F363976
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 253 | 194 | 253 | 275 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100253214|Ga0075434_1002532142 |
| Length | 317 |
| Sequence | MPNLRRAEETFLGEEAESPGIAGGEELLEGEGEELELFADERPEPIEPPRRRRGGETARRVLVAIPWIIFAIVITVAGGLPFAIAIAGLGLIGLREYFVMTAQHRPIQIAAYLAVPGMILAAHFGTAFNVLLVASASFLLLFAFGADRNHRDGITVSMGVTLLGVVWIGIPLVHAVLLRDLPHHGAALLIDVLVGTFVTDTAAYATGRMFGQHRFAPQLSPNKTIEGLVGGFVIGTMGFWFAGLYQDWLSGVDALIIGAAVAALAPVGDLFESMLKRDLGRKDTGTLFGPHGGLLDRLDAALFTIVVGYYLAVQLVY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 35 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 40 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 41 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 99 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 100 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 101 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 105 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 112 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 113 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 115 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 116 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 117 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 118 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 171 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 172 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 173 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 174 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 175 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 176 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 177 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 178 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 193 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 194 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.4 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.98 |
| Nodule | 0 |
| Rhizoplane | 11.07 |
| Rhizosphere | 82.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009389 | 3300001979 | Bacteria | 3832 |
| 2 | JGI25404J52841_10000671 | 3300003659 | Bacteria | 5227 |
| 3 | Ga0070658_10118218 | 3300005327 | Bacteria | 2201 |
| 4 | Ga0070683_100002624 | 3300005329 | Bacteria | 14372 |
| 5 | Ga0070683_100071942 | 3300005329 | Bacteria | 3227 |
| 6 | Ga0070677_10000091 | 3300005333 | Bacteria | 29146 |
| 7 | Ga0070666_10034430 | 3300005335 | Bacteria | 3357 |
| 8 | Ga0070682_100000398 | 3300005337 | Bacteria | 29064 |
| 9 | Ga0068868_100003008 | 3300005338 | Bacteria | 11721 |
| 10 | Ga0068868_100004891 | 3300005338 | Bacteria | 9406 |
| 11 | Ga0070660_100207538 | 3300005339 | Unclassified | 1590 |
| 12 | Ga0070691_10000021 | 3300005341 | Bacteria | 45268 |
| 13 | Ga0070661_100000616 | 3300005344 | Bacteria | 26479 |
| 14 | Ga0070668_100101166 | 3300005347 | Bacteria | 2284 |
| 15 | Ga0070674_100000235 | 3300005356 | Bacteria | 27333 |
| 16 | Ga0070673_100013619 | 3300005364 | Bacteria | 5633 |
| 17 | Ga0070688_100000027 | 3300005365 | Bacteria | 67477 |
| 18 | Ga0070688_100000373 | 3300005365 | Bacteria | 22710 |
| 19 | Ga0070667_100001804 | 3300005367 | Bacteria | 19049 |
| 20 | Ga0070667_100263270 | 3300005367 | Bacteria | 1544 |
| 21 | Ga0070714_100075899 | 3300005435 | Bacteria | 2917 |
| 22 | Ga0070713_100000010 | 3300005436 | Bacteria | 151790 |
| 23 | Ga0070711_100004194 | 3300005439 | Bacteria | 8471 |
| 24 | Ga0070694_100111958 | 3300005444 | Bacteria | 1946 |
| 25 | Ga0070662_100000061 | 3300005457 | Bacteria | 58911 |
| 26 | Ga0070681_10090912 | 3300005458 | Bacteria | 3003 |
| 27 | Ga0068867_100000226 | 3300005459 | Bacteria | 36850 |
| 28 | Ga0070685_10000118 | 3300005466 | Bacteria | 50597 |
| 29 | Ga0070685_10003919 | 3300005466 | Bacteria | 7520 |
| 30 | Ga0070679_100001474 | 3300005530 | Bacteria | 20867 |
| 31 | Ga0070684_100058026 | 3300005535 | Bacteria | 3381 |
| 32 | Ga0070684_100087930 | 3300005535 | Bacteria | 2760 |
| 33 | Ga0070693_100008442 | 3300005547 | Bacteria | 5079 |
| 34 | Ga0070665_100020049 | 3300005548 | Bacteria | 6713 |
| 35 | Ga0070665_100024849 | 3300005548 | Bacteria | 6036 |
| 36 | Ga0068855_100056955 | 3300005563 | Bacteria | 4583 |
| 37 | Ga0068857_100019320 | 3300005577 | Bacteria | 5982 |
| 38 | Ga0068854_100000116 | 3300005578 | Bacteria | 54986 |
| 39 | Ga0068854_100030204 | 3300005578 | Bacteria | 3758 |
| 40 | Ga0068856_100323687 | 3300005614 | Bacteria | 1559 |
| 41 | Ga0068852_100000056 | 3300005616 | Bacteria | 76111 |
| 42 | Ga0068866_10000008 | 3300005718 | Bacteria | 117658 |
| 43 | Ga0068861_100104384 | 3300005719 | Bacteria | 2261 |
| 44 | Ga0068863_100065700 | 3300005841 | Bacteria | 3432 |
| 45 | Ga0068862_100001600 | 3300005844 | Bacteria | 20633 |
| 46 | Ga0081455_10086730 | 3300005937 | Bacteria | 2549 |
| 47 | Ga0081540_1000041 | 3300005983 | Bacteria | 136874 |
| 48 | Ga0075365_10316843 | 3300006038 | Bacteria | 1098 |
| 49 | Ga0070715_10000021 | 3300006163 | Bacteria | 119283 |
| 50 | Ga0070712_100004878 | 3300006175 | Bacteria | 8296 |
| 51 | Ga0068871_100074592 | 3300006358 | Bacteria | 2799 |
| 52 | Ga0075430_100044684 | 3300006846 | Bacteria | 3744 |
| 53 | Ga0075434_100253214 | 3300006871 | Bacteria | 1780 |
| 54 | Ga0075436_100324052 | 3300006914 | Bacteria | 1107 |
| 55 | Ga0075435_100166949 | 3300007076 | Bacteria | 1856 |
| 56 | Ga0105245_10006545 | 3300009098 | Bacteria | 10227 |
| 57 | Ga0105247_10350021 | 3300009101 | Bacteria | 1039 |
| 58 | Ga0105243_10006419 | 3300009148 | Bacteria | 9088 |
| 59 | Ga0105248_10000020 | 3300009177 | Bacteria | 284637 |
| 60 | Ga0105238_10000055 | 3300009551 | Bacteria | 139232 |
| 61 | Ga0105249_10000332 | 3300009553 | Bacteria | 47770 |
| 62 | Ga0157369_10000074 | 3300013105 | Bacteria | 136668 |
| 63 | Ga0157374_10023926 | 3300013296 | Bacteria | 5470 |
| 64 | Ga0157374_10134876 | 3300013296 | Bacteria | 2392 |
| 65 | Ga0157378_10145567 | 3300013297 | Bacteria | 2203 |
| 66 | Ga0157372_10006125 | 3300013307 | Bacteria | 12781 |
| 67 | Ga0157375_10054962 | 3300013308 | Bacteria | 3923 |
| 68 | Ga0157380_10000391 | 3300014326 | Bacteria | 26465 |
| 69 | Ga0157380_10003677 | 3300014326 | Bacteria | 10550 |
| 70 | Ga0157376_10080966 | 3300014969 | Bacteria | 2787 |
| 71 | Ga0206353_10485474 | 3300020082 | Bacteria | 2537 |
| 72 | Ga0207682_10000022 | 3300025893 | Bacteria | 62630 |
| 73 | Ga0207642_10000002 | 3300025899 | Bacteria | 658166 |
| 74 | Ga0207642_10061910 | 3300025899 | Bacteria | 1742 |
| 75 | Ga0207710_10001168 | 3300025900 | Bacteria | 13367 |
| 76 | Ga0207680_10025822 | 3300025903 | Bacteria | 3246 |
| 77 | Ga0207685_10000028 | 3300025905 | Bacteria | 97935 |
| 78 | Ga0207705_10064896 | 3300025909 | Bacteria | 2639 |
| 79 | Ga0207654_10090219 | 3300025911 | Bacteria | 1866 |
| 80 | Ga0207707_10001875 | 3300025912 | Bacteria | 19216 |
| 81 | Ga0207693_10016150 | 3300025915 | Bacteria | 5972 |
| 82 | Ga0207663_10155492 | 3300025916 | Bacteria | 1608 |
| 83 | Ga0207649_10000189 | 3300025920 | Bacteria | 50504 |
| 84 | Ga0207652_10036544 | 3300025921 | Bacteria | 4152 |
| 85 | Ga0207694_10000063 | 3300025924 | Bacteria | 139700 |
| 86 | Ga0207659_10000553 | 3300025926 | Bacteria | 22395 |
| 87 | Ga0207687_10000073 | 3300025927 | Bacteria | 73917 |
| 88 | Ga0207700_10000007 | 3300025928 | Bacteria | 345720 |
| 89 | Ga0207706_10000250 | 3300025933 | Bacteria | 58868 |
| 90 | Ga0207686_10000073 | 3300025934 | Bacteria | 92009 |
| 91 | Ga0207686_10106975 | 3300025934 | Bacteria | 1879 |
| 92 | Ga0207709_10236944 | 3300025935 | Bacteria | 1325 |
| 93 | Ga0207669_10000182 | 3300025937 | Bacteria | 29102 |
| 94 | Ga0207691_10000529 | 3300025940 | Bacteria | 38127 |
| 95 | Ga0207711_10000006 | 3300025941 | Bacteria | 792692 |
| 96 | Ga0207661_10000278 | 3300025944 | Bacteria | 32703 |
| 97 | Ga0207661_10000312 | 3300025944 | Bacteria | 30978 |
| 98 | Ga0207651_10006244 | 3300025960 | Bacteria | 6211 |
| 99 | Ga0207712_10000058 | 3300025961 | Bacteria | 140948 |
| 100 | Ga0207668_10031218 | 3300025972 | Bacteria | 3507 |
| 101 | Ga0207640_10000134 | 3300025981 | Bacteria | 54961 |
| 102 | Ga0207640_10032707 | 3300025981 | Bacteria | 3227 |
| 103 | Ga0207677_10000263 | 3300026023 | Bacteria | 39869 |
| 104 | Ga0207677_10000374 | 3300026023 | Bacteria | 31092 |
| 105 | Ga0207639_10083399 | 3300026041 | Bacteria | 2537 |
| 106 | Ga0207708_10094449 | 3300026075 | Bacteria | 2308 |
| 107 | Ga0207641_10016945 | 3300026088 | Bacteria | 5965 |
| 108 | Ga0207648_10000907 | 3300026089 | Bacteria | 33370 |
| 109 | Ga0207675_100201565 | 3300026118 | Bacteria | 1911 |
| 110 | Ga0207698_10000101 | 3300026142 | Bacteria | 54530 |
| 111 | Ga0268266_10007058 | 3300028379 | Bacteria | 10199 |
| 112 | Ga0265337_1000240 | 3300028556 | Bacteria | 29757 |
| 113 | Ga0265326_10000393 | 3300028558 | Bacteria | 17549 |
| 114 | Ga0265319_1000105 | 3300028563 | Bacteria | 65502 |
| 115 | Ga0265322_10000029 | 3300028654 | Bacteria | 82867 |
| 116 | Ga0265336_10004292 | 3300028666 | Bacteria | 5420 |
| 117 | Ga0265338_10000507 | 3300028800 | Bacteria | 69026 |
| 118 | Ga0265324_10001546 | 3300029957 | Bacteria | 12903 |
| 119 | Ga0265324_10045977 | 3300029957 | Bacteria | 1503 |
| 120 | Ga0265330_10074680 | 3300031235 | Bacteria | 1465 |
| 121 | Ga0265328_10000802 | 3300031239 | Bacteria | 14539 |
| 122 | Ga0265320_10000011 | 3300031240 | Bacteria | 249534 |
| 123 | Ga0265325_10004756 | 3300031241 | Bacteria | 8512 |
| 124 | Ga0265339_10146559 | 3300031249 | Bacteria | 1197 |
| 125 | Ga0265331_10000839 | 3300031250 | Bacteria | 25044 |
| 126 | Ga0265331_10010709 | 3300031250 | Bacteria | 5057 |
| 127 | Ga0265327_10000015 | 3300031251 | Bacteria | 496677 |
| 128 | Ga0307513_10436096 | 3300031456 | Bacteria | 1037 |
| 129 | Ga0265314_10000361 | 3300031711 | Bacteria | 63269 |
| 130 | Ga0265342_10210826 | 3300031712 | Bacteria | 1051 |
| 131 | Ga0307407_10501978 | 3300031903 | Bacteria | 889 |
| 132 | Ga0316584_0002636 | 3300036712 | Bacteria | 11443 |
| 133 | Ga0451800_0843574 | 3300041459 | Bacteria | 1345 |
| 134 | Ga0466957_0107876 | 3300044842 | Bacteria | 1763 |
| 135 | Ga0466958_0043630 | 3300045836 | Bacteria | 2701 |
| 136 | Ga0466967_0259273 | 3300045976 | Bacteria | 1663 |
| 137 | Ga0495603_0198449 | 3300046455 | Unclassified | 1159 |
| 138 | Ga0495590_0059591 | 3300046457 | Bacteria | 1336 |
| 139 | Ga0495629_0001073 | 3300046459 | Bacteria | 21818 |
| 140 | Ga0495629_0009253 | 3300046459 | Bacteria | 7207 |
| 141 | Ga0495638_0013333 | 3300046460 | Bacteria | 5601 |
| 142 | Ga0495641_0026462 | 3300046461 | Bacteria | 2830 |
| 143 | Ga0495641_0051589 | 3300046461 | Bacteria | 1877 |
| 144 | Ga0495662_0000304 | 3300046476 | Bacteria | 21364 |
| 145 | Ga0495594_0000011 | 3300046499 | Bacteria | 118444 |
| 146 | Ga0495606_0000586 | 3300046507 | Bacteria | 57795 |
| 147 | Ga0495608_0000007 | 3300046511 | Bacteria | 313495 |
| 148 | Ga0495608_0006623 | 3300046511 | Bacteria | 8221 |
| 149 | Ga0495608_0100721 | 3300046511 | Bacteria | 1863 |
| 150 | Ga0495620_0000211 | 3300046515 | Bacteria | 43874 |
| 151 | Ga0495628_0001027 | 3300046516 | Bacteria | 25537 |
| 152 | Ga0495628_0005762 | 3300046516 | Bacteria | 10854 |
| 153 | Ga0495628_0054830 | 3300046516 | Bacteria | 3141 |
| 154 | Ga0495630_0000075 | 3300046517 | Bacteria | 77378 |
| 155 | Ga0495630_0000454 | 3300046517 | Bacteria | 31035 |
| 156 | Ga0495630_0020574 | 3300046517 | Bacteria | 4866 |
| 157 | Ga0495630_0062523 | 3300046517 | Bacteria | 2797 |
| 158 | Ga0495644_0000176 | 3300046523 | Bacteria | 30116 |
| 159 | Ga0495644_0075165 | 3300046523 | Bacteria | 1272 |
| 160 | Ga0495652_0000037 | 3300046529 | Bacteria | 133232 |
| 161 | Ga0495652_0034269 | 3300046529 | Bacteria | 4426 |
| 162 | Ga0495640_0017150 | 3300046533 | Bacteria | 5404 |
| 163 | Ga0495587_0046584 | 3300046536 | Bacteria | 2573 |
| 164 | Ga0495645_0000984 | 3300046543 | Bacteria | 19435 |
| 165 | Ga0495645_0033410 | 3300046543 | Bacteria | 3753 |
| 166 | Ga0495622_0000387 | 3300046557 | Bacteria | 30369 |
| 167 | Ga0495667_0000020 | 3300046559 | Bacteria | 180876 |
| 168 | Ga0495634_0002062 | 3300046642 | Bacteria | 16995 |
| 169 | Ga0495625_0001050 | 3300046660 | Bacteria | 36223 |
| 170 | Ga0495588_0000187 | 3300046674 | Bacteria | 67620 |
| 171 | Ga0495657_0000001 | 3300046675 | Bacteria | 445641 |
| 172 | Ga0495657_0024139 | 3300046675 | Bacteria | 4334 |
| 173 | Ga0495647_0003855 | 3300046681 | Bacteria | 4830 |
| 174 | Ga0495669_0000143 | 3300046684 | Bacteria | 45428 |
| 175 | Ga0495624_0000027 | 3300046690 | Bacteria | 93611 |
| 176 | Ga0495670_0003783 | 3300046691 | Bacteria | 7436 |
| 177 | Ga0495604_0000050 | 3300047317 | Bacteria | 108094 |
| 178 | Ga0495604_0048237 | 3300047317 | Bacteria | 3313 |
| 179 | Ga0495674_0000030 | 3300047319 | Bacteria | 115975 |
| 180 | Ga0495676_0012335 | 3300047321 | Bacteria | 7698 |
| 181 | Ga0495676_0078382 | 3300047321 | Bacteria | 2516 |
| 182 | Ga0495680_0004041 | 3300047322 | Bacteria | 14142 |
| 183 | Ga0495675_0000453 | 3300047444 | Bacteria | 27185 |
| 184 | Ga0495686_0111825 | 3300047472 | Bacteria | 1637 |
| 185 | Ga0495593_0037035 | 3300047673 | Bacteria | 2642 |
| 186 | Ga0495602_0000571 | 3300048088 | Bacteria | 34252 |
| 187 | Ga0495602_0156883 | 3300048088 | Bacteria | 1781 |
| 188 | Ga0496100_0000001 | 3300048903 | Bacteria | 530179 |
| 189 | Ga0496100_0000013 | 3300048903 | Bacteria | 177476 |
| 190 | Ga0496101_0000004 | 3300048904 | Bacteria | 331599 |
| 191 | Ga0496101_0000035 | 3300048904 | Bacteria | 177237 |
| 192 | Ga0496102_0000522 | 3300048905 | Bacteria | 41862 |
| 193 | Ga0496102_0054230 | 3300048905 | Bacteria | 3655 |
| 194 | Ga0496103_0000174 | 3300048906 | Bacteria | 67124 |
| 195 | Ga0496103_0050582 | 3300048906 | Bacteria | 2570 |
| 196 | Ga0496103_0149642 | 3300048906 | Bacteria | 1495 |
| 197 | Ga0496104_0001240 | 3300048907 | Bacteria | 21960 |
| 198 | Ga0496105_0006317 | 3300048908 | Bacteria | 9103 |
| 199 | Ga0496106_0000062 | 3300048909 | Bacteria | 85769 |
| 200 | Ga0496106_0000414 | 3300048909 | Bacteria | 30298 |
| 201 | Ga0496107_0000005 | 3300048910 | Bacteria | 281747 |
| 202 | Ga0496107_0000020 | 3300048910 | Bacteria | 148990 |
| 203 | Ga0496108_0017030 | 3300048911 | Bacteria | 5941 |
| 204 | Ga0496109_0001088 | 3300048912 | Bacteria | 22576 |
| 205 | Ga0496109_0654950 | 3300048912 | Bacteria | 987 |
| 206 | Ga0496110_0000242 | 3300048913 | Bacteria | 35454 |
| 207 | Ga0496110_0072907 | 3300048913 | Bacteria | 3047 |
| 208 | Ga0496110_0135373 | 3300048913 | Bacteria | 2226 |
| 209 | Ga0496111_0000316 | 3300048914 | Bacteria | 23885 |
| 210 | Ga0496112_0000025 | 3300048915 | Bacteria | 146197 |
| 211 | Ga0496114_0000039 | 3300048917 | Bacteria | 138486 |
| 212 | Ga0496114_0231826 | 3300048917 | Bacteria | 1622 |
| 213 | Ga0496115_0000011 | 3300048918 | Bacteria | 222529 |
| 214 | Ga0496115_0031258 | 3300048918 | Bacteria | 4194 |
| 215 | Ga0496116_0000176 | 3300048919 | Bacteria | 128426 |
| 216 | Ga0496117_0002967 | 3300048920 | Bacteria | 20476 |
| 217 | Ga0496118_0007078 | 3300048921 | Bacteria | 12050 |
| 218 | Ga0496119_0001444 | 3300048922 | Bacteria | 28583 |
| 219 | Ga0496119_0022693 | 3300048922 | Bacteria | 4482 |
| 220 | Ga0496119_0123286 | 3300048922 | Bacteria | 1421 |
| 221 | Ga0496120_0006050 | 3300048923 | Bacteria | 9402 |
| 222 | Ga0496121_0061005 | 3300048924 | Bacteria | 3097 |
| 223 | Ga0496125_0030415 | 3300048928 | Bacteria | 4832 |
| 224 | Ga0496126_0003514 | 3300048929 | Bacteria | 19727 |
| 225 | Ga0501042_0121902 | 3300049578 | Bacteria | 1877 |
| 226 | Ga0501047_0057719 | 3300049581 | Bacteria | 3753 |
| 227 | Ga0501075_0001206 | 3300049591 | Bacteria | 16739 |
| 228 | Ga0501076_0098262 | 3300049592 | Bacteria | 2358 |
| 229 | Ga0501083_0005694 | 3300049744 | Bacteria | 8818 |
| 230 | Ga0501044_0301983 | 3300049823 | Bacteria | 1529 |
| 231 | nmdc:mga00v17_37737_c1 | 3300050491 | Bacteria | 2886 |
| 232 | nmdc:mga0qj67_8158_c1 | 3300050509 | Bacteria | 7758 |
| 233 | nmdc:mga06r32_189999_c1 | 3300050510 | Bacteria | 2041 |
| 234 | Ga0495601_0000254 | 3300053077 | Bacteria | 28596 |
| 235 | Ga0495601_0005631 | 3300053077 | Bacteria | 7303 |
| 236 | Ga0495601_0007882 | 3300053077 | Bacteria | 6273 |
| 237 | Ga0495601_0185336 | 3300053077 | Bacteria | 1360 |
| 238 | Ga0495601_0216747 | 3300053077 | Bacteria | 1250 |
| 239 | Ga0495612_0003936 | 3300053078 | Bacteria | 6164 |
| 240 | Ga0495612_0031859 | 3300053078 | Bacteria | 2128 |
| 241 | Ga0495612_0050293 | 3300053078 | Bacteria | 1711 |
| 242 | Ga0495655_0000002 | 3300053083 | Bacteria | 312752 |
| 243 | Ga0495655_0000539 | 3300053083 | Bacteria | 6211 |
| 244 | Ga0495595_0000002 | 3300053084 | Bacteria | 445641 |
| 245 | Ga0495619_0000047 | 3300053085 | Bacteria | 102152 |
| 246 | Ga0495619_0000276 | 3300053085 | Bacteria | 36931 |
| 247 | Ga0495619_0000485 | 3300053085 | Bacteria | 26622 |
| 248 | Ga0495619_0000680 | 3300053085 | Bacteria | 22263 |
| 249 | Ga0495619_0143641 | 3300053085 | Bacteria | 1644 |
| 250 | Ga0495619_0267645 | 3300053085 | Bacteria | 1184 |
| 251 | Ga0500566_0000798 | 3300053094 | Bacteria | 17895 |
| 252 | Ga0500641_0003882 | 3300053096 | Bacteria | 5283 |
| 253 | Ga0500628_000001 | 3300053129 | Bacteria | 564074 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047673 | Ga0495593_0037035 | Ga0495593_0037035_1226_2143 | 226 |
| 2 | 3300005719 | Ga0068861_100104384 | Ga0068861_1001043841 | 234 |
| 3 | 3300026118 | Ga0207675_100201565 | Ga0207675_1002015651 | 234 |
| 4 | 3300006358 | Ga0068871_100074592 | Ga0068871_1000745922 | 235 |
| 5 | 3300025900 | Ga0207710_10001168 | Ga0207710_100011686 | 236 |
| 6 | 3300048929 | Ga0496126_0003514 | Ga0496126_0003514_14551_15513 | 237 |
| 7 | 3300006038 | Ga0075365_10316843 | Ga0075365_103168431 | 239 |
| 8 | 3300009101 | Ga0105247_10350021 | Ga0105247_103500212 | 239 |
| 9 | 3300036712 | Ga0316584_0002636 | Ga0316584_0002636_5183_5977 | 239 |
| 10 | 3300050491 | nmdc:mga00v17_37737_c1 | nmdc:mga00v17_37737_c1_1875_2669 | 239 |
| 11 | 3300005578 | Ga0068854_100000116 | Ga0068854_10000011637 | 240 |
| 12 | 3300025981 | Ga0207640_10000134 | Ga0207640_1000013438 | 240 |
| 13 | 3300031903 | Ga0307407_10501978 | Ga0307407_105019781 | 240 |
| 14 | 3300047321 | Ga0495676_0078382 | Ga0495676_0078382_736_1584 | 240 |
| 15 | 3300046511 | Ga0495608_0000007 | Ga0495608_0000007_23303_24184 | 241 |
| 16 | 3300046675 | Ga0495657_0000001 | Ga0495657_0000001_155449_156330 | 241 |
| 17 | 3300047444 | Ga0495675_0000453 | Ga0495675_0000453_12108_12989 | 241 |
| 18 | 3300053084 | Ga0495595_0000002 | Ga0495595_0000002_289312_290193 | 241 |
| 19 | 3300053085 | Ga0495619_0000276 | Ga0495619_0000276_14181_15062 | 241 |
| 20 | 3300005329 | Ga0070683_100071942 | Ga0070683_1000719424 | 242 |
| 21 | 3300005535 | Ga0070684_100058026 | Ga0070684_1000580264 | 242 |
| 22 | 3300025911 | Ga0207654_10090219 | Ga0207654_100902191 | 242 |
| 23 | 3300025944 | Ga0207661_10000278 | Ga0207661_1000027828 | 242 |
| 24 | 3300048908 | Ga0496105_0006317 | Ga0496105_0006317_6144_7061 | 242 |
| 25 | 3300005344 | Ga0070661_100000616 | Ga0070661_1000006166 | 243 |
| 26 | 3300020082 | Ga0206353_10485474 | Ga0206353_104854743 | 243 |
| 27 | 3300025920 | Ga0207649_10000189 | Ga0207649_1000018926 | 243 |
| 28 | 3300047317 | Ga0495604_0000050 | Ga0495604_0000050_84399_85286 | 243 |
| 29 | 3300005436 | Ga0070713_100000010 | Ga0070713_100000010124 | 244 |
| 30 | 3300025928 | Ga0207700_10000007 | Ga0207700_10000007325 | 244 |
| 31 | 3300005337 | Ga0070682_100000398 | Ga0070682_10000039828 | 245 |
| 32 | 3300053078 | Ga0495612_0031859 | Ga0495612_0031859_870_1751 | 245 |
| 33 | 3300053085 | Ga0495619_0000485 | Ga0495619_0000485_3606_4496 | 245 |
| 34 | 3300005338 | Ga0068868_100003008 | Ga0068868_1000030089 | 246 |
| 35 | 3300005347 | Ga0070668_100101166 | Ga0070668_1001011662 | 246 |
| 36 | 3300005535 | Ga0070684_100087930 | Ga0070684_1000879304 | 246 |
| 37 | 3300009148 | Ga0105243_10006419 | Ga0105243_100064196 | 246 |
| 38 | 3300014326 | Ga0157380_10000391 | Ga0157380_1000039118 | 246 |
| 39 | 3300025935 | Ga0207709_10236944 | Ga0207709_102369442 | 246 |
| 40 | 3300025972 | Ga0207668_10031218 | Ga0207668_100312182 | 246 |
| 41 | 3300026023 | Ga0207677_10000374 | Ga0207677_1000037415 | 246 |
| 42 | 3300048088 | Ga0495602_0156883 | Ga0495602_0156883_123_1007 | 246 |
| 43 | 3300048915 | Ga0496112_0000025 | Ga0496112_0000025_23945_24826 | 246 |
| 44 | 3300053085 | Ga0495619_0143641 | Ga0495619_0143641_55_939 | 246 |
| 45 | 3300005937 | Ga0081455_10086730 | Ga0081455_100867302 | 247 |
| 46 | 3300006163 | Ga0070715_10000021 | Ga0070715_1000002197 | 247 |
| 47 | 3300013297 | Ga0157378_10145567 | Ga0157378_101455672 | 247 |
| 48 | 3300013307 | Ga0157372_10006125 | Ga0157372_100061254 | 247 |
| 49 | 3300025905 | Ga0207685_10000028 | Ga0207685_1000002828 | 247 |
| 50 | 3300026041 | Ga0207639_10083399 | Ga0207639_100833992 | 247 |
| 51 | 3300046476 | Ga0495662_0000304 | Ga0495662_0000304_16473_17357 | 247 |
| 52 | 3300046533 | Ga0495640_0017150 | Ga0495640_0017150_1560_2444 | 247 |
| 53 | 3300047319 | Ga0495674_0000030 | Ga0495674_0000030_107138_108022 | 247 |
| 54 | 3300048911 | Ga0496108_0017030 | Ga0496108_0017030_3528_4424 | 247 |
| 55 | 3300048912 | Ga0496109_0001088 | Ga0496109_0001088_10339_11235 | 247 |
| 56 | 3300005365 | Ga0070688_100000027 | Ga0070688_10000002752 | 248 |
| 57 | 3300005459 | Ga0068867_100000226 | Ga0068867_10000022623 | 248 |
| 58 | 3300005466 | Ga0070685_10003919 | Ga0070685_100039195 | 248 |
| 59 | 3300026089 | Ga0207648_10000907 | Ga0207648_1000090721 | 248 |
| 60 | 3300046507 | Ga0495606_0000586 | Ga0495606_0000586_17927_18814 | 248 |
| 61 | 3300046660 | Ga0495625_0001050 | Ga0495625_0001050_15042_15932 | 248 |
| 62 | 3300053085 | Ga0495619_0000680 | Ga0495619_0000680_20117_21007 | 248 |
| 63 | 3300005367 | Ga0070667_100001804 | Ga0070667_10000180415 | 249 |
| 64 | 3300005548 | Ga0070665_100020049 | Ga0070665_1000200494 | 249 |
| 65 | 3300005844 | Ga0068862_100001600 | Ga0068862_10000160017 | 249 |
| 66 | 3300013308 | Ga0157375_10054962 | Ga0157375_100549625 | 249 |
| 67 | 3300041459 | Ga0451800_0843574 | Ga0451800_0843574_165_1052 | 249 |
| 68 | 3300046523 | Ga0495644_0000176 | Ga0495644_0000176_9941_10831 | 249 |
| 69 | 3300048924 | Ga0496121_0061005 | Ga0496121_0061005_673_1650 | 249 |
| 70 | 3300005365 | Ga0070688_100000373 | Ga0070688_1000003738 | 250 |
| 71 | 3300005435 | Ga0070714_100075899 | Ga0070714_1000758993 | 250 |
| 72 | 3300005466 | Ga0070685_10000118 | Ga0070685_1000011852 | 250 |
| 73 | 3300014969 | Ga0157376_10080966 | Ga0157376_100809662 | 250 |
| 74 | 3300046511 | Ga0495608_0100721 | Ga0495608_0100721_473_1357 | 250 |
| 75 | 3300048905 | Ga0496102_0054230 | Ga0496102_0054230_1687_2646 | 250 |
| 76 | 3300048906 | Ga0496103_0050582 | Ga0496103_0050582_450_1409 | 250 |
| 77 | 3300048907 | Ga0496104_0001240 | Ga0496104_0001240_738_1619 | 250 |
| 78 | 3300048912 | Ga0496109_0654950 | Ga0496109_0654950_78_959 | 250 |
| 79 | 3300048920 | Ga0496117_0002967 | Ga0496117_0002967_6074_7033 | 250 |
| 80 | 3300048921 | Ga0496118_0007078 | Ga0496118_0007078_10922_11881 | 250 |
| 81 | 3300048928 | Ga0496125_0030415 | Ga0496125_0030415_2854_3825 | 250 |
| 82 | 3300049592 | Ga0501076_0098262 | Ga0501076_0098262_109_984 | 250 |
| 83 | 3300053077 | Ga0495601_0007882 | Ga0495601_0007882_3265_4146 | 250 |
| 84 | 3300053077 | Ga0495601_0185336 | Ga0495601_0185336_395_1276 | 250 |
| 85 | 3300005439 | Ga0070711_100004194 | Ga0070711_1000041943 | 251 |
| 86 | 3300006846 | Ga0075430_100044684 | Ga0075430_1000446844 | 251 |
| 87 | 3300009551 | Ga0105238_10000055 | Ga0105238_10000055115 | 251 |
| 88 | 3300025924 | Ga0207694_10000063 | Ga0207694_1000006327 | 251 |
| 89 | 3300028556 | Ga0265337_1000240 | Ga0265337_100024022 | 251 |
| 90 | 3300028558 | Ga0265326_10000393 | Ga0265326_1000039317 | 251 |
| 91 | 3300028654 | Ga0265322_10000029 | Ga0265322_1000002969 | 251 |
| 92 | 3300028666 | Ga0265336_10004292 | Ga0265336_100042924 | 251 |
| 93 | 3300029957 | Ga0265324_10001546 | Ga0265324_1000154614 | 251 |
| 94 | 3300031235 | Ga0265330_10074680 | Ga0265330_100746802 | 251 |
| 95 | 3300031239 | Ga0265328_10000802 | Ga0265328_100008029 | 251 |
| 96 | 3300031240 | Ga0265320_10000011 | Ga0265320_10000011245 | 251 |
| 97 | 3300031249 | Ga0265339_10146559 | Ga0265339_101465591 | 251 |
| 98 | 3300031250 | Ga0265331_10000839 | Ga0265331_100008397 | 251 |
| 99 | 3300031251 | Ga0265327_10000015 | Ga0265327_10000015353 | 251 |
| 100 | 3300031711 | Ga0265314_10000361 | Ga0265314_1000036154 | 251 |
| 101 | 3300046455 | Ga0495603_0198449 | Ga0495603_0198449_129_1007 | 251 |
| 102 | 3300046517 | Ga0495630_0000454 | Ga0495630_0000454_9620_10510 | 251 |
| 103 | 3300046559 | Ga0495667_0000020 | Ga0495667_0000020_159836_160717 | 251 |
| 104 | 3300046675 | Ga0495657_0024139 | Ga0495657_0024139_1626_2516 | 251 |
| 105 | 3300046691 | Ga0495670_0003783 | Ga0495670_0003783_3580_4470 | 251 |
| 106 | 3300047322 | Ga0495680_0004041 | Ga0495680_0004041_11086_11967 | 251 |
| 107 | 3300048918 | Ga0496115_0031258 | Ga0496115_0031258_3199_4080 | 251 |
| 108 | 3300049581 | Ga0501047_0057719 | Ga0501047_0057719_2630_3628 | 251 |
| 109 | 3300049744 | Ga0501083_0005694 | Ga0501083_0005694_6876_7874 | 251 |
| 110 | 3300049823 | Ga0501044_0301983 | Ga0501044_0301983_118_1116 | 251 |
| 111 | 3300050509 | nmdc:mga0qj67_8158_c1 | nmdc:mga0qj67_8158_c1_1405_2295 | 251 |
| 112 | 3300053077 | Ga0495601_0005631 | Ga0495601_0005631_5252_6142 | 251 |
| 113 | 3300053085 | Ga0495619_0000047 | Ga0495619_0000047_22279_23184 | 251 |
| 114 | 3300053085 | Ga0495619_0267645 | Ga0495619_0267645_226_1116 | 251 |
| 115 | 3300005329 | Ga0070683_100002624 | Ga0070683_1000026243 | 252 |
| 116 | 3300005356 | Ga0070674_100000235 | Ga0070674_10000023527 | 252 |
| 117 | 3300005457 | Ga0070662_100000061 | Ga0070662_10000006159 | 252 |
| 118 | 3300005458 | Ga0070681_10090912 | Ga0070681_100909122 | 252 |
| 119 | 3300005530 | Ga0070679_100001474 | Ga0070679_1000014748 | 252 |
| 120 | 3300005578 | Ga0068854_100030204 | Ga0068854_1000302043 | 252 |
| 121 | 3300005614 | Ga0068856_100323687 | Ga0068856_1003236872 | 252 |
| 122 | 3300005718 | Ga0068866_10000008 | Ga0068866_1000000827 | 252 |
| 123 | 3300006175 | Ga0070712_100004878 | Ga0070712_1000048784 | 252 |
| 124 | 3300006914 | Ga0075436_100324052 | Ga0075436_1003240522 | 252 |
| 125 | 3300007076 | Ga0075435_100166949 | Ga0075435_1001669492 | 252 |
| 126 | 3300025899 | Ga0207642_10000002 | Ga0207642_10000002642 | 252 |
| 127 | 3300025912 | Ga0207707_10001875 | Ga0207707_1000187515 | 252 |
| 128 | 3300025915 | Ga0207693_10016150 | Ga0207693_100161506 | 252 |
| 129 | 3300025921 | Ga0207652_10036544 | Ga0207652_100365444 | 252 |
| 130 | 3300025933 | Ga0207706_10000250 | Ga0207706_100002506 | 252 |
| 131 | 3300025937 | Ga0207669_10000182 | Ga0207669_1000018227 | 252 |
| 132 | 3300025944 | Ga0207661_10000312 | Ga0207661_1000031218 | 252 |
| 133 | 3300025981 | Ga0207640_10032707 | Ga0207640_100327072 | 252 |
| 134 | 3300046460 | Ga0495638_0013333 | Ga0495638_0013333_3662_4552 | 252 |
| 135 | 3300046516 | Ga0495628_0054830 | Ga0495628_0054830_638_1528 | 252 |
| 136 | 3300046523 | Ga0495644_0075165 | Ga0495644_0075165_217_1101 | 252 |
| 137 | 3300046529 | Ga0495652_0000037 | Ga0495652_0000037_106926_107816 | 252 |
| 138 | 3300046529 | Ga0495652_0034269 | Ga0495652_0034269_2970_3860 | 252 |
| 139 | 3300046543 | Ga0495645_0033410 | Ga0495645_0033410_835_1725 | 252 |
| 140 | 3300048906 | Ga0496103_0149642 | Ga0496103_0149642_162_1166 | 252 |
| 141 | 3300048913 | Ga0496110_0000242 | Ga0496110_0000242_13139_14044 | 252 |
| 142 | 3300048914 | Ga0496111_0000316 | Ga0496111_0000316_12874_13779 | 252 |
| 143 | 3300048919 | Ga0496116_0000176 | Ga0496116_0000176_70651_71649 | 252 |
| 144 | 3300048922 | Ga0496119_0001444 | Ga0496119_0001444_16193_17191 | 252 |
| 145 | 3300048922 | Ga0496119_0123286 | Ga0496119_0123286_297_1265 | 252 |
| 146 | 3300048923 | Ga0496120_0006050 | Ga0496120_0006050_389_1357 | 252 |
| 147 | 3300005333 | Ga0070677_10000091 | Ga0070677_1000009117 | 253 |
| 148 | 3300005338 | Ga0068868_100004891 | Ga0068868_1000048916 | 253 |
| 149 | 3300005367 | Ga0070667_100263270 | Ga0070667_1002632702 | 253 |
| 150 | 3300005444 | Ga0070694_100111958 | Ga0070694_1001119583 | 253 |
| 151 | 3300005547 | Ga0070693_100008442 | Ga0070693_1000084425 | 253 |
| 152 | 3300005841 | Ga0068863_100065700 | Ga0068863_1000657003 | 253 |
| 153 | 3300009553 | Ga0105249_10000332 | Ga0105249_1000033228 | 253 |
| 154 | 3300013296 | Ga0157374_10023926 | Ga0157374_100239262 | 253 |
| 155 | 3300025893 | Ga0207682_10000022 | Ga0207682_1000002229 | 253 |
| 156 | 3300025934 | Ga0207686_10106975 | Ga0207686_101069752 | 253 |
| 157 | 3300025940 | Ga0207691_10000529 | Ga0207691_1000052936 | 253 |
| 158 | 3300025961 | Ga0207712_10000058 | Ga0207712_1000005828 | 253 |
| 159 | 3300026023 | Ga0207677_10000263 | Ga0207677_1000026342 | 253 |
| 160 | 3300026088 | Ga0207641_10016945 | Ga0207641_100169453 | 253 |
| 161 | 3300045976 | Ga0466967_0259273 | Ga0466967_0259273_233_1135 | 253 |
| 162 | 3300046457 | Ga0495590_0059591 | Ga0495590_0059591_61_1119 | 253 |
| 163 | 3300046499 | Ga0495594_0000011 | Ga0495594_0000011_95652_96536 | 253 |
| 164 | 3300046516 | Ga0495628_0005762 | Ga0495628_0005762_7119_8009 | 253 |
| 165 | 3300046543 | Ga0495645_0000984 | Ga0495645_0000984_13681_14559 | 253 |
| 166 | 3300046557 | Ga0495622_0000387 | Ga0495622_0000387_3985_4869 | 253 |
| 167 | 3300046642 | Ga0495634_0002062 | Ga0495634_0002062_12124_13008 | 253 |
| 168 | 3300046684 | Ga0495669_0000143 | Ga0495669_0000143_22648_23538 | 253 |
| 169 | 3300048903 | Ga0496100_0000013 | Ga0496100_0000013_154600_155490 | 253 |
| 170 | 3300048904 | Ga0496101_0000035 | Ga0496101_0000035_154600_155490 | 253 |
| 171 | 3300048909 | Ga0496106_0000062 | Ga0496106_0000062_63132_64022 | 253 |
| 172 | 3300048910 | Ga0496107_0000020 | Ga0496107_0000020_125749_126639 | 253 |
| 173 | 3300048913 | Ga0496110_0072907 | Ga0496110_0072907_1430_2320 | 253 |
| 174 | 3300049578 | Ga0501042_0121902 | Ga0501042_0121902_93_980 | 253 |
| 175 | 3300049591 | Ga0501075_0001206 | Ga0501075_0001206_9851_10741 | 253 |
| 176 | 3300050510 | nmdc:mga06r32_189999_c1 | nmdc:mga06r32_189999_c1_145_1200 | 253 |
| 177 | 3300053077 | Ga0495601_0216747 | Ga0495601_0216747_316_1194 | 253 |
| 178 | 3300005327 | Ga0070658_10118218 | Ga0070658_101182182 | 254 |
| 179 | 3300005335 | Ga0070666_10034430 | Ga0070666_100344302 | 254 |
| 180 | 3300005364 | Ga0070673_100013619 | Ga0070673_1000136191 | 254 |
| 181 | 3300009098 | Ga0105245_10006545 | Ga0105245_100065456 | 254 |
| 182 | 3300025903 | Ga0207680_10025822 | Ga0207680_100258224 | 254 |
| 183 | 3300025909 | Ga0207705_10064896 | Ga0207705_100648963 | 254 |
| 184 | 3300025926 | Ga0207659_10000553 | Ga0207659_100005535 | 254 |
| 185 | 3300025927 | Ga0207687_10000073 | Ga0207687_1000007330 | 254 |
| 186 | 3300025960 | Ga0207651_10006244 | Ga0207651_100062445 | 254 |
| 187 | 3300026075 | Ga0207708_10094449 | Ga0207708_100944492 | 254 |
| 188 | 3300045836 | Ga0466958_0043630 | Ga0466958_0043630_461_1351 | 254 |
| 189 | 3300046511 | Ga0495608_0006623 | Ga0495608_0006623_6381_7271 | 254 |
| 190 | 3300046515 | Ga0495620_0000211 | Ga0495620_0000211_19631_20518 | 254 |
| 191 | 3300046517 | Ga0495630_0000075 | Ga0495630_0000075_56324_57211 | 254 |
| 192 | 3300046517 | Ga0495630_0020574 | Ga0495630_0020574_2749_3639 | 254 |
| 193 | 3300046690 | Ga0495624_0000027 | Ga0495624_0000027_73745_74632 | 254 |
| 194 | 3300047317 | Ga0495604_0048237 | Ga0495604_0048237_868_1755 | 254 |
| 195 | 3300047472 | Ga0495686_0111825 | Ga0495686_0111825_615_1577 | 254 |
| 196 | 3300048922 | Ga0496119_0022693 | Ga0496119_0022693_2462_3439 | 254 |
| 197 | 3300053077 | Ga0495601_0000254 | Ga0495601_0000254_24532_25422 | 254 |
| 198 | 3300053078 | Ga0495612_0003936 | Ga0495612_0003936_1584_2471 | 254 |
| 199 | 3300053078 | Ga0495612_0050293 | Ga0495612_0050293_606_1493 | 254 |
| 200 | 3300053096 | Ga0500641_0003882 | Ga0500641_0003882_39_920 | 254 |
| 201 | 3300001979 | JGI24740J21852_10009389 | JGI24740J21852_100093894 | 255 |
| 202 | 3300003659 | JGI25404J52841_10000671 | JGI25404J52841_100006717 | 255 |
| 203 | 3300005339 | Ga0070660_100207538 | Ga0070660_1002075382 | 255 |
| 204 | 3300005341 | Ga0070691_10000021 | Ga0070691_1000002127 | 255 |
| 205 | 3300005548 | Ga0070665_100024849 | Ga0070665_1000248494 | 255 |
| 206 | 3300005563 | Ga0068855_100056955 | Ga0068855_1000569555 | 255 |
| 207 | 3300005577 | Ga0068857_100019320 | Ga0068857_1000193204 | 255 |
| 208 | 3300005616 | Ga0068852_100000056 | Ga0068852_10000005626 | 255 |
| 209 | 3300005983 | Ga0081540_1000041 | Ga0081540_100004181 | 255 |
| 210 | 3300006871 | Ga0075434_100253214 | Ga0075434_1002532142 | 255 |
| 211 | 3300009177 | Ga0105248_10000020 | Ga0105248_1000002026 | 255 |
| 212 | 3300013105 | Ga0157369_10000074 | Ga0157369_10000074124 | 255 |
| 213 | 3300013296 | Ga0157374_10134876 | Ga0157374_101348764 | 255 |
| 214 | 3300014326 | Ga0157380_10003677 | Ga0157380_100036774 | 255 |
| 215 | 3300025899 | Ga0207642_10061910 | Ga0207642_100619102 | 255 |
| 216 | 3300025916 | Ga0207663_10155492 | Ga0207663_101554922 | 255 |
| 217 | 3300025934 | Ga0207686_10000073 | Ga0207686_1000007387 | 255 |
| 218 | 3300025941 | Ga0207711_10000006 | Ga0207711_10000006349 | 255 |
| 219 | 3300026142 | Ga0207698_10000101 | Ga0207698_1000010126 | 255 |
| 220 | 3300028379 | Ga0268266_10007058 | Ga0268266_100070584 | 255 |
| 221 | 3300028563 | Ga0265319_1000105 | Ga0265319_100010526 | 255 |
| 222 | 3300028800 | Ga0265338_10000507 | Ga0265338_1000050749 | 255 |
| 223 | 3300029957 | Ga0265324_10045977 | Ga0265324_100459772 | 255 |
| 224 | 3300031241 | Ga0265325_10004756 | Ga0265325_100047563 | 255 |
| 225 | 3300031250 | Ga0265331_10010709 | Ga0265331_100107094 | 255 |
| 226 | 3300031456 | Ga0307513_10436096 | Ga0307513_104360961 | 255 |
| 227 | 3300031712 | Ga0265342_10210826 | Ga0265342_102108261 | 255 |
| 228 | 3300044842 | Ga0466957_0107876 | Ga0466957_0107876_202_1095 | 255 |
| 229 | 3300046459 | Ga0495629_0001073 | Ga0495629_0001073_6421_7308 | 255 |
| 230 | 3300046459 | Ga0495629_0009253 | Ga0495629_0009253_2877_3764 | 255 |
| 231 | 3300046461 | Ga0495641_0026462 | Ga0495641_0026462_802_1689 | 255 |
| 232 | 3300046461 | Ga0495641_0051589 | Ga0495641_0051589_589_1479 | 255 |
| 233 | 3300046516 | Ga0495628_0001027 | Ga0495628_0001027_4360_5247 | 255 |
| 234 | 3300046517 | Ga0495630_0062523 | Ga0495630_0062523_253_1140 | 255 |
| 235 | 3300046536 | Ga0495587_0046584 | Ga0495587_0046584_1662_2549 | 255 |
| 236 | 3300046674 | Ga0495588_0000187 | Ga0495588_0000187_20020_20907 | 255 |
| 237 | 3300046681 | Ga0495647_0003855 | Ga0495647_0003855_3202_4089 | 255 |
| 238 | 3300047321 | Ga0495676_0012335 | Ga0495676_0012335_1696_2583 | 255 |
| 239 | 3300048088 | Ga0495602_0000571 | Ga0495602_0000571_5671_6558 | 255 |
| 240 | 3300048903 | Ga0496100_0000001 | Ga0496100_0000001_510815_511702 | 255 |
| 241 | 3300048904 | Ga0496101_0000004 | Ga0496101_0000004_312167_313054 | 255 |
| 242 | 3300048905 | Ga0496102_0000522 | Ga0496102_0000522_19844_20731 | 255 |
| 243 | 3300048906 | Ga0496103_0000174 | Ga0496103_0000174_20311_21198 | 255 |
| 244 | 3300048909 | Ga0496106_0000414 | Ga0496106_0000414_10932_11819 | 255 |
| 245 | 3300048910 | Ga0496107_0000005 | Ga0496107_0000005_18546_19433 | 255 |
| 246 | 3300048913 | Ga0496110_0135373 | Ga0496110_0135373_655_1548 | 255 |
| 247 | 3300048917 | Ga0496114_0000039 | Ga0496114_0000039_114344_115231 | 255 |
| 248 | 3300048917 | Ga0496114_0231826 | Ga0496114_0231826_262_1149 | 255 |
| 249 | 3300048918 | Ga0496115_0000011 | Ga0496115_0000011_19705_20592 | 255 |
| 250 | 3300053083 | Ga0495655_0000002 | Ga0495655_0000002_290793_291680 | 255 |
| 251 | 3300053083 | Ga0495655_0000539 | Ga0495655_0000539_373_1257 | 255 |
| 252 | 3300053094 | Ga0500566_0000798 | Ga0500566_0000798_10584_11471 | 255 |
| 253 | 3300053129 | Ga0500628_000001 | Ga0500628_000001_379462_380349 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q2g-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) | 0.7646 | 15 | 254 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.7582 | 18 | 253 |
| 4q2g-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s223c, inactive mutant) | 0.7219 | 15 | 254 |
| 4q2e-assembly1.cif.gz_A | crystal structure of an intramembrane cdp-dag synthetase central for phospholipid biosynthesis (s200c/s258c, active mutant) | 0.707 | 18 | 253 |
| 5wuf-assembly1.cif.gz_A | structural basis for conductance through tric cation channels | 0.3132 | 47 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VHP1_6_149_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3916 | 118 | 253 | 1.10.1760.20 |
| af_Q2G0R7_343_485_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.3884 | 23 | 185 | 1.10.1760.20 |
| af_Q4DEW8_2_121_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.3867 | 125 | 252 | 1.10.3730.20 |
| af_E7F1E5_45_195_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3773 | 130 | 254 | 1.20.1070.10 |
| af_Q2G0R7_343_485_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.374 | 23 | 185 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A840IHW3-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8997 | 22 | 253 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A838PQU0-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) | 0.8978 | 24 | 252 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A6N7YLZ7-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8932 | 24 | 253 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A2W6BKX7-F1-model_v4 | Phosphatidate cytidylyltransferase (EC 2.7.7.41) (CDP-DAG synthase) (CDP-DG synthase) (CDP-diacylglycerol synthase) (CDP-diglyceride pyrophosphorylase) (CDP-diglyceride synthase) (CTP:phosphatidate cytidylyltransferase) | 0.8932 | 18 | 255 |
GO:0004605
GO:0005886 GO:0016024 |
| AF-A0A7V9VQ77-F1-model_v4 | deleted | 0.8878 | 24 | 242 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar