501079_0040554
450 Ga0501079_0053066
451 Ga0501079_0091753
452 Ga0501080_0001891
453 Ga0501080_0016803
454 Ga0501080_0038641
455 Ga0501080_0134801
456 Ga0501080_0150187
457 Ga0501080_0556251
458 Ga0501081_0008992
459 Ga0501081_0065656
460 Ga0501083_0000855
461 Ga0501083_0039582
462 Ga0501083_0043200
463 Ga0501044_0000642
464 Ga0501044_0377665
465 Ga0501044_0415518
466 Ga0501045_0008418
467 Ga0501045_0018840
468 nmdc:mga03n38_213338_c1
469 nmdc:mga00v17_12504_c1
470 nmdc:mga00v17_77021_c1
471 nmdc:mga0yw44_10565_c1
472 nmdc:mga0yw44_107984_c1
473 nmdc:mga0yw44_28411_c1
474 nmdc:mga0yw44_39539_c1
475 nmdc:mga0yw44_40065_c1
476 nmdc:mga05p37_128881_c1
477 nmdc:mga05p37_51260_c1
478 nmdc:mga05p37_5809_c1
479 nmdc:mga09592_156909_c1
480 nmdc:mga09592_17233_c1
481 nmdc:mga09592_54719_c1
482 nmdc:mga09592_584621_c1
483 nmdc:mga0qj67_280146_c1
484 nmdc:mga0qj67_31977_c1
485 nmdc:mga0qj67_49500_c1
486 nmdc:mga0qj67_60246_c1
487 nmdc:mga06r32_1558_c1
488 nmdc:mga06r32_161498_c1
489 nmdc:mga06r32_18138_c1
490 nmdc:mga08y16_239570_c1
491 nmdc:mga08y16_313205_c1
492 nmdc:mga08y16_53833_c1
493 nmdc:mga0n895_342026_c1
494 Ga0495612_0159650
495 Ga0495619_0099433
496 Ga0500566_0005107
497 Ga0500555_080786
498 Ga0500568_0000031
499 Ga0500616_0085814
500 Ga0501084_0003943
501 Ga0501084_0090773
502 Ga0501082_0018650
503 Ga0501082_0166737
504 Ga0501082_0284492
505 Ga0530510_0081047
506 Ga0530510_0226501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

105

168

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.8241 9 257
4ed4-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to atp 0.7996 9 257
4emd-assembly1.cif.gz_A crystal structure of ispe (4-diphosphocytidyl-2-c-methyl-d-erythritol kinase) from mycobacterium abcessus, bound to cmp and so4 0.7972 9 257
3pyf-assembly1.cif.gz_A mycobacterium tuberculosis 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (ispe) in complex with amp-pnp 0.7834 12 256
2v2q-assembly1.cif.gz_A ispe in complex with ligand 0.7799 10 252
ID Description Score Start End Superfamily
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8101 10 163 3.30.230.10
4dxlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8029 9 163 3.30.230.10
2v2qB01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7951 10 163 3.30.230.10
af_Q8S2G0_72_245_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7771 9 163 3.30.230.10
af_Q2G0S8_1_157_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7683 12 162 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A7W0RFB6-F1-model_v4 Uncharacterized protein 0.9831 165 253
AF-A0A3D5GJU8-F1-model_v4 Uncharacterized protein 0.9814 143 254
AF-A0A7V9NUV9-F1-model_v4 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (EC 2.7.1.148) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase) 0.9796 10 251 GO:0005524
GO:0016114
GO:0019288
GO:0050515
AF-A0A2E3ZED6-F1-model_v4 deleted 0.9769 124 253
AF-A0A0C1R5A8-F1-model_v4 GHMP kinase C-terminal domain-containing protein 0.9768 145 255 GO:0050515

Map