F363940

General Info

Members Datasets Scaffolds Average Seq Length
253 179 506 118

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10465161|Ga0075364_104651612
Length 143
Sequence MGGPIQGPLFHLAAGTKSAVLIVWSRNMAVKRVVANIASADPAQAAAFYGDILGMDIVMDHGWIVTYGGQGAALAQLSVASEGGSGTPVPDLSIEVDDLDAVLERLRHADIALEYGPAEEPWGVRRFYVRDPFGRLLNILAHT

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
40 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
41 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
57 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
58 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
79 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
80 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
95 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
100 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
101 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
104 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
105 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
106 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
109 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
163 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
164 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
178 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
179 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.97
Nodule 2.37
Rhizoplane 3.56
Rhizosphere 54.15
Stem 0
Stem Tuber 0
Unclassified 5.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10465161 3300006051 Bacteria 864
2 JGI24737J22298_10020725 3300001990 Bacteria 2097
3 JGI25154J39366_1001035 3300002738 Bacteria 11114
4 JGI25152J39213_1000829 3300002773 Bacteria 15367
5 JGI25150J39212_1000537 3300002774 Bacteria 15372
6 JGI25151J46595_10001067 3300003187 Bacteria 20456
7 JGI25153J46596_10003163 3300003215 Bacteria 9277
8 JGI25153J46596_10017558 3300003215 Bacteria 2814
9 Ga0055529_1003180 3300003763 Bacteria 2819
10 Ga0055526_1000361 3300003771 Bacteria 36774
11 Ga0055524_1001746 3300003775 Bacteria 12005
12 Ga0055524_1030647 3300003775 Bacteria 1564
13 Ga0055528_1000543 3300003790 Bacteria 28761
14 Ga0055528_1001746 3300003790 Bacteria 12547
15 Ga0055540_1013212 3300003792 Bacteria 2539
16 Ga0070668_100006879 3300005347 Bacteria 8429
17 Ga0070667_101761272 3300005367 Bacteria 583
18 Ga0070678_100024692 3300005456 Bacteria 4029
19 Ga0070699_100008887 3300005518 Bacteria 8701
20 Ga0070684_101369451 3300005535 Bacteria 666
21 Ga0070665_100475152 3300005548 Bacteria 1261
22 Ga0070664_101272758 3300005564 Bacteria 694
23 Ga0068856_100003754 3300005614 Bacteria 15227
24 Ga0068856_100255036 3300005614 Bacteria 1769
25 Ga0068856_100672328 3300005614 Bacteria 1056
26 Ga0068864_100654008 3300005618 Bacteria 1024
27 Ga0068860_100555886 3300005843 Bacteria 1150
28 Ga0068860_100816383 3300005843 Bacteria 946
29 Ga0081455_10005556 3300005937 Bacteria 13802
30 Ga0081539_10005457 3300005985 Bacteria 12970
31 Ga0075365_10040406 3300006038 Bacteria 3042
32 Ga0075365_10812294 3300006038 Unclassified 660
33 Ga0075365_11033661 3300006038 Bacteria 579
34 Ga0075368_10036014 3300006042 Bacteria 1933
35 Ga0075368_10259733 3300006042 Bacteria 743
36 Ga0075363_100099332 3300006048 Bacteria 1609
37 Ga0075367_10015613 3300006178 Bacteria 4133
38 Ga0075369_10001331 3300006186 Bacteria 8398
39 Ga0075366_10061817 3300006195 Bacteria 2226
40 Ga0075370_10009292 3300006353 Bacteria 5102
41 Ga0075428_100240272 3300006844 Bacteria 1954
42 Ga0075428_100970584 3300006844 Bacteria 900
43 Ga0075430_100130138 3300006846 Bacteria 2098
44 Ga0075430_100146600 3300006846 Bacteria 1966
45 Ga0075431_100012861 3300006847 Bacteria 8447
46 Ga0075431_100034611 3300006847 Bacteria 5204
47 Ga0075431_101987471 3300006847 Bacteria 537
48 Ga0075433_10908256 3300006852 Bacteria 768
49 Ga0075429_100124647 3300006880 Bacteria 2253
50 Ga0075436_100005429 3300006914 Bacteria 8770
51 Ga0097620_102455670 3300006931 Bacteria 574
52 Ga0099825_1033188 3300006941 Bacteria 2025
53 Ga0099824_1003225 3300006942 Bacteria 23847
54 Ga0099822_1005628 3300006943 Bacteria 16352
55 Ga0105251_10006281 3300009011 Bacteria 7606
56 Ga0105244_10000381 3300009036 Bacteria 41254
57 Ga0105250_10085892 3300009092 Bacteria 1277
58 Ga0114129_10101691 3300009147 Bacteria 3976
59 Ga0114129_10355179 3300009147 Bacteria 1940
60 Ga0105241_12397245 3300009174 Bacteria 527
61 Ga0105237_11210631 3300009545 Bacteria 762
62 Ga0157373_10059512 3300013100 Bacteria 2707
63 Ga0157373_10159102 3300013100 Bacteria 1589
64 Ga0157371_10000411 3300013102 Bacteria 52963
65 Ga0157371_10206280 3300013102 Bacteria 1410
66 Ga0157370_10000594 3300013104 Bacteria 45214
67 Ga0157370_10192248 3300013104 Bacteria 1894
68 Ga0157370_10420927 3300013104 Bacteria 1229
69 Ga0157369_10290491 3300013105 Bacteria 1702
70 Ga0157374_11697464 3300013296 Bacteria 656
71 Ga0163163_10355780 3300014325 Bacteria 1521
72 Ga0157379_10231400 3300014968 Bacteria 1675
73 Ga0182006_1098981 3300015261 Bacteria 1038
74 Ga0213876_10494614 3300021384 Bacteria 651
75 Ga0213875_10024242 3300021388 Bacteria 2895
76 Ga0207425_1000261 3300025245 Bacteria 38979
77 Ga0209646_1000365 3300025246 Bacteria 30280
78 Ga0209759_1001740 3300025256 Bacteria 11163
79 Ga0209129_1000328 3300025258 Bacteria 41383
80 Ga0209565_1026878 3300025263 Bacteria 1150
81 Ga0209455_1000455 3300025272 Bacteria 31156
82 Ga0209673_1000052 3300025273 Bacteria 279795
83 Ga0209675_1019032 3300025291 Bacteria 1902
84 Ga0209025_1001099 3300025294 Bacteria 38979
85 Ga0209564_1000795 3300025295 Bacteria 43436
86 Ga0209758_1000958 3300025297 Bacteria 38979
87 Ga0209758_1045999 3300025297 Bacteria 1579
88 Ga0209256_1000250 3300025299 Bacteria 95262
89 Ga0209256_1000279 3300025299 Bacteria 89712
90 Ga0209051_1001035 3300025303 Bacteria 26319
91 Ga0207655_1007534 3300025728 Bacteria 7048
92 Ga0207713_1020237 3300025735 Bacteria 3230
93 Ga0207706_10330311 3300025933 Bacteria 1327
94 Ga0207679_11068482 3300025945 Bacteria 740
95 Ga0207668_10045368 3300025972 Bacteria 2997
96 Ga0207702_10117966 3300026078 Bacteria 2370
97 Ga0207683_10014882 3300026121 Bacteria 6624
98 Ga0209589_1000006 3300027357 Bacteria 436292
99 Ga0209489_100007 3300027361 Bacteria 436292
100 Ga0209700_100008 3300027363 Bacteria 436292
101 Ga0209813_10027027 3300027866 Bacteria 1663
102 Ga0268266_10515023 3300028379 Bacteria 1143
103 Ga0268265_12287839 3300028380 Bacteria 547
104 Ga0268264_10150794 3300028381 Bacteria 2084
105 Ga0316576_10134114 3300031727 Bacteria 1864
106 Ga0307414_10222278 3300032004 Bacteria 1551
107 Ga0307414_10259432 3300032004 Unclassified 1449
108 Ga0373955_0466534 3300035172 Bacteria 770
109 Ga0373927_0343735 3300035695 Bacteria 983
110 Ga0373937_0008867 3300036401 Bacteria 8731
111 Ga0316584_0869187 3300036712 Unclassified 609
112 Ga0373925_0358531 3300037068 Unclassified 1185
113 Ga0395905_0000316 3300037471 Bacteria 69998
114 Ga0436364_0012650 3300037853 Bacteria 3986
115 Ga0436364_0973318 3300037853 Bacteria 2394
116 Ga0436364_1183970 3300037853 Bacteria 601
117 Ga0400483_006081 3300039062 Bacteria 1798
118 Ga0400483_022893 3300039062 Bacteria 1442
119 Ga0400483_053610 3300039062 Bacteria 14163
120 Ga0400483_086568 3300039062 Bacteria 1899
121 Ga0400483_186248 3300039062 Bacteria 4808
122 Ga0400483_279016 3300039062 Bacteria 45544
123 Ga0400487_07734 3300039110 Bacteria 3435
124 Ga0400487_59911 3300039110 Bacteria 17377
125 Ga0400487_60073 3300039110 Bacteria 2884
126 Ga0436365_1904382 3300039437 Bacteria 5990
127 Ga0436360_0541917 3300039438 Bacteria 2515
128 Ga0436363_0983049 3300039450 Unclassified 781
129 Ga0439438_173395 3300041405 Bacteria 513
130 Ga0439465_0011758 3300041413 Bacteria 2743
131 Ga0451837_1162081 3300041494 Unclassified 575
132 Ga0451853_0324131 3300041512 Bacteria 1335
133 Ga0439431_0121658 3300041997 Bacteria 728
134 Ga0439443_118855 3300042003 Bacteria 517
135 Ga0439445_0216314 3300042004 Bacteria 568
136 Ga0439432_008730 3300042006 Bacteria 3550
137 Ga0439432_086756 3300042006 Bacteria 944
138 Ga0439449_0046206 3300042007 Bacteria 1613
139 Ga0439452_000009 3300042010 Bacteria 569493
140 Ga0439462_0216329 3300042015 Bacteria 547
141 Ga0451576_0209123 3300045051 Bacteria 2038
142 Ga0495592_0115711 3300046454 Bacteria 1893
143 Ga0495638_0064753 3300046460 Bacteria 2251
144 Ga0495638_0226534 3300046460 Bacteria 1042
145 Ga0495653_0242035 3300046463 Bacteria 1202
146 Ga0495584_0005969 3300046491 Bacteria 6415
147 Ga0495608_0146217 3300046511 Bacteria 1508
148 Ga0495628_0362443 3300046516 Unclassified 1064
149 Ga0495632_0000894 3300046519 Bacteria 26185
150 Ga0495643_0070469 3300046522 Bacteria 1836
151 Ga0495652_0347196 3300046529 Unclassified 1064
152 Ga0495635_0575767 3300046663 Bacteria 737
153 Ga0495659_0167184 3300046664 Bacteria 891
154 Ga0495646_0460815 3300046680 Unclassified 656
155 Ga0495669_0160298 3300046684 Bacteria 1068
156 Ga0496100_0210108 3300048903 Bacteria 1423
157 Ga0496101_1075127 3300048904 Unclassified 632
158 Ga0496102_0132019 3300048905 Bacteria 2339
159 Ga0496105_0889061 3300048908 Bacteria 672
160 Ga0496106_0026343 3300048909 Bacteria 4329
161 Ga0496108_0159198 3300048911 Unclassified 1951
162 Ga0496109_0698182 3300048912 Bacteria 952
163 Ga0496112_0377522 3300048915 Bacteria 1359
164 Ga0496113_0009962 3300048916 Bacteria 6263
165 Ga0496116_0000518 3300048919 Bacteria 52094
166 Ga0496116_0035784 3300048919 Bacteria 3483
167 Ga0496116_0140819 3300048919 Bacteria 1357
168 Ga0496117_0006385 3300048920 Bacteria 11963
169 Ga0496117_0066026 3300048920 Bacteria 2456
170 Ga0496117_0300894 3300048920 Bacteria 849
171 Ga0496118_0000735 3300048921 Bacteria 52853
172 Ga0496118_0007132 3300048921 Bacteria 11982
173 Ga0496121_0002105 3300048924 Bacteria 31318
174 Ga0496121_0021817 3300048924 Bacteria 6253
175 Ga0496121_0184594 3300048924 Bacteria 1501
176 Ga0496121_0343533 3300048924 Unclassified 996
177 Ga0496121_0439669 3300048924 Bacteria 843
178 Ga0496121_0866169 3300048924 Unclassified 523
179 Ga0496122_0022692 3300048925 Bacteria 5570
180 Ga0496122_0082024 3300048925 Bacteria 2241
181 Ga0496122_0433092 3300048925 Bacteria 657
182 Ga0496123_0007005 3300048926 Bacteria 10751
183 Ga0496123_0012530 3300048926 Bacteria 7220
184 Ga0496123_0014930 3300048926 Bacteria 6403
185 Ga0496123_0073426 3300048926 Bacteria 2122
186 Ga0496124_0012089 3300048927 Bacteria 8567
187 Ga0496124_0027429 3300048927 Bacteria 5111
188 Ga0496124_0043118 3300048927 Bacteria 3879
189 Ga0496124_0102199 3300048927 Bacteria 2320
190 Ga0496124_0169859 3300048927 Bacteria 1690
191 Ga0496124_0447872 3300048927 Bacteria 881
192 Ga0496125_0289954 3300048928 Bacteria 1008
193 Ga0496126_0683424 3300048929 Bacteria 799
194 Ga0501031_0418702 3300049568 Bacteria 866
195 Ga0501031_1017289 3300049568 Bacteria 529
196 Ga0501032_0018514 3300049569 Bacteria 4878
197 Ga0501033_0363962 3300049570 Bacteria 1012
198 Ga0501034_0173096 3300049571 Bacteria 2125
199 Ga0501034_0228812 3300049571 Bacteria 1809
200 Ga0501034_0437179 3300049571 Bacteria 1227
201 Ga0501034_0555454 3300049571 Bacteria 1057
202 Ga0501034_0925795 3300049571 Bacteria 758
203 Ga0501036_0138893 3300049572 Bacteria 2051
204 Ga0501036_0154903 3300049572 Bacteria 1933
205 Ga0501037_0254485 3300049573 Bacteria 1228
206 Ga0501037_0442785 3300049573 Bacteria 887
207 Ga0501037_0451984 3300049573 Bacteria 876
208 Ga0501038_0032388 3300049574 Bacteria 4612
209 Ga0501038_0475509 3300049574 Bacteria 958
210 Ga0501039_0151188 3300049575 Bacteria 1824
211 Ga0501043_0063280 3300049579 Bacteria 2905
212 Ga0501043_0298006 3300049579 Bacteria 1233
213 Ga0501046_0000407 3300049580 Bacteria 42810
214 Ga0501046_0052161 3300049580 Bacteria 3224
215 Ga0501047_0000087 3300049581 Bacteria 117516
216 Ga0501047_0077036 3300049581 Bacteria 3209
217 Ga0501047_0281890 3300049581 Bacteria 1506
218 Ga0501048_0001772 3300049582 Bacteria 16430
219 Ga0501069_0621919 3300049585 Bacteria 649
220 Ga0501070_0604458 3300049586 Bacteria 874
221 Ga0501070_0964645 3300049586 Bacteria 662
222 Ga0501073_0328779 3300049589 Bacteria 1055
223 Ga0501074_0147550 3300049590 Bacteria 1682
224 Ga0501074_0601375 3300049590 Bacteria 778
225 Ga0501080_0834656 3300049742 Bacteria 806
226 Ga0501035_0384017 3300049822 Bacteria 1171
227 Ga0501035_0458124 3300049822 Bacteria 1054
228 Ga0501044_0120961 3300049823 Bacteria 2619
229 Ga0501044_0218661 3300049823 Bacteria 1856
230 Ga0501044_0664389 3300049823 Bacteria 930
231 Ga0501045_0142507 3300049824 Bacteria 1782
232 nmdc:mga03n38_165691_c1 3300050490 Bacteria 1122
233 nmdc:mga00v17_1063011_c1 3300050491 Bacteria 508
234 nmdc:mga00v17_330059_c1 3300050491 Bacteria 991
235 nmdc:mga0yw44_1737_c1 3300050492 Bacteria 8853
236 nmdc:mga0k408_20609_c1 3300050493 Bacteria 3696
237 nmdc:mga06z11_1752_c1 3300050494 Bacteria 8156
238 nmdc:mga04h51_226560_c1 3300050495 Bacteria 742
239 nmdc:mga04h51_32114_c1 3300050495 Bacteria 1663
240 nmdc:mga07m45_9425_c1 3300050496 Bacteria 5066
241 nmdc:mga05p37_263861_c1 3300050507 Bacteria 2060
242 nmdc:mga05p37_618909_c1 3300050507 Bacteria 1219
243 nmdc:mga09592_53583_c1 3300050508 Bacteria 3406
244 nmdc:mga0qj67_328299_c1 3300050509 Bacteria 1238
245 nmdc:mga06r32_28768_c1 3300050510 Bacteria 5203
246 nmdc:mga06r32_74284_c1 3300050510 Bacteria 3296
247 nmdc:mga08x19_369194_c1 3300050514 Bacteria 1004
248 nmdc:mga0a205_913896_c1 3300050515 Bacteria 724
249 nmdc:mga0sz30_42430_c1 3300050516 Bacteria 1914
250 Ga0500622_0100227 3300053156 Bacteria 1427
251 2929205334 2929199973 Bacteria 7260745
252 2961050067 2961047084 Bacteria 4594415
253 8055915868 8055909800 Bacteria 7278581
254 Ga0075364_10465161
255 JGI24737J22298_10020725
256 JGI25154J39366_1001035
257 JGI25152J39213_1000829
258 JGI25150J39212_1000537
259 JGI25151J46595_10001067
260 JGI25153J46596_10003163
261 JGI25153J46596_10017558
262 Ga0055529_1003180
263 Ga0055526_1000361
264 Ga0055524_1001746
265 Ga0055524_1030647
266 Ga0055528_1000543
267 Ga0055528_1001746
268 Ga0055540_1013212
269 Ga0070668_100006879
270 Ga0070667_101761272
271 Ga0070678_100024692
272 Ga0070699_100008887
273 Ga0070684_101369451
274 Ga0070665_100475152
275 Ga0070664_101272758
276 Ga0068856_100003754
277 Ga0068856_100255036
278 Ga0068856_100672328
279 Ga0068864_100654008
280 Ga0068860_100555886
281 Ga0068860_100816383
282 Ga0081455_10005556
283 Ga0081539_10005457
284 Ga0075365_10040406
285 Ga0075365_10812294
286 Ga0075365_11033661
287 Ga0075368_10036014
288 Ga0075368_10259733
289 Ga0075363_100099332
290 Ga0075367_10015613
291 Ga0075369_10001331
292 Ga0075366_10061817
293 Ga0075370_10009292
294 Ga0075428_100240272
295 Ga0075428_100970584
296 Ga0075430_100130138
297 Ga0075430_100146600
298 Ga0075431_100012861
299 Ga0075431_100034611
300 Ga0075431_101987471
301 Ga0075433_10908256
302 Ga0075429_100124647
303 Ga0075436_100005429
304 Ga0097620_102455670
305 Ga0099825_1033188
306 Ga0099824_1003225
307 Ga0099822_1005628
308 Ga0105251_10006281
309 Ga0105244_10000381
310 Ga0105250_10085892
311 Ga0114129_10101691
312 Ga0114129_10355179
313 Ga0105241_12397245
314 Ga0105237_11210631
315 Ga0157373_10059512
316 Ga0157373_10159102
317 Ga0157371_10000411
318 Ga0157371_10206280
319 Ga0157370_10000594
320 Ga0157370_10192248
321 Ga0157370_10420927
322 Ga0157369_10290491
323 Ga0157374_11697464
324 Ga0163163_10355780
325 Ga0157379_10231400
326 Ga0182006_1098981
327 Ga0213876_10494614
328 Ga0213875_10024242
329 Ga0207425_1000261
330 Ga0209646_1000365
331 Ga0209759_1001740
332 Ga0209129_1000328
333 Ga0209565_1026878
334 Ga0209455_1000455
335 Ga0209673_1000052
336 Ga0209675_1019032
337 Ga0209025_1001099
338 Ga0209564_1000795
339 Ga0209758_1000958
340 Ga0209758_1045999
341 Ga0209256_1000250
342 Ga0209256_1000279
343 Ga0209051_1001035
344 Ga0207655_1007534
345 Ga0207713_1020237
346 Ga0207706_10330311
347 Ga0207679_11068482
348 Ga0207668_10045368
349 Ga0207702_10117966
350 Ga0207683_10014882
351 Ga0209589_1000006
352 Ga0209489_100007
353 Ga0209700_100008
354 Ga0209813_10027027
355 Ga0268266_10515023
356 Ga0268265_12287839
357 Ga0268264_10150794
358 Ga0316576_10134114
359 Ga0307414_10222278
360 Ga0307414_10259432
361 Ga0373955_0466534
362 Ga0373927_0343735
363 Ga0373937_0008867
364 Ga0316584_0869187
365 Ga0373925_0358531
366 Ga0395905_0000316
367 Ga0436364_0012650
368 Ga0436364_0973318
369 Ga0436364_1183970
370 Ga0400483_006081
371 Ga0400483_022893
372 Ga0400483_053610
373 Ga0400483_086568
374 Ga0400483_186248
375 Ga0400483_279016
376 Ga0400487_07734
377 Ga0400487_59911
378 Ga0400487_60073
379 Ga0436365_1904382
380 Ga0436360_0541917
381 Ga0436363_0983049
382 Ga0439438_173395
383 Ga0439465_0011758
384 Ga0451837_1162081
385 Ga0451853_0324131
386 Ga0439431_0121658
387 Ga0439443_118855
388 Ga0439445_0216314
389 Ga0439432_008730
390 Ga0439432_086756
391 Ga0439449_0046206
392 Ga0439452_000009
393 Ga0439462_0216329
394 Ga0451576_0209123
395 Ga0495592_0115711
396 Ga0495638_0064753
397 Ga0495638_0226534
398 Ga0495653_0242035
399 Ga0495584_0005969
400 Ga0495608_0146217
401 Ga0495628_0362443
402 Ga0495632_0000894
403 Ga0495643_0070469
404 Ga0495652_0347196
405 Ga0495635_0575767
406 Ga0495659_0167184
407 Ga0495646_0460815
408 Ga0495669_0160298
409 Ga0496100_0210108
410 Ga0496101_1075127
411 Ga0496102_0132019
412 Ga0496105_0889061
413 Ga0496106_0026343
414 Ga0496108_0159198
415 Ga0496109_0698182
416 Ga0496112_0377522
417 Ga0496113_0009962
418 Ga0496116_0000518
419 Ga0496116_0035784
420 Ga0496116_0140819
421 Ga0496117_0006385
422 Ga0496117_0066026
423 Ga0496117_0300894
424 Ga0496118_0000735
425 Ga0496118_0007132
426 Ga0496121_0002105
427 Ga0496121_0021817
428 Ga0496121_0184594
429 Ga0496121_0343533
430 Ga0496121_0439669
431 Ga0496121_0866169
432 Ga0496122_0022692
433 Ga0496122_0082024
434 Ga0496122_0433092
435 Ga0496123_0007005
436 Ga0496123_0012530
437 Ga0496123_0014930
438 Ga0496123_0073426
439 Ga0496124_0012089
440 Ga0496124_0027429
441 Ga0496124_0043118
442 Ga0496124_0102199
443 Ga0496124_0169859
444 Ga0496124_0447872
445 Ga0496125_0289954
446 Ga0496126_0683424
447 Ga0501031_0418702
448 Ga0501031_1017289
449 Ga0501032_0018514
450 Ga0501033_0363962
451 Ga0501034_0173096
452 Ga0501034_0228812
453 Ga0501034_0437179
454 Ga0501034_0555454
455 Ga0501034_0925795
456 Ga0501036_0138893
457 Ga0501036_0154903
458 Ga0501037_0254485
459 Ga0501037_0442785
460 Ga0501037_0451984
461 Ga0501038_0032388
462 Ga0501038_0475509
463 Ga0501039_0151188
464 Ga0501043_0063280
465 Ga0501043_0298006
466 Ga0501046_0000407
467 Ga0501046_0052161
468 Ga0501047_0000087
469 Ga0501047_0077036
470 Ga0501047_0281890
471 Ga0501048_0001772
472 Ga0501069_0621919
473 Ga0501070_0604458
474 Ga0501070_0964645
475 Ga0501073_0328779
476 Ga0501074_0147550
477 Ga0501074_0601375
478 Ga0501080_0834656
479 Ga0501035_0384017
480 Ga0501035_0458124
481 Ga0501044_0120961
482 Ga0501044_0218661
483 Ga0501044_0664389
484 Ga0501045_0142507
485 nmdc:mga03n38_165691_c1
486 nmdc:mga00v17_1063011_c1
487 nmdc:mga00v17_330059_c1
488 nmdc:mga0yw44_1737_c1
489 nmdc:mga0k408_20609_c1
490 nmdc:mga06z11_1752_c1
491 nmdc:mga04h51_226560_c1
492 nmdc:mga04h51_32114_c1
493 nmdc:mga07m45_9425_c1
494 nmdc:mga05p37_263861_c1
495 nmdc:mga05p37_618909_c1
496 nmdc:mga09592_53583_c1
497 nmdc:mga0qj67_328299_c1
498 nmdc:mga06r32_28768_c1
499 nmdc:mga06r32_74284_c1
500 nmdc:mga08x19_369194_c1
501 nmdc:mga0a205_913896_c1
502 nmdc:mga0sz30_42430_c1
503 Ga0500622_0100227
504 2929205334
505 2961050067
506 8055915868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

30

139

0.89

PF12681

Glyoxalase_2

Glyoxalase-like domain

31

141

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.9689 2 114
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.9606 2 114
2ei1-assembly1.cif.gz_A anaerobic crystal structure analysis of the 1,2-dihydroxynaphthalene dioxygeanse of pseudomonas sp. strain c18 complexes to 1,2-dihydroxynaphthalene 0.8654 66 116
2ehz-assembly1.cif.gz_A anaerobic crystal structure analysis of 1,2-dihydroxynaphthalene dioxygenase from pseudomonas sp. strain c18 complexed with 4-methylcatechol 0.8599 66 116
3hpy-assembly1.cif.gz_B crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol 0.8243 66 117
ID Description Score Start End Superfamily
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9775 65 113 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9662 14 114 3.10.180.10
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9568 14 114 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9137 65 116 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8821 65 112 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6B3GEA4-F1-model_v4 Glyoxalase 1 61 115
AF-A0A1R4KEM8-F1-model_v4 VOC domain-containing protein 0.9929 66 117
AF-A0A7H8I5G5-F1-model_v4 deleted 0.9926 1 117
AF-A0A1H9R815-F1-model_v4 VOC domain-containing protein 0.9917 1 115
AF-A0A5C6CLU6-F1-model_v4 Glyoxalase-like domain protein 0.9892 1 116

Map