F363937

General Info

Members Datasets Scaffolds Average Seq Length
253 168 506 133

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10110859|Ga0075368_101108592
Length 137
Sequence VARRKLSHEGTLVLDCEGLSKLVSDHAPVVALVAEARKRGMETVISALTIIEAAHRRTDKARLAWILSGVRIAHIGDEEAKAASALLIDAGLHGHKYAIDAAVAEMALRQRRPVVLLTSDLDDMTKLCGDKVRLVAV

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
23 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
24 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
25 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
26 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
27 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
36 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
37 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
38 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
39 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
40 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
41 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
42 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
43 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
44 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
45 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
51 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
52 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
53 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
54 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
55 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
58 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
59 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
60 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
61 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
72 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
73 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
74 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
75 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
112 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
118 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
133 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
142 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
145 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
146 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
147 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
148 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
149 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
150 2643221548 Streptomyces sp. Root55 Isolate Unclassified
151 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
152 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
153 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
154 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
155 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
156 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
157 2891562705 Microbispora tritici MT50 Isolate Unclassified
158 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
159 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
160 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
161 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
162 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
163 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
164 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
165 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
166 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
167 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
168 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0
Isolates 9.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 0.4
Rhizosphere 77.08
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10110859 3300006042 Bacteria 1131
2 JGI24737J22298_10065926 3300001990 Bacteria 1085
3 JGI24738J21930_10011836 3300002075 Bacteria 1912
4 rootH1_10094182 3300003316 Bacteria 2830
5 rootL2_10214747 3300003322 Bacteria 1270
6 rootH1_10072261 3300003323 Bacteria 2729
7 Ga0070680_101633711 3300005336 Bacteria 558
8 Ga0070672_101060800 3300005543 Bacteria 719
9 Ga0068855_100819194 3300005563 Bacteria 988
10 Ga0068856_100362540 3300005614 Bacteria 1468
11 Ga0075368_10015363 3300006042 Bacteria 2840
12 Ga0075363_100643889 3300006048 Bacteria 637
13 Ga0075367_10000132 3300006178 Bacteria 22080
14 Ga0075367_10005726 3300006178 Bacteria 6208
15 Ga0105244_10146791 3300009036 Bacteria 1132
16 Ga0105243_11695277 3300009148 Bacteria 661
17 Ga0105035_106334 3300009988 Bacteria 978
18 Ga0105246_10000414 3300011119 Bacteria 22836
19 Ga0157372_10160481 3300013307 Bacteria 2598
20 Ga0207655_1202570 3300025728 Bacteria 591
21 Ga0207691_10977137 3300025940 Bacteria 707
22 Ga0207667_10734183 3300025949 Bacteria 988
23 Ga0207702_10785483 3300026078 Bacteria 941
24 Ga0209813_10065052 3300027866 Bacteria 1173
25 Ga0307515_10117606 3300028794 Bacteria 3041
26 Ga0307515_10416141 3300028794 Bacteria 966
27 Ga0307511_10142181 3300030521 Bacteria 1405
28 Ga0307512_10033773 3300030522 Bacteria 4391
29 Ga0265340_10010981 3300031247 Bacteria 4829
30 Ga0307513_10096938 3300031456 Bacteria 2985
31 Ga0307513_10205769 3300031456 Bacteria 1804
32 Ga0307509_10472827 3300031507 Bacteria 943
33 Ga0307508_10018878 3300031616 Bacteria 6265
34 Ga0307508_10077457 3300031616 Bacteria 2903
35 Ga0307508_10422764 3300031616 Bacteria 924
36 Ga0307514_10156757 3300031649 Bacteria 1516
37 Ga0307516_10075429 3300031730 Bacteria 3226
38 Ga0307516_10141576 3300031730 Bacteria 2174
39 Ga0307518_10035297 3300031838 Bacteria 3631
40 Ga0307518_10045518 3300031838 Bacteria 3190
41 Ga0307518_10096892 3300031838 Bacteria 2116
42 Ga0307518_10369293 3300031838 Bacteria 822
43 Ga0307406_11500580 3300031901 Bacteria 593
44 Ga0307407_10780491 3300031903 Bacteria 725
45 Ga0307409_100756194 3300031995 Bacteria 976
46 Ga0307416_100097612 3300032002 Bacteria 2545
47 Ga0307416_101164146 3300032002 Bacteria 876
48 Ga0307510_10007777 3300033180 Bacteria 12783
49 Ga0307510_10097184 3300033180 Bacteria 2757
50 Ga0307510_10364861 3300033180 Bacteria 892
51 Ga0439436_0001821 3300041404 Bacteria 6276
52 Ga0439436_0002007 3300041404 Bacteria 6045
53 Ga0439439_0170258 3300041406 Bacteria 624
54 Ga0451791_1027411 3300041451 Bacteria 1156
55 Ga0451839_0849130 3300041496 Bacteria 731
56 Ga0451853_0709450 3300041512 Bacteria 1966
57 Ga0451853_3419935 3300041512 Bacteria 3379
58 Ga0439431_0044508 3300041997 Bacteria 1138
59 Ga0439433_0000517 3300041999 Bacteria 7246
60 Ga0439442_005358 3300042002 Bacteria 2566
61 Ga0439448_0013897 3300042005 Bacteria 2424
62 Ga0439449_0009669 3300042007 Bacteria 3649
63 Ga0439449_0278656 3300042007 Bacteria 630
64 Ga0439457_000039 3300042014 Bacteria 27890
65 Ga0439457_000499 3300042014 Bacteria 11375
66 Ga0439462_0004741 3300042015 Bacteria 3332
67 Ga0450894_000643 3300042131 Bacteria 5856
68 Ga0450896_000474 3300042133 Bacteria 4162
69 Ga0450898_000547 3300042134 Bacteria 4425
70 Ga0450899_000864 3300042135 Bacteria 3458
71 Ga0450903_036677 3300042138 Bacteria 731
72 Ga0450910_021656 3300042147 Bacteria 974
73 Ga0466969_0115469 3300044656 Bacteria 1253
74 Ga0466966_0375180 3300044684 Bacteria 854
75 Ga0466961_0017116 3300044693 Bacteria 4656
76 Ga0466971_0029142 3300044719 Bacteria 2468
77 Ga0466968_0557984 3300044735 Unclassified 575
78 Ga0466957_1077257 3300044842 Bacteria 579
79 Ga0466959_0042722 3300045049 Bacteria 3343
80 Ga0466967_1339315 3300045976 Bacteria 713
81 Ga0495617_058593 3300046452 Bacteria 1276
82 Ga0495617_073519 3300046452 Bacteria 1123
83 Ga0495592_0019156 3300046454 Bacteria 5208
84 Ga0495592_0136614 3300046454 Bacteria 1709
85 Ga0495603_0080683 3300046455 Bacteria 1906
86 Ga0495603_0140186 3300046455 Bacteria 1407
87 Ga0495590_0252114 3300046457 Bacteria 657
88 Ga0495638_0017841 3300046460 Bacteria 4724
89 Ga0495638_0387471 3300046460 Bacteria 728
90 Ga0495651_0051255 3300046462 Bacteria 3183
91 Ga0495605_0002197 3300046474 Bacteria 12185
92 Ga0495662_0216077 3300046476 Bacteria 945
93 Ga0495664_0327959 3300046477 Bacteria 923
94 Ga0495585_0006560 3300046492 Bacteria 7198
95 Ga0495585_0011608 3300046492 Bacteria 5209
96 Ga0495585_0044363 3300046492 Bacteria 2484
97 Ga0495585_0112771 3300046492 Bacteria 1444
98 Ga0495594_0167168 3300046499 Bacteria 1251
99 Ga0495594_0242920 3300046499 Bacteria 1026
100 Ga0495596_0314536 3300046500 Bacteria 609
101 Ga0495607_0087163 3300046501 Bacteria 1700
102 Ga0495583_0003545 3300046506 Bacteria 11779
103 Ga0495583_0007642 3300046506 Bacteria 6742
104 Ga0495583_0070391 3300046506 Bacteria 1538
105 Ga0495583_0212112 3300046506 Bacteria 784
106 Ga0495606_0002627 3300046507 Bacteria 20492
107 Ga0495608_0116229 3300046511 Bacteria 1717
108 Ga0495610_0046695 3300046512 Bacteria 2135
109 Ga0495616_0022721 3300046513 Bacteria 3383
110 Ga0495618_0028048 3300046514 Bacteria 3508
111 Ga0495618_0207219 3300046514 Bacteria 1240
112 Ga0495620_0013396 3300046515 Bacteria 4198
113 Ga0495628_0042008 3300046516 Bacteria 3648
114 Ga0495631_0001549 3300046518 Bacteria 13832
115 Ga0495631_0259675 3300046518 Bacteria 740
116 Ga0495652_0056791 3300046529 Bacteria 3323
117 Ga0495652_0174218 3300046529 Bacteria 1657
118 Ga0495652_0716056 3300046529 Bacteria 672
119 Ga0495640_0052271 3300046533 Bacteria 2806
120 Ga0495640_0537258 3300046533 Bacteria 709
121 Ga0495640_0780435 3300046533 Bacteria 570
122 Ga0495609_0015407 3300046538 Bacteria 3578
123 Ga0495597_0002908 3300046542 Bacteria 10409
124 Ga0495597_0021806 3300046542 Bacteria 2976
125 Ga0495645_0008215 3300046543 Bacteria 7280
126 Ga0495633_0181631 3300046558 Bacteria 968
127 Ga0495668_0003044 3300046616 Bacteria 13030
128 Ga0495634_0035762 3300046642 Bacteria 3399
129 Ga0495634_0088266 3300046642 Bacteria 2017
130 Ga0495611_0006108 3300046648 Bacteria 5139
131 Ga0495611_0015177 3300046648 Bacteria 3293
132 Ga0495611_0038225 3300046648 Bacteria 2134
133 Ga0495611_0064207 3300046648 Bacteria 1671
134 Ga0495625_0003273 3300046660 Bacteria 16369
135 Ga0495625_0027976 3300046660 Bacteria 4233
136 Ga0495625_0124352 3300046660 Bacteria 1752
137 Ga0495635_0601719 3300046663 Bacteria 718
138 Ga0495661_0197821 3300046665 Bacteria 1054
139 Ga0495661_0279490 3300046665 Bacteria 842
140 Ga0495657_0017514 3300046675 Bacteria 5199
141 Ga0495657_0107195 3300046675 Bacteria 1773
142 Ga0495657_0334294 3300046675 Bacteria 898
143 Ga0495657_0633996 3300046675 Bacteria 617
144 Ga0495623_0393144 3300046679 Bacteria 747
145 Ga0495647_0516242 3300046681 Bacteria 557
146 Ga0495613_0018856 3300046689 Bacteria 5140
147 Ga0495613_0232667 3300046689 Bacteria 1290
148 Ga0495624_0072683 3300046690 Bacteria 2139
149 Ga0495671_0168163 3300046692 Bacteria 1066
150 Ga0495671_0431561 3300046692 Bacteria 630
151 Ga0495649_0022453 3300046694 Bacteria 3531
152 Ga0495649_0050406 3300046694 Bacteria 2259
153 Ga0495649_0054547 3300046694 Bacteria 2161
154 Ga0495589_0003785 3300046794 Bacteria 8142
155 Ga0495600_0066459 3300046809 Bacteria 2357
156 Ga0495600_0131056 3300046809 Bacteria 1630
157 Ga0495660_0001320 3300046810 Bacteria 17108
158 Ga0495660_0006665 3300046810 Bacteria 6819
159 Ga0495660_0042842 3300046810 Bacteria 2499
160 Ga0495660_0140289 3300046810 Bacteria 1203
161 Ga0495604_0048566 3300047317 Bacteria 3301
162 Ga0495604_0244402 3300047317 Bacteria 1226
163 Ga0495604_0454311 3300047317 Bacteria 836
164 Ga0495676_0150872 3300047321 Bacteria 1654
165 Ga0495676_0273995 3300047321 Bacteria 1144
166 Ga0495676_0691840 3300047321 Bacteria 660
167 Ga0495680_0038028 3300047322 Bacteria 3850
168 Ga0495683_0000850 3300047323 Bacteria 21655
169 Ga0495683_0002621 3300047323 Bacteria 10757
170 Ga0495683_0157510 3300047323 Bacteria 1052
171 Ga0495683_0267499 3300047323 Bacteria 744
172 Ga0495687_008122 3300047443 Bacteria 6058
173 Ga0495687_012516 3300047443 Bacteria 4479
174 Ga0495687_023992 3300047443 Bacteria 2906
175 Ga0495687_036676 3300047443 Bacteria 2191
176 Ga0495687_105168 3300047443 Bacteria 1050
177 Ga0495675_0089384 3300047444 Bacteria 1934
178 Ga0495675_0433276 3300047444 Bacteria 763
179 Ga0495675_0538177 3300047444 Bacteria 667
180 Ga0495685_007265 3300047447 Bacteria 3654
181 Ga0495685_020839 3300047447 Bacteria 2254
182 Ga0495685_089327 3300047447 Bacteria 1022
183 Ga0495684_0409984 3300047471 Bacteria 949
184 Ga0495686_0084656 3300047472 Bacteria 1932
185 Ga0495593_0146991 3300047673 Bacteria 1193
186 Ga0495593_0321224 3300047673 Bacteria 774
187 Ga0495626_0003718 3300048091 Bacteria 9637
188 Ga0501031_0002860 3300049568 Bacteria 11025
189 Ga0501032_0115599 3300049569 Bacteria 1774
190 Ga0501033_0067273 3300049570 Bacteria 2634
191 Ga0501034_0010434 3300049571 Bacteria 9676
192 Ga0501034_0501110 3300049571 Bacteria 1128
193 Ga0501037_0937325 3300049573 Bacteria 566
194 Ga0501038_0113152 3300049574 Bacteria 2246
195 Ga0501039_0047617 3300049575 Bacteria 3314
196 Ga0501042_0155171 3300049578 Bacteria 1651
197 Ga0501042_0241211 3300049578 Bacteria 1304
198 Ga0501043_0045362 3300049579 Bacteria 3457
199 Ga0501046_0775951 3300049580 Bacteria 672
200 Ga0501047_0000093 3300049581 Bacteria 110613
201 Ga0501047_0006109 3300049581 Bacteria 11317
202 Ga0501047_0059487 3300049581 Bacteria 3688
203 Ga0501047_0132453 3300049581 Bacteria 2373
204 Ga0501047_0235856 3300049581 Bacteria 1681
205 Ga0501070_1050495 3300049586 Bacteria 630
206 Ga0501073_0654748 3300049589 Bacteria 725
207 Ga0501250_025339 3300049680 Bacteria 795
208 Ga0501035_0065306 3300049822 Bacteria 3232
209 Ga0501035_0480679 3300049822 Bacteria 1024
210 Ga0501035_0786884 3300049822 Bacteria 761
211 Ga0501044_0094290 3300049823 Bacteria 3018
212 Ga0501044_0268630 3300049823 Bacteria 1642
213 Ga0501044_0270335 3300049823 Bacteria 1636
214 Ga0501044_0391994 3300049823 Bacteria 1302
215 Ga0501045_0197064 3300049824 Bacteria 1501
216 nmdc:mga06z11_453_c1 3300050494 Bacteria 15257
217 nmdc:mga06z11_5637_c1 3300050494 Bacteria 5041
218 nmdc:mga04h51_156008_c1 3300050495 Bacteria 875
219 Ga0500644_0006901 3300053088 Bacteria 2930
220 Ga0500583_0347897 3300053092 Bacteria 719
221 Ga0500566_0086657 3300053094 Bacteria 1735
222 Ga0500558_124859 3300053106 Bacteria 991
223 Ga0500560_072960 3300053107 Bacteria 1133
224 Ga0500573_0115265 3300053140 Bacteria 1500
225 Ga0500579_120447 3300053143 Bacteria 1275
226 Ga0500600_0157892 3300053149 Bacteria 1119
227 Ga0500600_0220897 3300053149 Bacteria 874
228 Ga0500634_0264770 3300053161 Bacteria 704
229 Ga0590075_075383 3300059424 Bacteria 872
230 Ga0466962_0027260 3300061719 Bacteria 2742
231 2616902225 2616644941 Bacteria 8510691
232 2643763007 2643221548 Bacteria 8053412
233 2644464135 2643221682 Bacteria 6743283
234 2819694550 2818991463 Bacteria 7948711
235 2819739347 2818991472 Bacteria 10089953
236 2852636674 2852635781 Bacteria 8251373
237 2852637099 2852635781 Bacteria 8251373
238 2856744812 2856741275 Bacteria 8096094
239 2884696098 2884693830 Bacteria 11273186
240 2891564580 2891562705 Bacteria 8039471
241 2895449468 2895442618 Bacteria 11027144
242 2935392834 2935390628 Bacteria 7043367
243 2954006683 2954002825 Bacteria 9173742
244 2954006793 2954002825 Bacteria 9173742
245 2966600790 2966598605 Bacteria 7676064
246 2990062019 2990059506 Bacteria 9321252
247 3006323765 3006321560 Bacteria 8247479
248 3006500166 3006493962 Bacteria 8825450
249 8008486039 8008485437 Bacteria 7198341
250 8025525355 8025524527 Bacteria 7197316
251 8048136629 8048127548 Bacteria 11053136
252 8048409348 8048406513 Bacteria 8936924
253 8048413302 8048406513 Bacteria 8936924
254 Ga0075368_10110859
255 JGI24737J22298_10065926
256 JGI24738J21930_10011836
257 rootH1_10094182
258 rootL2_10214747
259 rootH1_10072261
260 Ga0070680_101633711
261 Ga0070672_101060800
262 Ga0068855_100819194
263 Ga0068856_100362540
264 Ga0075368_10015363
265 Ga0075363_100643889
266 Ga0075367_10000132
267 Ga0075367_10005726
268 Ga0105244_10146791
269 Ga0105243_11695277
270 Ga0105035_106334
271 Ga0105246_10000414
272 Ga0157372_10160481
273 Ga0207655_1202570
274 Ga0207691_10977137
275 Ga0207667_10734183
276 Ga0207702_10785483
277 Ga0209813_10065052
278 Ga0307515_10117606
279 Ga0307515_10416141
280 Ga0307511_10142181
281 Ga0307512_10033773
282 Ga0265340_10010981
283 Ga0307513_10096938
284 Ga0307513_10205769
285 Ga0307509_10472827
286 Ga0307508_10018878
287 Ga0307508_10077457
288 Ga0307508_10422764
289 Ga0307514_10156757
290 Ga0307516_10075429
291 Ga0307516_10141576
292 Ga0307518_10035297
293 Ga0307518_10045518
294 Ga0307518_10096892
295 Ga0307518_10369293
296 Ga0307406_11500580
297 Ga0307407_10780491
298 Ga0307409_100756194
299 Ga0307416_100097612
300 Ga0307416_101164146
301 Ga0307510_10007777
302 Ga0307510_10097184
303 Ga0307510_10364861
304 Ga0439436_0001821
305 Ga0439436_0002007
306 Ga0439439_0170258
307 Ga0451791_1027411
308 Ga0451839_0849130
309 Ga0451853_0709450
310 Ga0451853_3419935
311 Ga0439431_0044508
312 Ga0439433_0000517
313 Ga0439442_005358
314 Ga0439448_0013897
315 Ga0439449_0009669
316 Ga0439449_0278656
317 Ga0439457_000039
318 Ga0439457_000499
319 Ga0439462_0004741
320 Ga0450894_000643
321 Ga0450896_000474
322 Ga0450898_000547
323 Ga0450899_000864
324 Ga0450903_036677
325 Ga0450910_021656
326 Ga0466969_0115469
327 Ga0466966_0375180
328 Ga0466961_0017116
329 Ga0466971_0029142
330 Ga0466968_0557984
331 Ga0466957_1077257
332 Ga0466959_0042722
333 Ga0466967_1339315
334 Ga0495617_058593
335 Ga0495617_073519
336 Ga0495592_0019156
337 Ga0495592_0136614
338 Ga0495603_0080683
339 Ga0495603_0140186
340 Ga0495590_0252114
341 Ga0495638_0017841
342 Ga0495638_0387471
343 Ga0495651_0051255
344 Ga0495605_0002197
345 Ga0495662_0216077
346 Ga0495664_0327959
347 Ga0495585_0006560
348 Ga0495585_0011608
349 Ga0495585_0044363
350 Ga0495585_0112771
351 Ga0495594_0167168
352 Ga0495594_0242920
353 Ga0495596_0314536
354 Ga0495607_0087163
355 Ga0495583_0003545
356 Ga0495583_0007642
357 Ga0495583_0070391
358 Ga0495583_0212112
359 Ga0495606_0002627
360 Ga0495608_0116229
361 Ga0495610_0046695
362 Ga0495616_0022721
363 Ga0495618_0028048
364 Ga0495618_0207219
365 Ga0495620_0013396
366 Ga0495628_0042008
367 Ga0495631_0001549
368 Ga0495631_0259675
369 Ga0495652_0056791
370 Ga0495652_0174218
371 Ga0495652_0716056
372 Ga0495640_0052271
373 Ga0495640_0537258
374 Ga0495640_0780435
375 Ga0495609_0015407
376 Ga0495597_0002908
377 Ga0495597_0021806
378 Ga0495645_0008215
379 Ga0495633_0181631
380 Ga0495668_0003044
381 Ga0495634_0035762
382 Ga0495634_0088266
383 Ga0495611_0006108
384 Ga0495611_0015177
385 Ga0495611_0038225
386 Ga0495611_0064207
387 Ga0495625_0003273
388 Ga0495625_0027976
389 Ga0495625_0124352
390 Ga0495635_0601719
391 Ga0495661_0197821
392 Ga0495661_0279490
393 Ga0495657_0017514
394 Ga0495657_0107195
395 Ga0495657_0334294
396 Ga0495657_0633996
397 Ga0495623_0393144
398 Ga0495647_0516242
399 Ga0495613_0018856
400 Ga0495613_0232667
401 Ga0495624_0072683
402 Ga0495671_0168163
403 Ga0495671_0431561
404 Ga0495649_0022453
405 Ga0495649_0050406
406 Ga0495649_0054547
407 Ga0495589_0003785
408 Ga0495600_0066459
409 Ga0495600_0131056
410 Ga0495660_0001320
411 Ga0495660_0006665
412 Ga0495660_0042842
413 Ga0495660_0140289
414 Ga0495604_0048566
415 Ga0495604_0244402
416 Ga0495604_0454311
417 Ga0495676_0150872
418 Ga0495676_0273995
419 Ga0495676_0691840
420 Ga0495680_0038028
421 Ga0495683_0000850
422 Ga0495683_0002621
423 Ga0495683_0157510
424 Ga0495683_0267499
425 Ga0495687_008122
426 Ga0495687_012516
427 Ga0495687_023992
428 Ga0495687_036676
429 Ga0495687_105168
430 Ga0495675_0089384
431 Ga0495675_0433276
432 Ga0495675_0538177
433 Ga0495685_007265
434 Ga0495685_020839
435 Ga0495685_089327
436 Ga0495684_0409984
437 Ga0495686_0084656
438 Ga0495593_0146991
439 Ga0495593_0321224
440 Ga0495626_0003718
441 Ga0501031_0002860
442 Ga0501032_0115599
443 Ga0501033_0067273
444 Ga0501034_0010434
445 Ga0501034_0501110
446 Ga0501037_0937325
447 Ga0501038_0113152
448 Ga0501039_0047617
449 Ga0501042_0155171
450 Ga0501042_0241211
451 Ga0501043_0045362
452 Ga0501046_0775951
453 Ga0501047_0000093
454 Ga0501047_0006109
455 Ga0501047_0059487
456 Ga0501047_0132453
457 Ga0501047_0235856
458 Ga0501070_1050495
459 Ga0501073_0654748
460 Ga0501250_025339
461 Ga0501035_0065306
462 Ga0501035_0480679
463 Ga0501035_0786884
464 Ga0501044_0094290
465 Ga0501044_0268630
466 Ga0501044_0270335
467 Ga0501044_0391994
468 Ga0501045_0197064
469 nmdc:mga06z11_453_c1
470 nmdc:mga06z11_5637_c1
471 nmdc:mga04h51_156008_c1
472 Ga0500644_0006901
473 Ga0500583_0347897
474 Ga0500566_0086657
475 Ga0500558_124859
476 Ga0500560_072960
477 Ga0500573_0115265
478 Ga0500579_120447
479 Ga0500600_0157892
480 Ga0500600_0220897
481 Ga0500634_0264770
482 Ga0590075_075383
483 Ga0466962_0027260
484 2616902225
485 2643763007
486 2644464135
487 2819694550
488 2819739347
489 2852636674
490 2852637099
491 2856744812
492 2884696098
493 2891564580
494 2895449468
495 2935392834
496 2954006683
497 2954006793
498 2966600790
499 2990062019
500 3006323765
501 3006500166
502 8008486039
503 8025525355
504 8048136629
505 8048409348
506 8048413302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5k8j-assembly1.cif.gz_B structure of caulobacter crescentus vapbc1 (apo form) 0.7949 5 130
5k8j-assembly1.cif.gz_B structure of caulobacter crescentus vapbc1 (apo form) 0.7837 5 130
3zvk-assembly1.cif.gz_B crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7653 4 130
7by2-assembly1.cif.gz_B-2 toxin-antitoxin complex from klebsiella pneumoniae 0.7568 5 125
3zvk-assembly1.cif.gz_D crystal structure of vapbc2 from rickettsia felis bound to a dna fragment from their promoter 0.7476 4 129
ID Description Score Start End Superfamily
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8515 6 119 3.40.50.1010
af_P9WFA7_1_124_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8017 5 100 3.40.50.1010
5k8jC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7972 5 130 3.40.50.1010
af_P9WF93_1_123_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7884 6 119 3.40.50.1010
5k8jC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7857 5 130 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A171C7F8-F1-model_v4 DNA-binding protein 0.9848 1 130 GO:0003677
AF-A0A0M8R2R1-F1-model_v4 deleted 0.9835 13 130
AF-A0A2L0NEJ1-F1-model_v4 DNA-binding protein 0.9833 3 130 GO:0003677
AF-A0A6I6F8H7-F1-model_v4 PIN domain-containing protein 0.9831 53 130 GO:0004518
AF-A0A7W7WFH3-F1-model_v4 DNA-binding protein 0.9828 7 130

Map