F363869

General Info

Members Datasets Scaffolds Average Seq Length
253 171 506 233

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10106246|Ga0070681_101062462
Length 281
Sequence MPATVLGGSDTTRRTTPRQSRQDSDLDPQEDAVARRETKRQQDATHDVVEIPDGPPDESGLTPRARRVLEVIRESVERRGYPPSMREIGDLVGLTSSSSVSHQLASLERKGFLRRDPNRPRAIEVRHPEAGRPAHSPSHDGGGSVHDLETGSGDVRPVAAYVPLVGRIAAGGPILAEQVVEDVFPLPRQVVGEGTLFLLQVQGDSMVDAAICDGDWVVVRQEQTAENGDIVAAMIDGEATVKTFKRRDGHVWLMPHNPAYDPIPGDDATVLGHVTAVLRRI

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
70 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
80 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
81 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
101 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
110 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
113 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
114 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
115 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
127 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
130 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
131 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
132 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
133 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
134 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
146 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
147 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
148 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
149 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
150 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
151 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
155 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
156 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
157 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
158 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
159 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
162 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
163 2643221613 Oerskovia sp. Root22 Isolate Unclassified
164 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
165 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
166 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
167 2643221721 Oerskovia sp. Root918 Isolate Unclassified
168 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
169 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
170 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
171 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.28
Metatranscriptomes 2.77
Isolates 3.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.83
Nodule 0
Rhizoplane 10.67
Rhizosphere 63.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10106246 3300005458 Bacteria 2749
2 Ga0007423J48922_100614 3300003285 Bacteria 9741
3 Ga0007423J48922_100615 3300003285 Bacteria 2470
4 Ga0070658_10001826 3300005327 Bacteria 17912
5 Ga0070683_100268379 3300005329 Bacteria 1623
6 Ga0068869_100266496 3300005334 Bacteria 1373
7 Ga0070680_100023600 3300005336 Bacteria 4907
8 Ga0070680_100072935 3300005336 Bacteria 2822
9 Ga0070680_100073795 3300005336 Bacteria 2806
10 Ga0070682_100639216 3300005337 Bacteria 846
11 Ga0070660_100060797 3300005339 Bacteria 2933
12 Ga0070660_100406138 3300005339 Bacteria 1127
13 Ga0070668_100009023 3300005347 Bacteria 7407
14 Ga0070659_100000676 3300005366 Bacteria 24819
15 Ga0070667_100000252 3300005367 Bacteria 60780
16 Ga0070667_100096654 3300005367 Bacteria 2547
17 Ga0070714_100164032 3300005435 Bacteria 2012
18 Ga0070713_100051931 3300005436 Bacteria 3392
19 Ga0070678_100084201 3300005456 Bacteria 2420
20 Ga0070681_10000036 3300005458 Bacteria 97835
21 Ga0070681_10030634 3300005458 Bacteria 5399
22 Ga0070699_100147765 3300005518 Bacteria 2077
23 Ga0070679_100001482 3300005530 Bacteria 20821
24 Ga0070679_100009128 3300005530 Bacteria 9360
25 Ga0070679_100146192 3300005530 Bacteria 2342
26 Ga0070684_100063753 3300005535 Bacteria 3231
27 Ga0070684_100486369 3300005535 Bacteria 1143
28 Ga0068857_100120546 3300005577 Bacteria 2361
29 Ga0068852_100181924 3300005616 Bacteria 1977
30 Ga0068864_100314080 3300005618 Bacteria 1470
31 Ga0068860_100335782 3300005843 Bacteria 1485
32 Ga0081455_10008474 3300005937 Bacteria 10688
33 Ga0081540_1002741 3300005983 Bacteria 14333
34 Ga0075365_10024989 3300006038 Bacteria 3776
35 Ga0075365_10034732 3300006038 Bacteria 3257
36 Ga0075365_10039597 3300006038 Bacteria 3070
37 Ga0075363_100000219 3300006048 Bacteria 15877
38 Ga0075363_100001591 3300006048 Bacteria 8733
39 Ga0075363_100080381 3300006048 Bacteria 1783
40 Ga0075363_100135933 3300006048 Bacteria 1381
41 Ga0075364_10005158 3300006051 Bacteria 7574
42 Ga0075362_10071701 3300006177 Bacteria 1583
43 Ga0075369_10069050 3300006186 Bacteria 1554
44 Ga0075370_10000360 3300006353 Bacteria 16654
45 Ga0075430_100117507 3300006846 Bacteria 2217
46 Ga0068865_100523301 3300006881 Bacteria 992
47 Ga0105240_10228272 3300009093 Bacteria 2165
48 Ga0111539_10513507 3300009094 Bacteria 1396
49 Ga0105242_10401288 3300009176 Bacteria 1280
50 Ga0105237_10353723 3300009545 Bacteria 1473
51 Ga0105237_10701977 3300009545 Bacteria 1018
52 Ga0105238_10246514 3300009551 Bacteria 1764
53 Ga0105239_10234323 3300010375 Bacteria 2060
54 Ga0105246_10198837 3300011119 Bacteria 1557
55 Ga0157369_10003007 3300013105 Bacteria 20164
56 Ga0157369_10031561 3300013105 Bacteria 5832
57 Ga0157369_10107071 3300013105 Bacteria 2974
58 Ga0157369_10107875 3300013105 Bacteria 2962
59 Ga0157369_10117857 3300013105 Bacteria 2818
60 Ga0157369_10118293 3300013105 Bacteria 2812
61 Ga0157369_10171453 3300013105 Bacteria 2286
62 Ga0157374_10395217 3300013296 Bacteria 1379
63 Ga0157374_11045711 3300013296 Bacteria 836
64 Ga0163162_10425492 3300013306 Bacteria 1460
65 Ga0157372_10087335 3300013307 Bacteria 3538
66 Ga0157372_10382762 3300013307 Bacteria 1639
67 Ga0157375_10091126 3300013308 Bacteria 3109
68 Ga0163163_10022170 3300014325 Bacteria 6008
69 Ga0182008_10286461 3300014497 Bacteria 858
70 Ga0157377_10029560 3300014745 Bacteria 2960
71 Ga0157376_10819754 3300014969 Bacteria 944
72 Ga0206353_10013884 3300020082 Bacteria 2883
73 Ga0206353_10658622 3300020082 Bacteria 1887
74 Ga0206353_12052796 3300020082 Bacteria 3184
75 Ga0224712_10108397 3300022467 Bacteria 1188
76 Ga0224712_10187488 3300022467 Bacteria 935
77 Ga0209051_1000042 3300025303 Bacteria 308486
78 Ga0207705_10006419 3300025909 Bacteria 8708
79 Ga0207707_10000237 3300025912 Bacteria 59781
80 Ga0207707_10017362 3300025912 Bacteria 6274
81 Ga0207660_10004251 3300025917 Bacteria 9337
82 Ga0207660_10055254 3300025917 Bacteria 2837
83 Ga0207657_10139351 3300025919 Bacteria 1982
84 Ga0207657_10230965 3300025919 Bacteria 1480
85 Ga0207652_10000131 3300025921 Bacteria 80949
86 Ga0207652_10017334 3300025921 Bacteria 5893
87 Ga0207687_10721774 3300025927 Bacteria 847
88 Ga0207700_10136087 3300025928 Bacteria 2012
89 Ga0207664_10036544 3300025929 Bacteria 3797
90 Ga0207690_10000197 3300025932 Bacteria 47054
91 Ga0207709_10055018 3300025935 Bacteria 2456
92 Ga0207689_10437353 3300025942 Bacteria 1092
93 Ga0207661_10231874 3300025944 Bacteria 1635
94 Ga0207668_10004229 3300025972 Bacteria 8418
95 Ga0207658_10002267 3300025986 Bacteria 14226
96 Ga0207658_10099151 3300025986 Bacteria 2278
97 Ga0207674_10027071 3300026116 Bacteria 6074
98 Ga0207698_10117292 3300026142 Bacteria 2245
99 Ga0268264_10991566 3300028381 Bacteria 846
100 Ga0307515_10246122 3300028794 Bacteria 1549
101 Ga0265340_10001232 3300031247 Bacteria 14659
102 Ga0265327_10025233 3300031251 Bacteria 3471
103 Ga0307513_10000822 3300031456 Bacteria 45278
104 Ga0316579_10001096 3300031691 Bacteria 9615
105 Ga0316576_10034465 3300031727 Bacteria 3608
106 Ga0395899_0001373 3300037312 Bacteria 20884
107 Ga0395900_0104982 3300037418 Bacteria 2903
108 Ga0395900_0120279 3300037418 Bacteria 2695
109 Ga0395900_0418397 3300037418 Bacteria 1301
110 Ga0395900_0674082 3300037418 Bacteria 969
111 Ga0395898_0073930 3300037466 Bacteria 3293
112 Ga0395898_0127048 3300037466 Bacteria 2443
113 Ga0395898_0332940 3300037466 Bacteria 1448
114 Ga0395905_0083749 3300037471 Bacteria 2988
115 Ga0395905_0517406 3300037471 Bacteria 1094
116 Ga0395901_0009997 3300038443 Bacteria 9615
117 Ga0395901_0063816 3300038443 Bacteria 3834
118 Ga0451795_1552925 3300041456 Bacteria 959
119 Ga0451833_0962064 3300041491 Bacteria 1493
120 Ga0439448_0028784 3300042005 Bacteria 1756
121 Ga0466969_0063600 3300044656 Bacteria 1788
122 Ga0466972_0005773 3300044658 Bacteria 6200
123 Ga0466965_0026863 3300044683 Bacteria 2791
124 Ga0466965_0062387 3300044683 Bacteria 1864
125 Ga0466966_0027089 3300044684 Bacteria 3738
126 Ga0466961_0084252 3300044693 Bacteria 2010
127 Ga0466961_0173331 3300044693 Bacteria 1341
128 Ga0466963_0041737 3300044694 Bacteria 3010
129 Ga0466963_0125713 3300044694 Bacteria 1768
130 Ga0466963_0207184 3300044694 Bacteria 1372
131 Ga0466964_0019913 3300044706 Bacteria 2582
132 Ga0466971_0181278 3300044719 Bacteria 990
133 Ga0466957_0007748 3300044842 Bacteria 6076
134 Ga0466960_0114137 3300044901 Bacteria 1407
135 Ga0466959_0014778 3300045049 Bacteria 5683
136 Ga0466959_0181880 3300045049 Bacteria 1470
137 Ga0466958_0082119 3300045836 Bacteria 1984
138 Ga0466958_0155907 3300045836 Bacteria 1441
139 Ga0466958_0171633 3300045836 Bacteria 1373
140 Ga0466958_0403974 3300045836 Bacteria 882
141 Ga0466967_0245228 3300045976 Bacteria 1709
142 Ga0466967_0276189 3300045976 Bacteria 1611
143 Ga0466967_1062869 3300045976 Bacteria 806
144 Ga0495629_0338220 3300046459 Bacteria 1028
145 Ga0495638_0007324 3300046460 Bacteria 7927
146 Ga0495638_0031188 3300046460 Bacteria 3427
147 Ga0495641_0134988 3300046461 Bacteria 1102
148 Ga0495651_0537355 3300046462 Bacteria 744
149 Ga0495606_0004858 3300046507 Bacteria 13181
150 Ga0495608_0254248 3300046511 Bacteria 1095
151 Ga0495648_0000665 3300046524 Bacteria 36750
152 Ga0495642_0144287 3300046528 Bacteria 1028
153 Ga0495656_0146741 3300046615 Bacteria 1136
154 Ga0495611_0064694 3300046648 Bacteria 1666
155 Ga0495635_0501612 3300046663 Bacteria 799
156 Ga0495588_0174987 3300046674 Bacteria 1135
157 Ga0495647_0104788 3300046681 Bacteria 1174
158 Ga0495658_0287624 3300046683 Bacteria 1038
159 Ga0495671_0114772 3300046692 Bacteria 1315
160 Ga0495589_0253256 3300046794 Bacteria 822
161 Ga0495581_0187145 3300047315 Bacteria 1211
162 Ga0495672_0002360 3300047320 Bacteria 17452
163 Ga0495676_0014970 3300047321 Bacteria 6922
164 Ga0495676_0302781 3300047321 Bacteria 1078
165 Ga0495673_0000721 3300047469 Bacteria 31896
166 Ga0495626_0024049 3300048091 Bacteria 2991
167 Ga0495626_0130139 3300048091 Bacteria 1075
168 Ga0496100_0000025 3300048903 Bacteria 115919
169 Ga0496100_0569083 3300048903 Bacteria 878
170 Ga0496101_0000068 3300048904 Bacteria 120985
171 Ga0496102_0072983 3300048905 Bacteria 3155
172 Ga0496102_0126686 3300048905 Bacteria 2387
173 Ga0496103_0002252 3300048906 Bacteria 12214
174 Ga0496105_0016003 3300048908 Bacteria 5982
175 Ga0496105_0254051 3300048908 Bacteria 1423
176 Ga0496106_0001171 3300048909 Bacteria 19508
177 Ga0496106_0226424 3300048909 Bacteria 1492
178 Ga0496107_0000758 3300048910 Bacteria 18590
179 Ga0496107_0314227 3300048910 Bacteria 1166
180 Ga0496108_0014986 3300048911 Bacteria 6328
181 Ga0496108_0026369 3300048911 Bacteria 4793
182 Ga0496108_0052278 3300048911 Bacteria 3423
183 Ga0496109_0000175 3300048912 Bacteria 63767
184 Ga0496109_0008053 3300048912 Bacteria 8931
185 Ga0496109_0538906 3300048912 Bacteria 1101
186 Ga0496110_0012818 3300048913 Bacteria 6905
187 Ga0496110_0142667 3300048913 Bacteria 2166
188 Ga0496111_0001363 3300048914 Bacteria 13838
189 Ga0496111_0195992 3300048914 Bacteria 1501
190 Ga0496112_0009849 3300048915 Bacteria 8635
191 Ga0496114_0002796 3300048917 Bacteria 13362
192 Ga0496114_0011852 3300048917 Bacteria 6976
193 Ga0496115_0010340 3300048918 Bacteria 6968
194 Ga0496116_0001540 3300048919 Bacteria 25540
195 Ga0496117_0018428 3300048920 Bacteria 5779
196 Ga0496118_0093683 3300048921 Bacteria 2056
197 Ga0496118_0148456 3300048921 Bacteria 1471
198 Ga0496119_0001269 3300048922 Bacteria 31365
199 Ga0496119_0004090 3300048922 Bacteria 14706
200 Ga0496119_0102103 3300048922 Bacteria 1608
201 Ga0496120_0035079 3300048923 Bacteria 3000
202 Ga0496120_0041336 3300048923 Bacteria 2702
203 Ga0496121_0000023 3300048924 Bacteria 463448
204 Ga0496122_0000038 3300048925 Bacteria 295624
205 Ga0496122_0013325 3300048925 Bacteria 8057
206 Ga0496123_0050919 3300048926 Bacteria 2763
207 Ga0496124_0000014 3300048927 Bacteria 463448
208 Ga0496124_0093178 3300048927 Bacteria 2452
209 Ga0496125_0000020 3300048928 Bacteria 463448
210 Ga0496125_0000172 3300048928 Bacteria 144915
211 Ga0496126_0000023 3300048929 Bacteria 463448
212 Ga0496126_0181420 3300048929 Bacteria 1788
213 Ga0501047_0000018 3300049581 Bacteria 274180
214 Ga0501047_0077955 3300049581 Bacteria 3187
215 Ga0501047_0082243 3300049581 Bacteria 3095
216 Ga0501067_0175060 3300049583 Bacteria 1195
217 Ga0501070_0044378 3300049586 Bacteria 3699
218 Ga0501070_0061604 3300049586 Bacteria 3108
219 Ga0501044_0021520 3300049823 Bacteria 6878
220 nmdc:mga03683_266298_c1 3300050489 Bacteria 798
221 nmdc:mga03n38_137910_c1 3300050490 Bacteria 1216
222 nmdc:mga03n38_2739_c1 3300050490 Bacteria 5520
223 nmdc:mga00v17_181234_c1 3300050491 Bacteria 1359
224 nmdc:mga00v17_224793_c1 3300050491 Bacteria 1216
225 nmdc:mga0yw44_13440_c1 3300050492 Bacteria 4311
226 nmdc:mga0yw44_20614_c1 3300050492 Bacteria 3662
227 nmdc:mga0yw44_341799_c1 3300050492 Bacteria 1007
228 nmdc:mga0k408_38843_c2 3300050493 Bacteria 2023
229 nmdc:mga06z11_3012_c1 3300050494 Bacteria 6480
230 nmdc:mga06z11_82978_c1 3300050494 Bacteria 1724
231 nmdc:mga07m45_34638_c1 3300050496 Bacteria 2807
232 nmdc:mga0qj67_41820_c1 3300050509 Bacteria 3606
233 nmdc:mga0sz30_10719_c1 3300050516 Bacteria 3518
234 Ga0500610_0081343 3300053079 Bacteria 1688
235 Ga0500556_0001815 3300053104 Bacteria 7837
236 Ga0500556_0037093 3300053104 Bacteria 1694
237 Ga0500562_001873 3300053108 Bacteria 5276
238 Ga0500568_0079002 3300053139 Bacteria 1251
239 Ga0500577_0058622 3300053142 Bacteria 1473
240 Ga0500604_0028823 3300053151 Bacteria 1614
241 Ga0500616_0001107 3300053153 Bacteria 27884
242 Ga0500616_0003061 3300053153 Bacteria 13149
243 Ga0500633_0157421 3300053160 Bacteria 852
244 2643850637 2643221567 Bacteria 4163945
245 2644081745 2643221613 Bacteria 4622396
246 2644134391 2643221624 Bacteria 4384879
247 2644506511 2643221690 Bacteria 4654705
248 2644526571 2643221694 Bacteria 4392972
249 2644665212 2643221721 Bacteria 4486924
250 2644671237 2643221722 Bacteria 4247614
251 2738666731 2738541264 Bacteria 5935393
252 2739145575 2738541356 Bacteria 5935017
253 2935891376 2935890801 Bacteria 4593001
254 Ga0070681_10106246
255 Ga0007423J48922_100614
256 Ga0007423J48922_100615
257 Ga0070658_10001826
258 Ga0070683_100268379
259 Ga0068869_100266496
260 Ga0070680_100023600
261 Ga0070680_100072935
262 Ga0070680_100073795
263 Ga0070682_100639216
264 Ga0070660_100060797
265 Ga0070660_100406138
266 Ga0070668_100009023
267 Ga0070659_100000676
268 Ga0070667_100000252
269 Ga0070667_100096654
270 Ga0070714_100164032
271 Ga0070713_100051931
272 Ga0070678_100084201
273 Ga0070681_10000036
274 Ga0070681_10030634
275 Ga0070699_100147765
276 Ga0070679_100001482
277 Ga0070679_100009128
278 Ga0070679_100146192
279 Ga0070684_100063753
280 Ga0070684_100486369
281 Ga0068857_100120546
282 Ga0068852_100181924
283 Ga0068864_100314080
284 Ga0068860_100335782
285 Ga0081455_10008474
286 Ga0081540_1002741
287 Ga0075365_10024989
288 Ga0075365_10034732
289 Ga0075365_10039597
290 Ga0075363_100000219
291 Ga0075363_100001591
292 Ga0075363_100080381
293 Ga0075363_100135933
294 Ga0075364_10005158
295 Ga0075362_10071701
296 Ga0075369_10069050
297 Ga0075370_10000360
298 Ga0075430_100117507
299 Ga0068865_100523301
300 Ga0105240_10228272
301 Ga0111539_10513507
302 Ga0105242_10401288
303 Ga0105237_10353723
304 Ga0105237_10701977
305 Ga0105238_10246514
306 Ga0105239_10234323
307 Ga0105246_10198837
308 Ga0157369_10003007
309 Ga0157369_10031561
310 Ga0157369_10107071
311 Ga0157369_10107875
312 Ga0157369_10117857
313 Ga0157369_10118293
314 Ga0157369_10171453
315 Ga0157374_10395217
316 Ga0157374_11045711
317 Ga0163162_10425492
318 Ga0157372_10087335
319 Ga0157372_10382762
320 Ga0157375_10091126
321 Ga0163163_10022170
322 Ga0182008_10286461
323 Ga0157377_10029560
324 Ga0157376_10819754
325 Ga0206353_10013884
326 Ga0206353_10658622
327 Ga0206353_12052796
328 Ga0224712_10108397
329 Ga0224712_10187488
330 Ga0209051_1000042
331 Ga0207705_10006419
332 Ga0207707_10000237
333 Ga0207707_10017362
334 Ga0207660_10004251
335 Ga0207660_10055254
336 Ga0207657_10139351
337 Ga0207657_10230965
338 Ga0207652_10000131
339 Ga0207652_10017334
340 Ga0207687_10721774
341 Ga0207700_10136087
342 Ga0207664_10036544
343 Ga0207690_10000197
344 Ga0207709_10055018
345 Ga0207689_10437353
346 Ga0207661_10231874
347 Ga0207668_10004229
348 Ga0207658_10002267
349 Ga0207658_10099151
350 Ga0207674_10027071
351 Ga0207698_10117292
352 Ga0268264_10991566
353 Ga0307515_10246122
354 Ga0265340_10001232
355 Ga0265327_10025233
356 Ga0307513_10000822
357 Ga0316579_10001096
358 Ga0316576_10034465
359 Ga0395899_0001373
360 Ga0395900_0104982
361 Ga0395900_0120279
362 Ga0395900_0418397
363 Ga0395900_0674082
364 Ga0395898_0073930
365 Ga0395898_0127048
366 Ga0395898_0332940
367 Ga0395905_0083749
368 Ga0395905_0517406
369 Ga0395901_0009997
370 Ga0395901_0063816
371 Ga0451795_1552925
372 Ga0451833_0962064
373 Ga0439448_0028784
374 Ga0466969_0063600
375 Ga0466972_0005773
376 Ga0466965_0026863
377 Ga0466965_0062387
378 Ga0466966_0027089
379 Ga0466961_0084252
380 Ga0466961_0173331
381 Ga0466963_0041737
382 Ga0466963_0125713
383 Ga0466963_0207184
384 Ga0466964_0019913
385 Ga0466971_0181278
386 Ga0466957_0007748
387 Ga0466960_0114137
388 Ga0466959_0014778
389 Ga0466959_0181880
390 Ga0466958_0082119
391 Ga0466958_0155907
392 Ga0466958_0171633
393 Ga0466958_0403974
394 Ga0466967_0245228
395 Ga0466967_0276189
396 Ga0466967_1062869
397 Ga0495629_0338220
398 Ga0495638_0007324
399 Ga0495638_0031188
400 Ga0495641_0134988
401 Ga0495651_0537355
402 Ga0495606_0004858
403 Ga0495608_0254248
404 Ga0495648_0000665
405 Ga0495642_0144287
406 Ga0495656_0146741
407 Ga0495611_0064694
408 Ga0495635_0501612
409 Ga0495588_0174987
410 Ga0495647_0104788
411 Ga0495658_0287624
412 Ga0495671_0114772
413 Ga0495589_0253256
414 Ga0495581_0187145
415 Ga0495672_0002360
416 Ga0495676_0014970
417 Ga0495676_0302781
418 Ga0495673_0000721
419 Ga0495626_0024049
420 Ga0495626_0130139
421 Ga0496100_0000025
422 Ga0496100_0569083
423 Ga0496101_0000068
424 Ga0496102_0072983
425 Ga0496102_0126686
426 Ga0496103_0002252
427 Ga0496105_0016003
428 Ga0496105_0254051
429 Ga0496106_0001171
430 Ga0496106_0226424
431 Ga0496107_0000758
432 Ga0496107_0314227
433 Ga0496108_0014986
434 Ga0496108_0026369
435 Ga0496108_0052278
436 Ga0496109_0000175
437 Ga0496109_0008053
438 Ga0496109_0538906
439 Ga0496110_0012818
440 Ga0496110_0142667
441 Ga0496111_0001363
442 Ga0496111_0195992
443 Ga0496112_0009849
444 Ga0496114_0002796
445 Ga0496114_0011852
446 Ga0496115_0010340
447 Ga0496116_0001540
448 Ga0496117_0018428
449 Ga0496118_0093683
450 Ga0496118_0148456
451 Ga0496119_0001269
452 Ga0496119_0004090
453 Ga0496119_0102103
454 Ga0496120_0035079
455 Ga0496120_0041336
456 Ga0496121_0000023
457 Ga0496122_0000038
458 Ga0496122_0013325
459 Ga0496123_0050919
460 Ga0496124_0000014
461 Ga0496124_0093178
462 Ga0496125_0000020
463 Ga0496125_0000172
464 Ga0496126_0000023
465 Ga0496126_0181420
466 Ga0501047_0000018
467 Ga0501047_0077955
468 Ga0501047_0082243
469 Ga0501067_0175060
470 Ga0501070_0044378
471 Ga0501070_0061604
472 Ga0501044_0021520
473 nmdc:mga03683_266298_c1
474 nmdc:mga03n38_137910_c1
475 nmdc:mga03n38_2739_c1
476 nmdc:mga00v17_181234_c1
477 nmdc:mga00v17_224793_c1
478 nmdc:mga0yw44_13440_c1
479 nmdc:mga0yw44_20614_c1
480 nmdc:mga0yw44_341799_c1
481 nmdc:mga0k408_38843_c2
482 nmdc:mga06z11_3012_c1
483 nmdc:mga06z11_82978_c1
484 nmdc:mga07m45_34638_c1
485 nmdc:mga0qj67_41820_c1
486 nmdc:mga0sz30_10719_c1
487 Ga0500610_0081343
488 Ga0500556_0001815
489 Ga0500556_0037093
490 Ga0500562_001873
491 Ga0500568_0079002
492 Ga0500577_0058622
493 Ga0500604_0028823
494 Ga0500616_0001107
495 Ga0500616_0003061
496 Ga0500633_0157421
497 2643850637
498 2644081745
499 2644134391
500 2644506511
501 2644526571
502 2644665212
503 2644671237
504 2738666731
505 2739145575
506 2935891376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01726

LexA_DNA_bind

LexA DNA binding domain

58

122

0.98

PF00717

Peptidase_S24

Peptidase S24-like

163

275

0.97

Map