F363890

General Info

Members Datasets Scaffolds Average Seq Length
253 147 506 396

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100000677|Ga0068853_10000067710
Length 435
Sequence MGNRRSASYTAAVLDIRLIREQPDEVRAGFQRLGAVVDFDAVLALDTRVRDLKNDSQSLQAEQNRMSKEIGRAAPGEAREQAKAQSAALKTKIEALAADLXXAEAALDNRLLELPNLPHPSVPTGKDDSENRVIREEGTRRAFDFAPQPHWDLGTKLGIIDFERGVKISGSRFYVLKSWGARLQRALITYMLDLHTLKHGYTEIYPPYMVKRECLVGTGNLPKFGENLYHDAEEDFWWVPTAEVPVTNLYRDEIVPEASLPIRHVAFTACFRREQMAAGRDTRGIKRGHQFDKVELVKFVHPDTSMDELPKLLADAEDVLKGLGLPYRVVQMCTGDLSFSAMAKFDLELWAPGQNEWLEVSSCSNFGDFQARRARIRFKEGGDKGKNRFVHTLNGSGLALPRTLIGVLETYQRADGRIDVPAALRPYLGGAEVLG

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
67 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
94 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
95 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
96 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
119 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.14
Rhizosphere 93.28
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100000677 3300005539 Bacteria 23465
2 Ga0070658_10018193 3300005327 Bacteria 5622
3 Ga0070676_10015924 3300005328 Bacteria 4149
4 Ga0070683_100030570 3300005329 Bacteria 4890
5 Ga0070690_100004384 3300005330 Bacteria 7830
6 Ga0070680_100028332 3300005336 Bacteria 4491
7 Ga0070680_100035355 3300005336 Bacteria 4032
8 Ga0070680_100077356 3300005336 Bacteria 2741
9 Ga0068868_100052127 3300005338 Bacteria 3221
10 Ga0070689_100000013 3300005340 Bacteria 206982
11 Ga0070687_100001293 3300005343 Bacteria 8731
12 Ga0070675_100098290 3300005354 Bacteria 2462
13 Ga0070673_100018406 3300005364 Bacteria 4988
14 Ga0070673_100048722 3300005364 Bacteria 3305
15 Ga0070688_100035451 3300005365 Bacteria 3031
16 Ga0070710_10008280 3300005437 Bacteria 5062
17 Ga0070705_100031218 3300005440 Bacteria 2948
18 Ga0070681_10007942 3300005458 Bacteria 10384
19 Ga0070681_10236244 3300005458 Bacteria 1742
20 Ga0068867_100042826 3300005459 Bacteria 3313
21 Ga0070699_100211452 3300005518 Bacteria 1727
22 Ga0070679_100001992 3300005530 Bacteria 18343
23 Ga0070679_100044540 3300005530 Bacteria 4420
24 Ga0070679_100055884 3300005530 Bacteria 3932
25 Ga0070684_100002029 3300005535 Bacteria 14898
26 Ga0070684_100175492 3300005535 Bacteria 1947
27 Ga0068853_100179248 3300005539 Bacteria 1921
28 Ga0070672_100105732 3300005543 Bacteria 2289
29 Ga0068855_100136164 3300005563 Bacteria 2802
30 Ga0068856_100109991 3300005614 Bacteria 2752
31 Ga0068856_100176835 3300005614 Bacteria 2147
32 Ga0068859_100061131 3300005617 Bacteria 3795
33 Ga0068861_100112710 3300005719 Bacteria 2181
34 Ga0068858_100290074 3300005842 Bacteria 1559
35 Ga0068860_100195669 3300005843 Bacteria 1958
36 Ga0068862_100075656 3300005844 Bacteria 2912
37 Ga0070715_10060006 3300006163 Bacteria 1666
38 Ga0075428_100282237 3300006844 Bacteria 1787
39 Ga0068865_100006563 3300006881 Bacteria 7111
40 Ga0097620_100061137 3300006931 Bacteria 3795
41 Ga0114129_10243532 3300009147 Bacteria 2417
42 Ga0105237_10000025 3300009545 Bacteria 215920
43 Ga0105237_10094999 3300009545 Bacteria 2970
44 Ga0105238_10004468 3300009551 Bacteria 13861
45 Ga0105249_10121468 3300009553 Bacteria 2483
46 Ga0105239_10168583 3300010375 Bacteria 2448
47 Ga0157378_10037855 3300013297 Bacteria 4274
48 Ga0157379_10001515 3300014968 Bacteria 19126
49 Ga0207699_10090815 3300025906 Bacteria 1917
50 Ga0207645_10006589 3300025907 Bacteria 8304
51 Ga0207684_10101625 3300025910 Bacteria 2458
52 Ga0207684_10140593 3300025910 Bacteria 2075
53 Ga0207671_10000075 3300025914 Bacteria 153167
54 Ga0207671_10053003 3300025914 Bacteria 3006
55 Ga0207693_10151035 3300025915 Bacteria 1827
56 Ga0207660_10024103 3300025917 Bacteria 4116
57 Ga0207660_10036414 3300025917 Bacteria 3421
58 Ga0207652_10003596 3300025921 Bacteria 12772
59 Ga0207652_10009986 3300025921 Bacteria 7643
60 Ga0207652_10019418 3300025921 Bacteria 5590
61 Ga0207652_10319169 3300025921 Bacteria 1402
62 Ga0207681_10008078 3300025923 Bacteria 6438
63 Ga0207694_10004647 3300025924 Bacteria 10688
64 Ga0207694_10011597 3300025924 Bacteria 6651
65 Ga0207650_10196552 3300025925 Bacteria 1614
66 Ga0207659_10163179 3300025926 Bacteria 1751
67 Ga0207670_10000004 3300025936 Bacteria 707262
68 Ga0207670_10016657 3300025936 Bacteria 4423
69 Ga0207670_10136246 3300025936 Bacteria 1805
70 Ga0207691_10013855 3300025940 Bacteria 7698
71 Ga0207691_10119520 3300025940 Bacteria 2337
72 Ga0207661_10000570 3300025944 Bacteria 23531
73 Ga0207667_10082236 3300025949 Bacteria 3336
74 Ga0207651_10003254 3300025960 Bacteria 7952
75 Ga0207651_10023506 3300025960 Bacteria 3793
76 Ga0207668_10199100 3300025972 Bacteria 1593
77 Ga0207658_10086744 3300025986 Bacteria 2415
78 Ga0207639_10004128 3300026041 Bacteria 9785
79 Ga0207639_10103128 3300026041 Bacteria 2310
80 Ga0207708_10001208 3300026075 Bacteria 19489
81 Ga0207702_10165432 3300026078 Bacteria 2023
82 Ga0207641_10065038 3300026088 Bacteria 3119
83 Ga0207648_10007750 3300026089 Bacteria 10488
84 Ga0207674_10048816 3300026116 Bacteria 4330
85 Ga0207675_100186554 3300026118 Bacteria 1988
86 Ga0207698_10012093 3300026142 Bacteria 5631
87 Ga0268265_10279672 3300028380 Bacteria 1493
88 Ga0265337_1005930 3300028556 Bacteria 4782
89 Ga0265319_1012089 3300028563 Bacteria 3502
90 Ga0265334_10007845 3300028573 Bacteria 4566
91 Ga0265318_10000486 3300028577 Bacteria 29307
92 Ga0265318_10001218 3300028577 Bacteria 15644
93 Ga0265323_10006340 3300028653 Bacteria 4973
94 Ga0265323_10006836 3300028653 Bacteria 4772
95 Ga0265323_10014719 3300028653 Bacteria 3087
96 Ga0265323_10042000 3300028653 Bacteria 1657
97 Ga0265322_10003257 3300028654 Bacteria 4927
98 Ga0265322_10021639 3300028654 Unclassified 1841
99 Ga0265336_10006992 3300028666 Bacteria 4037
100 Ga0265338_10014804 3300028800 Bacteria 8632
101 Ga0265338_10019288 3300028800 Bacteria 7248
102 Ga0265338_10028725 3300028800 Bacteria 5539
103 Ga0265338_10104439 3300028800 Bacteria 2299
104 Ga0265324_10000079 3300029957 Bacteria 75663
105 Ga0265330_10000414 3300031235 Bacteria 29282
106 Ga0265330_10001118 3300031235 Bacteria 16145
107 Ga0265330_10001523 3300031235 Bacteria 13365
108 Ga0265330_10001713 3300031235 Bacteria 12376
109 Ga0265330_10002772 3300031235 Bacteria 9404
110 Ga0265330_10003818 3300031235 Bacteria 7763
111 Ga0265330_10009838 3300031235 Bacteria 4525
112 Ga0265330_10036425 3300031235 Bacteria 2193
113 Ga0265332_10000726 3300031238 Bacteria 20712
114 Ga0265332_10004039 3300031238 Bacteria 6975
115 Ga0265328_10002206 3300031239 Bacteria 8781
116 Ga0265328_10012307 3300031239 Bacteria 3407
117 Ga0265328_10013474 3300031239 Bacteria 3234
118 Ga0265320_10000021 3300031240 Bacteria 179499
119 Ga0265320_10009847 3300031240 Bacteria 5727
120 Ga0265320_10012647 3300031240 Bacteria 4899
121 Ga0265325_10001282 3300031241 Bacteria 17849
122 Ga0265329_10001117 3300031242 Bacteria 13192
123 Ga0265329_10001203 3300031242 Bacteria 12696
124 Ga0265329_10007784 3300031242 Bacteria 4113
125 Ga0265329_10009950 3300031242 Bacteria 3518
126 Ga0265329_10032254 3300031242 Bacteria 1697
127 Ga0265340_10000363 3300031247 Bacteria 24182
128 Ga0265339_10000092 3300031249 Bacteria 75663
129 Ga0265339_10002329 3300031249 Bacteria 13674
130 Ga0265339_10002956 3300031249 Bacteria 12008
131 Ga0265339_10020488 3300031249 Bacteria 3862
132 Ga0265339_10057903 3300031249 Bacteria 2094
133 Ga0265331_10000277 3300031250 Bacteria 56887
134 Ga0265331_10001551 3300031250 Bacteria 16850
135 Ga0265316_10000078 3300031344 Bacteria 101128
136 Ga0265316_10000093 3300031344 Bacteria 95937
137 Ga0265316_10000185 3300031344 Bacteria 71392
138 Ga0265316_10000532 3300031344 Bacteria 42948
139 Ga0265316_10000738 3300031344 Bacteria 36145
140 Ga0265316_10001183 3300031344 Bacteria 28298
141 Ga0265316_10003324 3300031344 Bacteria 16294
142 Ga0265316_10006169 3300031344 Bacteria 11499
143 Ga0265316_10010079 3300031344 Bacteria 8637
144 Ga0265316_10011042 3300031344 Bacteria 8187
145 Ga0265316_10032798 3300031344 Bacteria 4236
146 Ga0265316_10060945 3300031344 Bacteria 2932
147 Ga0265316_10079891 3300031344 Bacteria 2509
148 Ga0265316_10089735 3300031344 Bacteria 2345
149 Ga0265316_10191204 3300031344 Bacteria 1520
150 Ga0307509_10088352 3300031507 Bacteria 3182
151 Ga0265313_10000379 3300031595 Bacteria 48042
152 Ga0265313_10007371 3300031595 Bacteria 7537
153 Ga0265313_10009724 3300031595 Bacteria 6199
154 Ga0265313_10019083 3300031595 Bacteria 3832
155 Ga0265313_10024862 3300031595 Bacteria 3188
156 Ga0316579_10103836 3300031691 Bacteria 1362
157 Ga0265314_10000242 3300031711 Bacteria 80440
158 Ga0265314_10001229 3300031711 Bacteria 29307
159 Ga0265314_10001335 3300031711 Bacteria 27972
160 Ga0265342_10000123 3300031712 Bacteria 85936
161 Ga0265342_10000171 3300031712 Bacteria 71706
162 Ga0265342_10000970 3300031712 Bacteria 28494
163 Ga0265342_10002809 3300031712 Bacteria 14733
164 Ga0265342_10004010 3300031712 Bacteria 11766
165 Ga0265342_10004402 3300031712 Bacteria 11113
166 Ga0265342_10008004 3300031712 Bacteria 7654
167 Ga0265342_10050047 3300031712 Bacteria 2498
168 Ga0316576_10107446 3300031727 Bacteria 2090
169 Ga0316577_10000252 3300031733 Bacteria 18904
170 Ga0316577_10011383 3300031733 Bacteria 4817
171 Ga0316577_10141004 3300031733 Bacteria 1358
172 Ga0307510_10152583 3300033180 Bacteria 1925
173 Ga0373950_0000009 3300034818 Bacteria 379994
174 Ga0373950_0000063 3300034818 Bacteria 60052
175 Ga0373954_0005374 3300035118 Bacteria 5537
176 Ga0373956_0020925 3300035119 Bacteria 2789
177 Ga0373957_0012830 3300035120 Bacteria 2829
178 Ga0373957_0025404 3300035120 Bacteria 2134
179 Ga0373955_0074320 3300035172 Bacteria 1907
180 Ga0373933_0036913 3300035724 Bacteria 2864
181 Ga0373947_0086137 3300035725 Bacteria 1952
182 Ga0373937_0002556 3300036401 Bacteria 15123
183 Ga0373937_0029213 3300036401 Bacteria 4992
184 Ga0373937_0175379 3300036401 Bacteria 2012
185 Ga0316582_0013653 3300036647 Bacteria 4580
186 Ga0316584_0022045 3300036712 Bacteria 4641
187 Ga0316584_0030761 3300036712 Bacteria 3967
188 Ga0373925_0004612 3300037068 Bacteria 10403
189 Ga0373925_0009811 3300037068 Bacteria 6953
190 Ga0373925_0166253 3300037068 Bacteria 1740
191 Ga0400489_61493 3300039093 Bacteria 1507
192 Ga0400489_94808 3300039093 Bacteria 3652
193 Ga0436361_1043475 3300039447 Bacteria 3164
194 Ga0451802_0933033 3300041460 Bacteria 2217
195 Ga0451577_0000205 3300042876 Bacteria 123564
196 Ga0451577_0033660 3300042876 Bacteria 4620
197 Ga0451577_0134045 3300042876 Bacteria 2223
198 Ga0466969_0042801 3300044656 Bacteria 2258
199 Ga0466966_0025220 3300044684 Bacteria 3885
200 Ga0466961_0144677 3300044693 Bacteria 1487
201 Ga0453684_0000034 3300044712 Bacteria 728457
202 Ga0453684_0000281 3300044712 Bacteria 219577
203 Ga0453684_0048235 3300044712 Bacteria 5636
204 Ga0453684_0127604 3300044712 Bacteria 3059
205 Ga0466959_0012055 3300045049 Bacteria 6236
206 Ga0451576_0318419 3300045051 Bacteria 1628
207 Ga0495651_0018575 3300046462 Bacteria 5386
208 Ga0495580_0004038 3300046472 Bacteria 12386
209 Ga0495628_0245909 3300046516 Bacteria 1337
210 Ga0495630_0073763 3300046517 Bacteria 2570
211 Ga0495667_0062871 3300046559 Bacteria 2432
212 Ga0495634_0000909 3300046642 Bacteria 28234
213 Ga0495657_0097684 3300046675 Bacteria 1875
214 Ga0496100_0158710 3300048903 Bacteria 1620
215 Ga0496101_0096881 3300048904 Bacteria 2202
216 Ga0496104_0161250 3300048907 Bacteria 2151
217 Ga0496108_0034439 3300048911 Bacteria 4208
218 Ga0496109_0049971 3300048912 Bacteria 3809
219 Ga0496112_0052016 3300048915 Bacteria 4019
220 Ga0496112_0245573 3300048915 Bacteria 1742
221 Ga0496114_0000614 3300048917 Bacteria 26344
222 Ga0496114_0060755 3300048917 Bacteria 3159
223 Ga0496114_0062116 3300048917 Bacteria 3126
224 Ga0496114_0218370 3300048917 Bacteria 1673
225 Ga0496115_0123490 3300048918 Bacteria 2131
226 Ga0501034_0002340 3300049571 Bacteria 23138
227 Ga0501036_0031545 3300049572 Bacteria 4478
228 Ga0501043_0003456 3300049579 Bacteria 12972
229 Ga0501046_0001402 3300049580 Bacteria 23203
230 Ga0501047_0000011 3300049581 Bacteria 409778
231 Ga0501048_0001696 3300049582 Bacteria 16794
232 Ga0501067_0000014 3300049583 Bacteria 110569
233 Ga0501067_0098132 3300049583 Bacteria 1627
234 Ga0501070_0001677 3300049586 Bacteria 19631
235 Ga0501070_0165549 3300049586 Bacteria 1822
236 Ga0501072_0000030 3300049588 Bacteria 133181
237 Ga0501073_0000177 3300049589 Bacteria 41855
238 Ga0501073_0026928 3300049589 Bacteria 4116
239 Ga0501073_0064262 3300049589 Bacteria 2559
240 Ga0501074_0007314 3300049590 Bacteria 7982
241 Ga0501074_0049973 3300049590 Bacteria 3018
242 Ga0501077_0070112 3300049593 Bacteria 2222
243 Ga0501077_0142037 3300049593 Bacteria 1523
244 Ga0501079_0000150 3300049741 Bacteria 37871
245 Ga0501080_0002902 3300049742 Bacteria 15079
246 Ga0501083_0005768 3300049744 Bacteria 8763
247 Ga0501083_0015901 3300049744 Bacteria 5267
248 nmdc:mga0rr50_163512_c1 3300050513 Bacteria 1808
249 Ga0495601_0034731 3300053077 Bacteria 3146
250 Ga0501084_0000004 3300054114 Bacteria 267128
251 Ga0501084_0175818 3300054114 Bacteria 1807
252 Ga0501082_0003472 3300060353 Bacteria 13748
253 Ga0501082_0093894 3300060353 Bacteria 2592
254 Ga0068853_100000677
255 Ga0070658_10018193
256 Ga0070676_10015924
257 Ga0070683_100030570
258 Ga0070690_100004384
259 Ga0070680_100028332
260 Ga0070680_100035355
261 Ga0070680_100077356
262 Ga0068868_100052127
263 Ga0070689_100000013
264 Ga0070687_100001293
265 Ga0070675_100098290
266 Ga0070673_100018406
267 Ga0070673_100048722
268 Ga0070688_100035451
269 Ga0070710_10008280
270 Ga0070705_100031218
271 Ga0070681_10007942
272 Ga0070681_10236244
273 Ga0068867_100042826
274 Ga0070699_100211452
275 Ga0070679_100001992
276 Ga0070679_100044540
277 Ga0070679_100055884
278 Ga0070684_100002029
279 Ga0070684_100175492
280 Ga0068853_100179248
281 Ga0070672_100105732
282 Ga0068855_100136164
283 Ga0068856_100109991
284 Ga0068856_100176835
285 Ga0068859_100061131
286 Ga0068861_100112710
287 Ga0068858_100290074
288 Ga0068860_100195669
289 Ga0068862_100075656
290 Ga0070715_10060006
291 Ga0075428_100282237
292 Ga0068865_100006563
293 Ga0097620_100061137
294 Ga0114129_10243532
295 Ga0105237_10000025
296 Ga0105237_10094999
297 Ga0105238_10004468
298 Ga0105249_10121468
299 Ga0105239_10168583
300 Ga0157378_10037855
301 Ga0157379_10001515
302 Ga0207699_10090815
303 Ga0207645_10006589
304 Ga0207684_10101625
305 Ga0207684_10140593
306 Ga0207671_10000075
307 Ga0207671_10053003
308 Ga0207693_10151035
309 Ga0207660_10024103
310 Ga0207660_10036414
311 Ga0207652_10003596
312 Ga0207652_10009986
313 Ga0207652_10019418
314 Ga0207652_10319169
315 Ga0207681_10008078
316 Ga0207694_10004647
317 Ga0207694_10011597
318 Ga0207650_10196552
319 Ga0207659_10163179
320 Ga0207670_10000004
321 Ga0207670_10016657
322 Ga0207670_10136246
323 Ga0207691_10013855
324 Ga0207691_10119520
325 Ga0207661_10000570
326 Ga0207667_10082236
327 Ga0207651_10003254
328 Ga0207651_10023506
329 Ga0207668_10199100
330 Ga0207658_10086744
331 Ga0207639_10004128
332 Ga0207639_10103128
333 Ga0207708_10001208
334 Ga0207702_10165432
335 Ga0207641_10065038
336 Ga0207648_10007750
337 Ga0207674_10048816
338 Ga0207675_100186554
339 Ga0207698_10012093
340 Ga0268265_10279672
341 Ga0265337_1005930
342 Ga0265319_1012089
343 Ga0265334_10007845
344 Ga0265318_10000486
345 Ga0265318_10001218
346 Ga0265323_10006340
347 Ga0265323_10006836
348 Ga0265323_10014719
349 Ga0265323_10042000
350 Ga0265322_10003257
351 Ga0265322_10021639
352 Ga0265336_10006992
353 Ga0265338_10014804
354 Ga0265338_10019288
355 Ga0265338_10028725
356 Ga0265338_10104439
357 Ga0265324_10000079
358 Ga0265330_10000414
359 Ga0265330_10001118
360 Ga0265330_10001523
361 Ga0265330_10001713
362 Ga0265330_10002772
363 Ga0265330_10003818
364 Ga0265330_10009838
365 Ga0265330_10036425
366 Ga0265332_10000726
367 Ga0265332_10004039
368 Ga0265328_10002206
369 Ga0265328_10012307
370 Ga0265328_10013474
371 Ga0265320_10000021
372 Ga0265320_10009847
373 Ga0265320_10012647
374 Ga0265325_10001282
375 Ga0265329_10001117
376 Ga0265329_10001203
377 Ga0265329_10007784
378 Ga0265329_10009950
379 Ga0265329_10032254
380 Ga0265340_10000363
381 Ga0265339_10000092
382 Ga0265339_10002329
383 Ga0265339_10002956
384 Ga0265339_10020488
385 Ga0265339_10057903
386 Ga0265331_10000277
387 Ga0265331_10001551
388 Ga0265316_10000078
389 Ga0265316_10000093
390 Ga0265316_10000185
391 Ga0265316_10000532
392 Ga0265316_10000738
393 Ga0265316_10001183
394 Ga0265316_10003324
395 Ga0265316_10006169
396 Ga0265316_10010079
397 Ga0265316_10011042
398 Ga0265316_10032798
399 Ga0265316_10060945
400 Ga0265316_10079891
401 Ga0265316_10089735
402 Ga0265316_10191204
403 Ga0307509_10088352
404 Ga0265313_10000379
405 Ga0265313_10007371
406 Ga0265313_10009724
407 Ga0265313_10019083
408 Ga0265313_10024862
409 Ga0316579_10103836
410 Ga0265314_10000242
411 Ga0265314_10001229
412 Ga0265314_10001335
413 Ga0265342_10000123
414 Ga0265342_10000171
415 Ga0265342_10000970
416 Ga0265342_10002809
417 Ga0265342_10004010
418 Ga0265342_10004402
419 Ga0265342_10008004
420 Ga0265342_10050047
421 Ga0316576_10107446
422 Ga0316577_10000252
423 Ga0316577_10011383
424 Ga0316577_10141004
425 Ga0307510_10152583
426 Ga0373950_0000009
427 Ga0373950_0000063
428 Ga0373954_0005374
429 Ga0373956_0020925
430 Ga0373957_0012830
431 Ga0373957_0025404
432 Ga0373955_0074320
433 Ga0373933_0036913
434 Ga0373947_0086137
435 Ga0373937_0002556
436 Ga0373937_0029213
437 Ga0373937_0175379
438 Ga0316582_0013653
439 Ga0316584_0022045
440 Ga0316584_0030761
441 Ga0373925_0004612
442 Ga0373925_0009811
443 Ga0373925_0166253
444 Ga0400489_61493
445 Ga0400489_94808
446 Ga0436361_1043475
447 Ga0451802_0933033
448 Ga0451577_0000205
449 Ga0451577_0033660
450 Ga0451577_0134045
451 Ga0466969_0042801
452 Ga0466966_0025220
453 Ga0466961_0144677
454 Ga0453684_0000034
455 Ga0453684_0000281
456 Ga0453684_0048235
457 Ga0453684_0127604
458 Ga0466959_0012055
459 Ga0451576_0318419
460 Ga0495651_0018575
461 Ga0495580_0004038
462 Ga0495628_0245909
463 Ga0495630_0073763
464 Ga0495667_0062871
465 Ga0495634_0000909
466 Ga0495657_0097684
467 Ga0496100_0158710
468 Ga0496101_0096881
469 Ga0496104_0161250
470 Ga0496108_0034439
471 Ga0496109_0049971
472 Ga0496112_0052016
473 Ga0496112_0245573
474 Ga0496114_0000614
475 Ga0496114_0060755
476 Ga0496114_0062116
477 Ga0496114_0218370
478 Ga0496115_0123490
479 Ga0501034_0002340
480 Ga0501036_0031545
481 Ga0501043_0003456
482 Ga0501046_0001402
483 Ga0501047_0000011
484 Ga0501048_0001696
485 Ga0501067_0000014
486 Ga0501067_0098132
487 Ga0501070_0001677
488 Ga0501070_0165549
489 Ga0501072_0000030
490 Ga0501073_0000177
491 Ga0501073_0026928
492 Ga0501073_0064262
493 Ga0501074_0007314
494 Ga0501074_0049973
495 Ga0501077_0070112
496 Ga0501077_0142037
497 Ga0501079_0000150
498 Ga0501080_0002902
499 Ga0501083_0005768
500 Ga0501083_0015901
501 nmdc:mga0rr50_163512_c1
502 Ga0495601_0034731
503 Ga0501084_0000004
504 Ga0501084_0175818
505 Ga0501082_0003472
506 Ga0501082_0093894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02403

Seryl_tRNA_N

Seryl-tRNA synthetase N-terminal domain

13

118

0.97

PF00587

tRNA-synt_2b

tRNA synthetase class II core domain (G, H, P, S and T)

226

411

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ydf-assembly1.cif.gz_A crystal structure of human sars2 catalytic domain 0.927 79 383
8ffy-assembly1.cif.gz_A cryo-electron microscopy structure of human mt-serrs in complex with mt-trna(uga-tl) 0.9161 82 384
7u2b-assembly1.cif.gz_A cryo-electron microscopy structure of human mt-serrs in complex with mt-trna(gcu-tl) 0.9145 81 384
6blj-assembly2.cif.gz_A crystal structure of cytoplasmic serine-trna ligase from naegleria fowleri in complex with amp 0.9124 47 383
7ydf-assembly1.cif.gz_A crystal structure of human sars2 catalytic domain 0.9059 79 383
ID Description Score Start End Superfamily
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9642 65 383 3.30.930.10
2dq3B02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9524 65 383 3.30.930.10
1sryA02 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9498 65 383 3.30.930.10
af_I1JVB5_172_505_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9464 65 384 3.30.930.10
af_P9WFT7_105_418_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9451 66 383 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A519WVM3-F1-model_v4 deleted 0.9784 242 384
AF-A0A7V5GYJ3-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9765 239 383 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A352W1Y4-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9765 248 384 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A7Y8I8G2-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9758 246 384 GO:0004828
GO:0005524
GO:0005737
GO:0006434
AF-A0A353Y9I4-F1-model_v4 serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (Seryl-tRNA(Ser/Sec) synthetase) 0.9745 239 380 GO:0004828
GO:0005524
GO:0005737
GO:0006434

Map