F363976

General Info

Members Datasets Scaffolds Average Seq Length
253 194 253 275

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100253214|Ga0075434_1002532142
Length 317
Sequence MPNLRRAEETFLGEEAESPGIAGGEELLEGEGEELELFADERPEPIEPPRRRRGGETARRVLVAIPWIIFAIVITVAGGLPFAIAIAGLGLIGLREYFVMTAQHRPIQIAAYLAVPGMILAAHFGTAFNVLLVASASFLLLFAFGADRNHRDGITVSMGVTLLGVVWIGIPLVHAVLLRDLPHHGAALLIDVLVGTFVTDTAAYATGRMFGQHRFAPQLSPNKTIEGLVGGFVIGTMGFWFAGLYQDWLSGVDALIIGAAVAALAPVGDLFESMLKRDLGRKDTGTLFGPHGGLLDRLDAALFTIVVGYYLAVQLVY

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
105 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
130 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
177 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
193 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
194 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 11.07
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009389 3300001979 Bacteria 3832
2 JGI25404J52841_10000671 3300003659 Bacteria 5227
3 Ga0070658_10118218 3300005327 Bacteria 2201
4 Ga0070683_100002624 3300005329 Bacteria 14372
5 Ga0070683_100071942 3300005329 Bacteria 3227
6 Ga0070677_10000091 3300005333 Bacteria 29146
7 Ga0070666_10034430 3300005335 Bacteria 3357
8 Ga0070682_100000398 3300005337 Bacteria 29064
9 Ga0068868_100003008 3300005338 Bacteria 11721
10 Ga0068868_100004891 3300005338 Bacteria 9406
11 Ga0070660_100207538 3300005339 Unclassified 1590
12 Ga0070691_10000021 3300005341 Bacteria 45268
13 Ga0070661_100000616 3300005344 Bacteria 26479
14 Ga0070668_100101166 3300005347 Bacteria 2284
15 Ga0070674_100000235 3300005356 Bacteria 27333
16 Ga0070673_100013619 3300005364 Bacteria 5633
17 Ga0070688_100000027 3300005365 Bacteria 67477
18 Ga0070688_100000373 3300005365 Bacteria 22710
19 Ga0070667_100001804 3300005367 Bacteria 19049
20 Ga0070667_100263270 3300005367 Bacteria 1544
21 Ga0070714_100075899 3300005435 Bacteria 2917
22 Ga0070713_100000010 3300005436 Bacteria 151790
23 Ga0070711_100004194 3300005439 Bacteria 8471
24 Ga0070694_100111958 3300005444 Bacteria 1946
25 Ga0070662_100000061 3300005457 Bacteria 58911
26 Ga0070681_10090912 3300005458 Bacteria 3003
27 Ga0068867_100000226 3300005459 Bacteria 36850
28 Ga0070685_10000118 3300005466 Bacteria 50597
29 Ga0070685_10003919 3300005466 Bacteria 7520
30 Ga0070679_100001474 3300005530 Bacteria 20867
31 Ga0070684_100058026 3300005535 Bacteria 3381
32 Ga0070684_100087930 3300005535 Bacteria 2760
33 Ga0070693_100008442 3300005547 Bacteria 5079
34 Ga0070665_100020049 3300005548 Bacteria 6713
35 Ga0070665_100024849 3300005548 Bacteria 6036
36 Ga0068855_100056955 3300005563 Bacteria 4583
37 Ga0068857_100019320 3300005577 Bacteria 5982
38 Ga0068854_100000116 3300005578 Bacteria 54986
39 Ga0068854_100030204 3300005578 Bacteria 3758
40 Ga0068856_100323687 3300005614 Bacteria 1559
41 Ga0068852_100000056 3300005616 Bacteria 76111
42 Ga0068866_10000008 3300005718 Bacteria 117658
43 Ga0068861_100104384 3300005719 Bacteria 2261
44 Ga0068863_100065700 3300005841 Bacteria 3432
45 Ga0068862_100001600 3300005844 Bacteria 20633
46 Ga0081455_10086730 3300005937 Bacteria 2549
47 Ga0081540_1000041 3300005983 Bacteria 136874
48 Ga0075365_10316843 3300006038 Bacteria 1098
49 Ga0070715_10000021 3300006163 Bacteria 119283
50 Ga0070712_100004878 3300006175 Bacteria 8296
51 Ga0068871_100074592 3300006358 Bacteria 2799
52 Ga0075430_100044684 3300006846 Bacteria 3744
53 Ga0075434_100253214 3300006871 Bacteria 1780
54 Ga0075436_100324052 3300006914 Bacteria 1107
55 Ga0075435_100166949 3300007076 Bacteria 1856
56 Ga0105245_10006545 3300009098 Bacteria 10227
57 Ga0105247_10350021 3300009101 Bacteria 1039
58 Ga0105243_10006419 3300009148 Bacteria 9088
59 Ga0105248_10000020 3300009177 Bacteria 284637
60 Ga0105238_10000055 3300009551 Bacteria 139232
61 Ga0105249_10000332 3300009553 Bacteria 47770
62 Ga0157369_10000074 3300013105 Bacteria 136668
63 Ga0157374_10023926 3300013296 Bacteria 5470
64 Ga0157374_10134876 3300013296 Bacteria 2392
65 Ga0157378_10145567 3300013297 Bacteria 2203
66 Ga0157372_10006125 3300013307 Bacteria 12781
67 Ga0157375_10054962 3300013308 Bacteria 3923
68 Ga0157380_10000391 3300014326 Bacteria 26465
69 Ga0157380_10003677 3300014326 Bacteria 10550
70 Ga0157376_10080966 3300014969 Bacteria 2787
71 Ga0206353_10485474 3300020082 Bacteria 2537
72 Ga0207682_10000022 3300025893 Bacteria 62630
73 Ga0207642_10000002 3300025899 Bacteria 658166
74 Ga0207642_10061910 3300025899 Bacteria 1742
75 Ga0207710_10001168 3300025900 Bacteria 13367
76 Ga0207680_10025822 3300025903 Bacteria 3246
77 Ga0207685_10000028 3300025905 Bacteria 97935
78 Ga0207705_10064896 3300025909 Bacteria 2639
79 Ga0207654_10090219 3300025911 Bacteria 1866
80 Ga0207707_10001875 3300025912 Bacteria 19216
81 Ga0207693_10016150 3300025915 Bacteria 5972
82 Ga0207663_10155492 3300025916 Bacteria 1608
83 Ga0207649_10000189 3300025920 Bacteria 50504
84 Ga0207652_10036544 3300025921 Bacteria 4152
85 Ga0207694_10000063 3300025924 Bacteria 139700
86 Ga0207659_10000553 3300025926 Bacteria 22395
87 Ga0207687_10000073 3300025927 Bacteria 73917
88 Ga0207700_10000007 3300025928 Bacteria 345720
89 Ga0207706_10000250 3300025933 Bacteria 58868
90 Ga0207686_10000073 3300025934 Bacteria 92009
91 Ga0207686_10106975 3300025934 Bacteria 1879
92 Ga0207709_10236944 3300025935 Bacteria 1325
93 Ga0207669_10000182 3300025937 Bacteria 29102
94 Ga0207691_10000529 3300025940 Bacteria 38127
95 Ga0207711_10000006 3300025941 Bacteria 792692
96 Ga0207661_10000278 3300025944 Bacteria 32703
97 Ga0207661_10000312 3300025944 Bacteria 30978
98 Ga0207651_10006244 3300025960 Bacteria 6211
99 Ga0207712_10000058 3300025961 Bacteria 140948
100 Ga0207668_10031218 3300025972 Bacteria 3507
101 Ga0207640_10000134 3300025981 Bacteria 54961
102 Ga0207640_10032707 3300025981 Bacteria 3227
103 Ga0207677_10000263 3300026023 Bacteria 39869
104 Ga0207677_10000374 3300026023 Bacteria 31092
105 Ga0207639_10083399 3300026041 Bacteria 2537
106 Ga0207708_10094449 3300026075 Bacteria 2308
107 Ga0207641_10016945 3300026088 Bacteria 5965
108 Ga0207648_10000907 3300026089 Bacteria 33370
109 Ga0207675_100201565 3300026118 Bacteria 1911
110 Ga0207698_10000101 3300026142 Bacteria 54530
111 Ga0268266_10007058 3300028379 Bacteria 10199
112 Ga0265337_1000240 3300028556 Bacteria 29757
113 Ga0265326_10000393 3300028558 Bacteria 17549
114 Ga0265319_1000105 3300028563 Bacteria 65502
115 Ga0265322_10000029 3300028654 Bacteria 82867
116 Ga0265336_10004292 3300028666 Bacteria 5420
117 Ga0265338_10000507 3300028800 Bacteria 69026
118 Ga0265324_10001546 3300029957 Bacteria 12903
119 Ga0265324_10045977 3300029957 Bacteria 1503
120 Ga0265330_10074680 3300031235 Bacteria 1465
121 Ga0265328_10000802 3300031239 Bacteria 14539
122 Ga0265320_10000011 3300031240 Bacteria 249534
123 Ga0265325_10004756 3300031241 Bacteria 8512
124 Ga0265339_10146559 3300031249 Bacteria 1197
125 Ga0265331_10000839 3300031250 Bacteria 25044
126 Ga0265331_10010709 3300031250 Bacteria 5057
127 Ga0265327_10000015 3300031251 Bacteria 496677
128 Ga0307513_10436096 3300031456 Bacteria 1037
129 Ga0265314_10000361 3300031711 Bacteria 63269
130 Ga0265342_10210826 3300031712 Bacteria 1051
131 Ga0307407_10501978 3300031903 Bacteria 889
132 Ga0316584_0002636 3300036712 Bacteria 11443
133 Ga0451800_0843574 3300041459 Bacteria 1345
134 Ga0466957_0107876 3300044842 Bacteria 1763
135 Ga0466958_0043630 3300045836 Bacteria 2701
136 Ga0466967_0259273 3300045976 Bacteria 1663
137 Ga0495603_0198449 3300046455 Unclassified 1159
138 Ga0495590_0059591 3300046457 Bacteria 1336
139 Ga0495629_0001073 3300046459 Bacteria 21818
140 Ga0495629_0009253 3300046459 Bacteria 7207
141 Ga0495638_0013333 3300046460 Bacteria 5601
142 Ga0495641_0026462 3300046461 Bacteria 2830
143 Ga0495641_0051589 3300046461 Bacteria 1877
144 Ga0495662_0000304 3300046476 Bacteria 21364
145 Ga0495594_0000011 3300046499 Bacteria 118444
146 Ga0495606_0000586 3300046507 Bacteria 57795
147 Ga0495608_0000007 3300046511 Bacteria 313495
148 Ga0495608_0006623 3300046511 Bacteria 8221
149 Ga0495608_0100721 3300046511 Bacteria 1863
150 Ga0495620_0000211 3300046515 Bacteria 43874
151 Ga0495628_0001027 3300046516 Bacteria 25537
152 Ga0495628_0005762 3300046516 Bacteria 10854
153 Ga0495628_0054830 3300046516 Bacteria 3141
154 Ga0495630_0000075 3300046517 Bacteria 77378
155 Ga0495630_0000454 3300046517 Bacteria 31035
156 Ga0495630_0020574 3300046517 Bacteria 4866
157 Ga0495630_0062523 3300046517 Bacteria 2797
158 Ga0495644_0000176 3300046523 Bacteria 30116
159 Ga0495644_0075165 3300046523 Bacteria 1272
160 Ga0495652_0000037 3300046529 Bacteria 133232
161 Ga0495652_0034269 3300046529 Bacteria 4426
162 Ga0495640_0017150 3300046533 Bacteria 5404
163 Ga0495587_0046584 3300046536 Bacteria 2573
164 Ga0495645_0000984 3300046543 Bacteria 19435
165 Ga0495645_0033410 3300046543 Bacteria 3753
166 Ga0495622_0000387 3300046557 Bacteria 30369
167 Ga0495667_0000020 3300046559 Bacteria 180876
168 Ga0495634_0002062 3300046642 Bacteria 16995
169 Ga0495625_0001050 3300046660 Bacteria 36223
170 Ga0495588_0000187 3300046674 Bacteria 67620
171 Ga0495657_0000001 3300046675 Bacteria 445641
172 Ga0495657_0024139 3300046675 Bacteria 4334
173 Ga0495647_0003855 3300046681 Bacteria 4830
174 Ga0495669_0000143 3300046684 Bacteria 45428
175 Ga0495624_0000027 3300046690 Bacteria 93611
176 Ga0495670_0003783 3300046691 Bacteria 7436
177 Ga0495604_0000050 3300047317 Bacteria 108094
178 Ga0495604_0048237 3300047317 Bacteria 3313
179 Ga0495674_0000030 3300047319 Bacteria 115975
180 Ga0495676_0012335 3300047321 Bacteria 7698
181 Ga0495676_0078382 3300047321 Bacteria 2516
182 Ga0495680_0004041 3300047322 Bacteria 14142
183 Ga0495675_0000453 3300047444 Bacteria 27185
184 Ga0495686_0111825 3300047472 Bacteria 1637
185 Ga0495593_0037035 3300047673 Bacteria 2642
186 Ga0495602_0000571 3300048088 Bacteria 34252
187 Ga0495602_0156883 3300048088 Bacteria 1781
188 Ga0496100_0000001 3300048903 Bacteria 530179
189 Ga0496100_0000013 3300048903 Bacteria 177476
190 Ga0496101_0000004 3300048904 Bacteria 331599
191 Ga0496101_0000035 3300048904 Bacteria 177237
192 Ga0496102_0000522 3300048905 Bacteria 41862
193 Ga0496102_0054230 3300048905 Bacteria 3655
194 Ga0496103_0000174 3300048906 Bacteria 67124
195 Ga0496103_0050582 3300048906 Bacteria 2570
196 Ga0496103_0149642 3300048906 Bacteria 1495
197 Ga0496104_0001240 3300048907 Bacteria 21960
198 Ga0496105_0006317 3300048908 Bacteria 9103
199 Ga0496106_0000062 3300048909 Bacteria 85769
200 Ga0496106_0000414 3300048909 Bacteria 30298
201 Ga0496107_0000005 3300048910 Bacteria 281747
202 Ga0496107_0000020 3300048910 Bacteria 148990
203 Ga0496108_0017030 3300048911 Bacteria 5941
204 Ga0496109_0001088 3300048912 Bacteria 22576
205 Ga0496109_0654950 3300048912 Bacteria 987
206 Ga0496110_0000242 3300048913 Bacteria 35454
207 Ga0496110_0072907 3300048913 Bacteria 3047
208 Ga0496110_0135373 3300048913 Bacteria 2226
209 Ga0496111_0000316 3300048914 Bacteria 23885
210 Ga0496112_0000025 3300048915 Bacteria 146197
211 Ga0496114_0000039 3300048917 Bacteria 138486
212 Ga0496114_0231826 3300048917 Bacteria 1622
213 Ga0496115_0000011 3300048918 Bacteria 222529
214 Ga0496115_0031258 3300048918 Bacteria 4194
215 Ga0496116_0000176 3300048919 Bacteria 128426
216 Ga0496117_0002967 3300048920 Bacteria 20476
217 Ga0496118_0007078 3300048921 Bacteria 12050
218 Ga0496119_0001444 3300048922 Bacteria 28583
219 Ga0496119_0022693 3300048922 Bacteria 4482
220 Ga0496119_0123286 3300048922 Bacteria 1421
221 Ga0496120_0006050 3300048923 Bacteria 9402
222 Ga0496121_0061005 3300048924 Bacteria 3097
223 Ga0496125_0030415 3300048928 Bacteria 4832
224 Ga0496126_0003514 3300048929 Bacteria 19727
225 Ga0501042_0121902 3300049578 Bacteria 1877
226 Ga0501047_0057719 3300049581 Bacteria 3753
227 Ga0501075_0001206 3300049591 Bacteria 16739
228 Ga0501076_0098262 3300049592 Bacteria 2358
229 Ga0501083_0005694 3300049744 Bacteria 8818
230 Ga0501044_0301983 3300049823 Bacteria 1529
231 nmdc:mga00v17_37737_c1 3300050491 Bacteria 2886
232 nmdc:mga0qj67_8158_c1 3300050509 Bacteria 7758
233 nmdc:mga06r32_189999_c1 3300050510 Bacteria 2041
234 Ga0495601_0000254 3300053077 Bacteria 28596
235 Ga0495601_0005631 3300053077 Bacteria 7303
236 Ga0495601_0007882 3300053077 Bacteria 6273
237 Ga0495601_0185336 3300053077 Bacteria 1360
238 Ga0495601_0216747 3300053077 Bacteria 1250
239 Ga0495612_0003936 3300053078 Bacteria 6164
240 Ga0495612_0031859 3300053078 Bacteria 2128
241 Ga0495612_0050293 3300053078 Bacteria 1711
242 Ga0495655_0000002 3300053083 Bacteria 312752
243 Ga0495655_0000539 3300053083 Bacteria 6211
244 Ga0495595_0000002 3300053084 Bacteria 445641
245 Ga0495619_0000047 3300053085 Bacteria 102152
246 Ga0495619_0000276 3300053085 Bacteria 36931
247 Ga0495619_0000485 3300053085 Bacteria 26622
248 Ga0495619_0000680 3300053085 Bacteria 22263
249 Ga0495619_0143641 3300053085 Bacteria 1644
250 Ga0495619_0267645 3300053085 Bacteria 1184
251 Ga0500566_0000798 3300053094 Bacteria 17895
252 Ga0500641_0003882 3300053096 Bacteria 5283
253 Ga0500628_000001 3300053129 Bacteria 564074

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047673 Ga0495593_0037035 Ga0495593_0037035_1226_2143 226
2 3300005719 Ga0068861_100104384 Ga0068861_1001043841 234
3 3300026118 Ga0207675_100201565 Ga0207675_1002015651 234
4 3300006358 Ga0068871_100074592 Ga0068871_1000745922 235
5 3300025900 Ga0207710_10001168 Ga0207710_100011686 236
6 3300048929 Ga0496126_0003514 Ga0496126_0003514_14551_15513 237
7 3300006038 Ga0075365_10316843 Ga0075365_103168431 239
8 3300009101 Ga0105247_10350021 Ga0105247_103500212 239
9 3300036712 Ga0316584_0002636 Ga0316584_0002636_5183_5977 239
10 3300050491 nmdc:mga00v17_37737_c1 nmdc:mga00v17_37737_c1_1875_2669 239
11 3300005578 Ga0068854_100000116 Ga0068854_10000011637 240
12 3300025981 Ga0207640_10000134 Ga0207640_1000013438 240
13 3300031903 Ga0307407_10501978 Ga0307407_105019781 240
14 3300047321 Ga0495676_0078382 Ga0495676_0078382_736_1584 240
15 3300046511 Ga0495608_0000007 Ga0495608_0000007_23303_24184 241
16 3300046675 Ga0495657_0000001 Ga0495657_0000001_155449_156330 241
17 3300047444 Ga0495675_0000453 Ga0495675_0000453_12108_12989 241
18 3300053084 Ga0495595_0000002 Ga0495595_0000002_289312_290193 241
19 3300053085 Ga0495619_0000276 Ga0495619_0000276_14181_15062 241
20 3300005329 Ga0070683_100071942 Ga0070683_1000719424 242
21 3300005535 Ga0070684_100058026 Ga0070684_1000580264 242
22 3300025911 Ga0207654_10090219 Ga0207654_100902191 242
23 3300025944 Ga0207661_10000278 Ga0207661_1000027828 242
24 3300048908 Ga0496105_0006317 Ga0496105_0006317_6144_7061 242
25 3300005344 Ga0070661_100000616 Ga0070661_1000006166 243
26 3300020082 Ga0206353_10485474 Ga0206353_104854743 243
27 3300025920 Ga0207649_10000189 Ga0207649_1000018926 243
28 3300047317 Ga0495604_0000050 Ga0495604_0000050_84399_85286 243
29 3300005436 Ga0070713_100000010 Ga0070713_100000010124 244
30 3300025928 Ga0207700_10000007 Ga0207700_10000007325 244
31 3300005337 Ga0070682_100000398 Ga0070682_10000039828 245
32 3300053078 Ga0495612_0031859 Ga0495612_0031859_870_1751 245
33 3300053085 Ga0495619_0000485 Ga0495619_0000485_3606_4496 245
34 3300005338 Ga0068868_100003008 Ga0068868_1000030089 246
35 3300005347 Ga0070668_100101166 Ga0070668_1001011662 246
36 3300005535 Ga0070684_100087930 Ga0070684_1000879304 246
37 3300009148 Ga0105243_10006419 Ga0105243_100064196 246
38 3300014326 Ga0157380_10000391 Ga0157380_1000039118 246
39 3300025935 Ga0207709_10236944 Ga0207709_102369442 246
40 3300025972 Ga0207668_10031218 Ga0207668_100312182 246
41 3300026023 Ga0207677_10000374 Ga0207677_1000037415 246
42 3300048088 Ga0495602_0156883 Ga0495602_0156883_123_1007 246
43 3300048915 Ga0496112_0000025 Ga0496112_0000025_23945_24826 246
44 3300053085 Ga0495619_0143641 Ga0495619_0143641_55_939 246
45 3300005937 Ga0081455_10086730 Ga0081455_100867302 247
46 3300006163 Ga0070715_10000021 Ga0070715_1000002197 247
47 3300013297 Ga0157378_10145567 Ga0157378_101455672 247
48 3300013307 Ga0157372_10006125 Ga0157372_100061254 247
49 3300025905 Ga0207685_10000028 Ga0207685_1000002828 247
50 3300026041 Ga0207639_10083399 Ga0207639_100833992 247
51 3300046476 Ga0495662_0000304 Ga0495662_0000304_16473_17357 247
52 3300046533 Ga0495640_0017150 Ga0495640_0017150_1560_2444 247
53 3300047319 Ga0495674_0000030 Ga0495674_0000030_107138_108022 247
54 3300048911 Ga0496108_0017030 Ga0496108_0017030_3528_4424 247
55 3300048912 Ga0496109_0001088 Ga0496109_0001088_10339_11235 247
56 3300005365 Ga0070688_100000027 Ga0070688_10000002752 248
57 3300005459 Ga0068867_100000226 Ga0068867_10000022623 248
58 3300005466 Ga0070685_10003919 Ga0070685_100039195 248
59 3300026089 Ga0207648_10000907 Ga0207648_1000090721 248
60 3300046507 Ga0495606_0000586 Ga0495606_0000586_17927_18814 248
61 3300046660 Ga0495625_0001050 Ga0495625_0001050_15042_15932 248
62 3300053085 Ga0495619_0000680 Ga0495619_0000680_20117_21007 248
63 3300005367 Ga0070667_100001804 Ga0070667_10000180415 249
64 3300005548 Ga0070665_100020049 Ga0070665_1000200494 249
65 3300005844 Ga0068862_100001600 Ga0068862_10000160017 249
66 3300013308 Ga0157375_10054962 Ga0157375_100549625 249
67 3300041459 Ga0451800_0843574 Ga0451800_0843574_165_1052 249
68 3300046523 Ga0495644_0000176 Ga0495644_0000176_9941_10831 249
69 3300048924 Ga0496121_0061005 Ga0496121_0061005_673_1650 249
70 3300005365 Ga0070688_100000373 Ga0070688_1000003738 250
71 3300005435 Ga0070714_100075899 Ga0070714_1000758993 250
72 3300005466 Ga0070685_10000118 Ga0070685_1000011852 250
73 3300014969 Ga0157376_10080966 Ga0157376_100809662 250
74 3300046511 Ga0495608_0100721 Ga0495608_0100721_473_1357 250
75 3300048905 Ga0496102_0054230 Ga0496102_0054230_1687_2646 250
76 3300048906 Ga0496103_0050582 Ga0496103_0050582_450_1409 250
77 3300048907 Ga0496104_0001240 Ga0496104_0001240_738_1619 250
78 3300048912 Ga0496109_0654950 Ga0496109_0654950_78_959 250
79 3300048920 Ga0496117_0002967 Ga0496117_0002967_6074_7033 250
80 3300048921 Ga0496118_0007078 Ga0496118_0007078_10922_11881 250
81 3300048928 Ga0496125_0030415 Ga0496125_0030415_2854_3825 250
82 3300049592 Ga0501076_0098262 Ga0501076_0098262_109_984 250
83 3300053077 Ga0495601_0007882 Ga0495601_0007882_3265_4146 250
84 3300053077 Ga0495601_0185336 Ga0495601_0185336_395_1276 250
85 3300005439 Ga0070711_100004194 Ga0070711_1000041943 251
86 3300006846 Ga0075430_100044684 Ga0075430_1000446844 251
87 3300009551 Ga0105238_10000055 Ga0105238_10000055115 251
88 3300025924 Ga0207694_10000063 Ga0207694_1000006327 251
89 3300028556 Ga0265337_1000240 Ga0265337_100024022 251
90 3300028558 Ga0265326_10000393 Ga0265326_1000039317 251
91 3300028654 Ga0265322_10000029 Ga0265322_1000002969 251
92 3300028666 Ga0265336_10004292 Ga0265336_100042924 251
93 3300029957 Ga0265324_10001546 Ga0265324_1000154614 251
94 3300031235 Ga0265330_10074680 Ga0265330_100746802 251
95 3300031239 Ga0265328_10000802 Ga0265328_100008029 251
96 3300031240 Ga0265320_10000011 Ga0265320_10000011245 251
97 3300031249 Ga0265339_10146559 Ga0265339_101465591 251
98 3300031250 Ga0265331_10000839 Ga0265331_100008397 251
99 3300031251 Ga0265327_10000015 Ga0265327_10000015353 251
100 3300031711 Ga0265314_10000361 Ga0265314_1000036154 251
101 3300046455 Ga0495603_0198449 Ga0495603_0198449_129_1007 251
102 3300046517 Ga0495630_0000454 Ga0495630_0000454_9620_10510 251
103 3300046559 Ga0495667_0000020 Ga0495667_0000020_159836_160717 251
104 3300046675 Ga0495657_0024139 Ga0495657_0024139_1626_2516 251
105 3300046691 Ga0495670_0003783 Ga0495670_0003783_3580_4470 251
106 3300047322 Ga0495680_0004041 Ga0495680_0004041_11086_11967 251
107 3300048918 Ga0496115_0031258 Ga0496115_0031258_3199_4080 251
108 3300049581 Ga0501047_0057719 Ga0501047_0057719_2630_3628 251
109 3300049744 Ga0501083_0005694 Ga0501083_0005694_6876_7874 251
110 3300049823 Ga0501044_0301983 Ga0501044_0301983_118_1116 251
111 3300050509 nmdc:mga0qj67_8158_c1 nmdc:mga0qj67_8158_c1_1405_2295 251
112 3300053077 Ga0495601_0005631 Ga0495601_0005631_5252_6142 251
113 3300053085 Ga0495619_0000047 Ga0495619_0000047_22279_23184 251
114 3300053085 Ga0495619_0267645 Ga0495619_0267645_226_1116 251
115 3300005329 Ga0070683_100002624 Ga0070683_1000026243 252
116 3300005356 Ga0070674_100000235 Ga0070674_10000023527 252
117 3300005457 Ga0070662_100000061 Ga0070662_10000006159 252
118 3300005458 Ga0070681_10090912 Ga0070681_100909122 252
119 3300005530 Ga0070679_100001474 Ga0070679_1000014748 252
120 3300005578 Ga0068854_100030204 Ga0068854_1000302043 252
121 3300005614 Ga0068856_100323687 Ga0068856_1003236872 252
122 3300005718 Ga0068866_10000008 Ga0068866_1000000827 252
123 3300006175 Ga0070712_100004878 Ga0070712_1000048784 252
124 3300006914 Ga0075436_100324052 Ga0075436_1003240522 252
125 3300007076 Ga0075435_100166949 Ga0075435_1001669492 252
126 3300025899 Ga0207642_10000002 Ga0207642_10000002642 252
127 3300025912 Ga0207707_10001875 Ga0207707_1000187515 252
128 3300025915 Ga0207693_10016150 Ga0207693_100161506 252
129 3300025921 Ga0207652_10036544 Ga0207652_100365444 252
130 3300025933 Ga0207706_10000250 Ga0207706_100002506 252
131 3300025937 Ga0207669_10000182 Ga0207669_1000018227 252
132 3300025944 Ga0207661_10000312 Ga0207661_1000031218 252
133 3300025981 Ga0207640_10032707 Ga0207640_100327072 252
134 3300046460 Ga0495638_0013333 Ga0495638_0013333_3662_4552 252
135 3300046516 Ga0495628_0054830 Ga0495628_0054830_638_1528 252
136 3300046523 Ga0495644_0075165 Ga0495644_0075165_217_1101 252
137 3300046529 Ga0495652_0000037 Ga0495652_0000037_106926_107816 252
138 3300046529 Ga0495652_0034269 Ga0495652_0034269_2970_3860 252
139 3300046543 Ga0495645_0033410 Ga0495645_0033410_835_1725 252
140 3300048906 Ga0496103_0149642 Ga0496103_0149642_162_1166 252
141 3300048913 Ga0496110_0000242 Ga0496110_0000242_13139_14044 252
142 3300048914 Ga0496111_0000316 Ga0496111_0000316_12874_13779 252
143 3300048919 Ga0496116_0000176 Ga0496116_0000176_70651_71649 252
144 3300048922 Ga0496119_0001444 Ga0496119_0001444_16193_17191 252
145 3300048922 Ga0496119_0123286 Ga0496119_0123286_297_1265 252
146 3300048923 Ga0496120_0006050 Ga0496120_0006050_389_1357 252
147 3300005333 Ga0070677_10000091 Ga0070677_1000009117 253
148 3300005338 Ga0068868_100004891 Ga0068868_1000048916 253
149 3300005367 Ga0070667_100263270 Ga0070667_1002632702 253
150 3300005444 Ga0070694_100111958 Ga0070694_1001119583 253
151 3300005547 Ga0070693_100008442 Ga0070693_1000084425 253
152 3300005841 Ga0068863_100065700 Ga0068863_1000657003 253
153 3300009553 Ga0105249_10000332 Ga0105249_1000033228 253
154 3300013296 Ga0157374_10023926 Ga0157374_100239262 253
155 3300025893 Ga0207682_10000022 Ga0207682_1000002229 253
156 3300025934 Ga0207686_10106975 Ga0207686_101069752 253
157 3300025940 Ga0207691_10000529 Ga0207691_1000052936 253
158 3300025961 Ga0207712_10000058 Ga0207712_1000005828 253
159 3300026023 Ga0207677_10000263 Ga0207677_1000026342 253
160 3300026088 Ga0207641_10016945 Ga0207641_100169453 253
161 3300045976 Ga0466967_0259273 Ga0466967_0259273_233_1135 253
162 3300046457 Ga0495590_0059591 Ga0495590_0059591_61_1119 253
163 3300046499 Ga0495594_0000011 Ga0495594_0000011_95652_96536 253
164 3300046516 Ga0495628_0005762 Ga0495628_0005762_7119_8009 253
165 3300046543 Ga0495645_0000984 Ga0495645_0000984_13681_14559 253
166 3300046557 Ga0495622_0000387 Ga0495622_0000387_3985_4869 253
167 3300046642 Ga0495634_0002062 Ga0495634_0002062_12124_13008 253
168 3300046684 Ga0495669_0000143 Ga0495669_0000143_22648_23538 253
169 3300048903 Ga0496100_0000013 Ga0496100_0000013_154600_155490 253
170 3300048904 Ga0496101_0000035 Ga0496101_0000035_154600_155490 253
171 3300048909 Ga0496106_0000062 Ga0496106_0000062_63132_64022 253
172 3300048910 Ga0496107_0000020 Ga0496107_0000020_125749_126639 253
173 3300048913 Ga0496110_0072907 Ga0496110_0072907_1430_2320 253
174 3300049578 Ga0501042_0121902 Ga0501042_0121902_93_980 253
175 3300049591 Ga0501075_0001206 Ga0501075_0001206_9851_10741 253
176 3300050510 nmdc:mga06r32_189999_c1 nmdc:mga06r32_189999_c1_145_1200 253
177 3300053077 Ga0495601_0216747 Ga0495601_0216747_316_1194 253
178 3300005327 Ga0070658_10118218 Ga0070658_101182182 254
179 3300005335 Ga0070666_10034430 Ga0070666_100344302 254
180 3300005364 Ga0070673_100013619 Ga0070673_1000136191 254
181 3300009098 Ga0105245_10006545 Ga0105245_100065456 254
182 3300025903 Ga0207680_10025822 Ga0207680_100258224 254
183 3300025909 Ga0207705_10064896 Ga0207705_100648963 254
184 3300025926 Ga0207659_10000553 Ga0207659_100005535 254
185 3300025927 Ga0207687_10000073 Ga0207687_1000007330 254
186 3300025960 Ga0207651_10006244 Ga0207651_100062445 254
187 3300026075 Ga0207708_10094449 Ga0207708_100944492 254
188 3300045836 Ga0466958_0043630 Ga0466958_0043630_461_1351 254
189 3300046511 Ga0495608_0006623 Ga0495608_0006623_6381_7271 254
190 3300046515 Ga0495620_0000211 Ga0495620_0000211_19631_20518 254
191 3300046517 Ga0495630_0000075 Ga0495630_0000075_56324_57211 254
192 3300046517 Ga0495630_0020574 Ga0495630_0020574_2749_3639 254
193 3300046690 Ga0495624_0000027 Ga0495624_0000027_73745_74632 254
194 3300047317 Ga0495604_0048237 Ga0495604_0048237_868_1755 254
195 3300047472 Ga0495686_0111825 Ga0495686_0111825_615_1577 254
196 3300048922 Ga0496119_0022693 Ga0496119_0022693_2462_3439 254
197 3300053077 Ga0495601_0000254 Ga0495601_0000254_24532_25422 254
198 3300053078 Ga0495612_0003936 Ga0495612_0003936_1584_2471 254
199 3300053078 Ga0495612_0050293 Ga0495612_0050293_606_1493 254
200 3300053096 Ga0500641_0003882 Ga0500641_0003882_39_920 254
201 3300001979 JGI24740J21852_10009389 JGI24740J21852_100093894 255
202 3300003659 JGI25404J52841_10000671 JGI25404J52841_100006717 255
203 3300005339 Ga0070660_100207538 Ga0070660_1002075382 255
204 3300005341 Ga0070691_10000021 Ga0070691_1000002127 255
205 3300005548 Ga0070665_100024849 Ga0070665_1000248494 255
206 3300005563 Ga0068855_100056955 Ga0068855_1000569555 255
207 3300005577 Ga0068857_100019320 Ga0068857_1000193204 255
208 3300005616 Ga0068852_100000056 Ga0068852_10000005626 255
209 3300005983 Ga0081540_1000041 Ga0081540_100004181 255
210 3300006871 Ga0075434_100253214 Ga0075434_1002532142 255
211 3300009177 Ga0105248_10000020 Ga0105248_1000002026 255
212 3300013105 Ga0157369_10000074 Ga0157369_10000074124 255
213 3300013296 Ga0157374_10134876 Ga0157374_101348764 255
214 3300014326 Ga0157380_10003677 Ga0157380_100036774 255
215 3300025899 Ga0207642_10061910 Ga0207642_100619102 255
216 3300025916 Ga0207663_10155492 Ga0207663_101554922 255
217 3300025934 Ga0207686_10000073 Ga0207686_1000007387 255
218 3300025941 Ga0207711_10000006 Ga0207711_10000006349 255
219 3300026142 Ga0207698_10000101 Ga0207698_1000010126 255
220 3300028379 Ga0268266_10007058 Ga0268266_100070584 255
221 3300028563 Ga0265319_1000105 Ga0265319_100010526 255
222 3300028800 Ga0265338_10000507 Ga0265338_1000050749 255
223 3300029957 Ga0265324_10045977 Ga0265324_100459772 255
224 3300031241 Ga0265325_10004756 Ga0265325_100047563 255
225 3300031250 Ga0265331_10010709 Ga0265331_100107094 255
226 3300031456 Ga0307513_10436096 Ga0307513_104360961 255
227 3300031712 Ga0265342_10210826 Ga0265342_102108261 255
228 3300044842 Ga0466957_0107876 Ga0466957_0107876_202_1095 255
229 3300046459 Ga0495629_0001073 Ga0495629_0001073_6421_7308 255
230 3300046459 Ga0495629_0009253 Ga0495629_0009253_2877_3764 255
231 3300046461 Ga0495641_0026462 Ga0495641_0026462_802_1689 255
232 3300046461 Ga0495641_0051589 Ga0495641_0051589_589_1479 255
233 3300046516 Ga0495628_0001027 Ga0495628_0001027_4360_5247 255
234 3300046517 Ga0495630_0062523 Ga0495630_0062523_253_1140 255
235 3300046536 Ga0495587_0046584 Ga0495587_0046584_1662_2549 255
236 3300046674 Ga0495588_0000187 Ga0495588_0000187_20020_20907 255
237 3300046681 Ga0495647_0003855 Ga0495647_0003855_3202_4089 255
238 3300047321 Ga0495676_0012335 Ga0495676_0012335_1696_2583 255
239 3300048088 Ga0495602_0000571 Ga0495602_0000571_5671_6558 255
240 3300048903 Ga0496100_0000001 Ga0496100_0000001_510815_511702 255
241 3300048904 Ga0496101_0000004 Ga0496101_0000004_312167_313054 255
242 3300048905 Ga0496102_0000522 Ga0496102_0000522_19844_20731 255
243 3300048906 Ga0496103_0000174 Ga0496103_0000174_20311_21198 255
244 3300048909 Ga0496106_0000414 Ga0496106_0000414_10932_11819 255
245 3300048910 Ga0496107_0000005 Ga0496107_0000005_18546_19433 255
246 3300048913 Ga0496110_0135373 Ga0496110_0135373_655_1548 255
247 3300048917 Ga0496114_0000039 Ga0496114_0000039_114344_115231 255
248 3300048917 Ga0496114_0231826 Ga0496114_0231826_262_1149 255
249 3300048918 Ga0496115_0000011 Ga0496115_0000011_19705_20592 255
250 3300053083 Ga0495655_0000002 Ga0495655_0000002_290793_291680 255
251 3300053083 Ga0495655_0000539 Ga0495655_0000539_373_1257 255
252 3300053094 Ga0500566_0000798 Ga0500566_0000798_10584_11471 255
253 3300053129 Ga0500628_000001 Ga0500628_000001_379462_380349 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01148

CTP_transf_1

Cytidylyltransferase family

58

315

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7646 15 254
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.7582 18 253
4q2g-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) 0.7219 15 254
4q2e-assembly1.cif.gz_A crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) 0.707 18 253
5wuf-assembly1.cif.gz_A structural basis for conductance through tric cation channels 0.3132 47 249
ID Description Score Start End Superfamily
af_Q9VHP1_6_149_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3916 118 253 1.10.1760.20
af_Q2G0R7_343_485_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.3884 23 185 1.10.1760.20
af_Q4DEW8_2_121_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.3867 125 252 1.10.3730.20
af_E7F1E5_45_195_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3773 130 254 1.20.1070.10
af_Q2G0R7_343_485_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.374 23 185 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A840IHW3-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8997 22 253 GO:0004605
GO:0005886
GO:0016024
AF-A0A838PQU0-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) 0.8978 24 252 GO:0004605
GO:0005886
GO:0016024
AF-A0A6N7YLZ7-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8932 24 253 GO:0004605
GO:0005886
GO:0016024
AF-A0A2W6BKX7-F1-model_v4 Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) 0.8932 18 255 GO:0004605
GO:0005886
GO:0016024
AF-A0A7V9VQ77-F1-model_v4 deleted 0.8878 24 242

Feature Viewer

pLDDT pTM Quality
79.32 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map