F363826

General Info

Members Datasets Scaffolds Average Seq Length
253 188 506 124

Family's Representative Sequence

Representative Sequence 3300005365|Ga0070688_100605192|Ga0070688_1006051922
Length 121
Sequence LNILLWVLQGLLAVHTAMGAVWKLSHSEQTLPSLRAIPHGAWLALSVFELLCSVGLVIPAVHAASAGLAPVAAACIGAEMLLFIGLHLRSGHQEKGPVRYWLVVAALCAFVAYGRFVLVPL

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
144 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
176 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 5.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 1.98
Rhizosphere 91.7
Stem 0
Stem Tuber 0
Unclassified 11.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100605192 3300005365 Unclassified 839
2 Ga0065712_10205897 3300005290 Bacteria 1091
3 Ga0065712_10489245 3300005290 Unclassified 657
4 Ga0065715_10406283 3300005293 Bacteria 875
5 Ga0065707_10298958 3300005295 Bacteria 1008
6 Ga0070658_10134783 3300005327 Bacteria 2059
7 Ga0070658_10649493 3300005327 Bacteria 915
8 Ga0070676_10005332 3300005328 Bacteria 6845
9 Ga0070683_100389627 3300005329 Bacteria 1328
10 Ga0070690_100291244 3300005330 Bacteria 1168
11 Ga0070670_100102363 3300005331 Unclassified 2466
12 Ga0070670_100467334 3300005331 Unclassified 1119
13 Ga0068869_100025497 3300005334 Bacteria 4106
14 Ga0068869_100040579 3300005334 Bacteria 3329
15 Ga0070666_10189523 3300005335 Bacteria 1445
16 Ga0068868_100023256 3300005338 Bacteria 4689
17 Ga0070660_100726363 3300005339 Unclassified 833
18 Ga0070689_100172432 3300005340 Bacteria 1753
19 Ga0070668_100026673 3300005347 Bacteria 4385
20 Ga0070669_100039810 3300005353 Bacteria 3416
21 Ga0070675_100055548 3300005354 Bacteria 3260
22 Ga0070671_100102683 3300005355 Bacteria 2399
23 Ga0070671_100510650 3300005355 Unclassified 1034
24 Ga0070673_100026013 3300005364 Bacteria 4316
25 Ga0070673_101318966 3300005364 Bacteria 678
26 Ga0070688_100543802 3300005365 Unclassified 882
27 Ga0070709_10205005 3300005434 Bacteria 1399
28 Ga0070694_100094211 3300005444 Bacteria 2106
29 Ga0070663_100033534 3300005455 Bacteria 3548
30 Ga0070663_100128309 3300005455 Bacteria 1923
31 Ga0070663_101381887 3300005455 Unclassified 623
32 Ga0070678_100000729 3300005456 Bacteria 16373
33 Ga0070662_100716295 3300005457 Bacteria 847
34 Ga0070662_101122853 3300005457 Bacteria 675
35 Ga0070681_10542299 3300005458 Unclassified 1077
36 Ga0068867_100076035 3300005459 Bacteria 2520
37 Ga0070684_100015429 3300005535 Bacteria 6221
38 Ga0070684_100632431 3300005535 Bacteria 996
39 Ga0068853_100018825 3300005539 Bacteria 5718
40 Ga0070672_100033808 3300005543 Bacteria 3875
41 Ga0070672_100036784 3300005543 Bacteria 3732
42 Ga0070695_100561122 3300005545 Bacteria 891
43 Ga0070696_101921209 3300005546 Bacteria 513
44 Ga0070665_100009120 3300005548 Bacteria 10049
45 Ga0070704_100066607 3300005549 Bacteria 2598
46 Ga0068855_100014598 3300005563 Bacteria 9460
47 Ga0070664_100024221 3300005564 Bacteria 5020
48 Ga0068856_100059232 3300005614 Unclassified 3782
49 Ga0068859_101046328 3300005617 Bacteria 897
50 Ga0068861_100414252 3300005719 Bacteria 1199
51 Ga0068858_100104287 3300005842 Bacteria 2646
52 Ga0068862_100247764 3300005844 Unclassified 1622
53 Ga0081539_10102468 3300005985 Bacteria 1456
54 Ga0070717_10886514 3300006028 Bacteria 812
55 Ga0075364_10020288 3300006051 Bacteria 4179
56 Ga0070715_10433109 3300006163 Bacteria 738
57 Ga0070712_100577029 3300006175 Bacteria 950
58 Ga0075367_10335776 3300006178 Bacteria 953
59 Ga0075428_100012626 3300006844 Bacteria 9393
60 Ga0075428_100101070 3300006844 Bacteria 3144
61 Ga0075428_100148037 3300006844 Bacteria 2552
62 Ga0075430_100131981 3300006846 Bacteria 2082
63 Ga0075433_10003670 3300006852 Bacteria 11871
64 Ga0075433_10032048 3300006852 Bacteria 4499
65 Ga0075434_100082227 3300006871 Bacteria 3218
66 Ga0075434_100226520 3300006871 Bacteria 1889
67 Ga0075429_100017383 3300006880 Bacteria 6218
68 Ga0068865_100114193 3300006881 Bacteria 1997
69 Ga0068865_100465698 3300006881 Bacteria 1048
70 Ga0097620_101046382 3300006931 Bacteria 897
71 Ga0075435_100148372 3300007076 Bacteria 1971
72 Ga0105240_10053504 3300009093 Bacteria 5067
73 Ga0111539_10267952 3300009094 Bacteria 1988
74 Ga0111539_10425474 3300009094 Bacteria 1547
75 Ga0111539_11459363 3300009094 Bacteria 793
76 Ga0105247_10377126 3300009101 Unclassified 1005
77 Ga0114129_10013929 3300009147 Bacteria 11456
78 Ga0114129_10037406 3300009147 Bacteria 6852
79 Ga0114129_10255701 3300009147 Bacteria 2350
80 Ga0114129_12441371 3300009147 Bacteria 626
81 Ga0105241_10019412 3300009174 Bacteria 5012
82 Ga0105242_10182563 3300009176 Bacteria 1852
83 Ga0105242_10193617 3300009176 Bacteria 1802
84 Ga0105242_10392491 3300009176 Bacteria 1293
85 Ga0105242_12290673 3300009176 Bacteria 586
86 Ga0105248_13237848 3300009177 Bacteria 518
87 Ga0105237_10202407 3300009545 Unclassified 1986
88 Ga0105237_10531895 3300009545 Bacteria 1182
89 Ga0105237_11063366 3300009545 Unclassified 816
90 Ga0105249_10248917 3300009553 Bacteria 1761
91 Ga0105249_10389202 3300009553 Bacteria 1422
92 Ga0105249_12278522 3300009553 Bacteria 614
93 Ga0105239_10015677 3300010375 Bacteria 8388
94 Ga0105239_10907475 3300010375 Bacteria 1011
95 Ga0105246_10062877 3300011119 Bacteria 2587
96 Ga0157373_10028357 3300013100 Bacteria 4038
97 Ga0157371_10399960 3300013102 Bacteria 1005
98 Ga0157370_10227585 3300013104 Bacteria 1726
99 Ga0157370_10310437 3300013104 Bacteria 1455
100 Ga0157369_10026314 3300013105 Bacteria 6455
101 Ga0157374_10045402 3300013296 Bacteria 4067
102 Ga0157378_10000033 3300013297 Bacteria 120764
103 Ga0157378_11611618 3300013297 Unclassified 695
104 Ga0157378_11898905 3300013297 Bacteria 644
105 Ga0163162_12184055 3300013306 Bacteria 635
106 Ga0157372_10006740 3300013307 Bacteria 12213
107 Ga0182008_10123336 3300014497 Unclassified 1288
108 Ga0157377_11373115 3300014745 Bacteria 556
109 Ga0163161_10029670 3300017792 Bacteria 3888
110 Ga0207656_10413744 3300025321 Bacteria 679
111 Ga0207680_10538046 3300025903 Bacteria 834
112 Ga0207699_10332693 3300025906 Bacteria 1068
113 Ga0207645_10001890 3300025907 Bacteria 16904
114 Ga0207705_10027757 3300025909 Bacteria 4037
115 Ga0207705_10563812 3300025909 Bacteria 885
116 Ga0207707_10143584 3300025912 Bacteria 2086
117 Ga0207695_10017798 3300025913 Bacteria 8245
118 Ga0207695_10356312 3300025913 Bacteria 1350
119 Ga0207671_10030635 3300025914 Bacteria 4011
120 Ga0207671_10177696 3300025914 Unclassified 1655
121 Ga0207693_10321267 3300025915 Bacteria 1212
122 Ga0207663_10459296 3300025916 Bacteria 983
123 Ga0207657_10013441 3300025919 Bacteria 8030
124 Ga0207649_10008797 3300025920 Bacteria 5509
125 Ga0207649_10751024 3300025920 Bacteria 759
126 Ga0207681_10020936 3300025923 Bacteria 4151
127 Ga0207659_10468908 3300025926 Bacteria 1062
128 Ga0207700_10605728 3300025928 Bacteria 975
129 Ga0207644_10080678 3300025931 Bacteria 2403
130 Ga0207690_10271013 3300025932 Bacteria 1319
131 Ga0207706_10495165 3300025933 Bacteria 1055
132 Ga0207686_10744716 3300025934 Bacteria 782
133 Ga0207686_10827935 3300025934 Bacteria 743
134 Ga0207670_10125405 3300025936 Bacteria 1873
135 Ga0207670_10457070 3300025936 Bacteria 1030
136 Ga0207691_10020349 3300025940 Bacteria 6272
137 Ga0207691_10065397 3300025940 Bacteria 3292
138 Ga0207689_10017678 3300025942 Bacteria 6026
139 Ga0207689_10043163 3300025942 Bacteria 3727
140 Ga0207661_10298217 3300025944 Bacteria 1444
141 Ga0207661_11688681 3300025944 Bacteria 578
142 Ga0207679_10831559 3300025945 Bacteria 843
143 Ga0207667_10063417 3300025949 Bacteria 3861
144 Ga0207667_10076526 3300025949 Unclassified 3472
145 Ga0207651_10028582 3300025960 Bacteria 3520
146 Ga0207651_12160426 3300025960 Bacteria 500
147 Ga0207668_10030690 3300025972 Bacteria 3534
148 Ga0207703_10064365 3300026035 Bacteria 3010
149 Ga0207639_10019469 3300026041 Bacteria 4841
150 Ga0207648_10173701 3300026089 Bacteria 1905
151 Ga0207676_10522465 3300026095 Bacteria 1130
152 Ga0207674_10021320 3300026116 Bacteria 6981
153 Ga0207683_10002366 3300026121 Bacteria 16474
154 Ga0207428_10411579 3300027907 Bacteria 989
155 Ga0268266_10039813 3300028379 Bacteria 4004
156 Ga0265337_1019858 3300028556 Unclassified 2112
157 Ga0265338_10034845 3300028800 Unclassified 4853
158 Ga0265338_10369464 3300028800 Bacteria 1028
159 Ga0265324_10042437 3300029957 Unclassified 1572
160 Ga0265762_1081195 3300030760 Bacteria 695
161 Ga0265760_10071898 3300031090 Bacteria 1062
162 Ga0265320_10241387 3300031240 Unclassified 802
163 Ga0265340_10028084 3300031247 Bacteria 2832
164 Ga0265316_10279484 3300031344 Bacteria 1220
165 Ga0265316_10376440 3300031344 Bacteria 1025
166 Ga0265316_10673466 3300031344 Bacteria 730
167 Ga0307408_101027822 3300031548 Bacteria 761
168 Ga0265313_10018310 3300031595 Unclassified 3937
169 Ga0307516_10001150 3300031730 Bacteria 36999
170 Ga0307516_10044196 3300031730 Bacteria 4409
171 Ga0307516_10152423 3300031730 Unclassified 2070
172 Ga0307405_10300079 3300031731 Bacteria 1218
173 Ga0307413_11436795 3300031824 Bacteria 608
174 Ga0307410_10593210 3300031852 Bacteria 923
175 Ga0307416_100265577 3300032002 Bacteria 1681
176 Ga0307415_100126251 3300032126 Bacteria 1929
177 Ga0395900_1138684 3300037418 Bacteria 697
178 Ga0395900_1183379 3300037418 Bacteria 680
179 Ga0395905_0164543 3300037471 Bacteria 2084
180 Ga0395901_0926264 3300038443 Bacteria 852
181 Ga0395901_1138371 3300038443 Bacteria 749
182 Ga0436365_1264057 3300039437 Bacteria 1293
183 Ga0436365_1817443 3300039437 Unclassified 826
184 Ga0436362_1105423 3300039453 Bacteria 950
185 Ga0451800_0256090 3300041459 Bacteria 619
186 Ga0451800_0686219 3300041459 Unclassified 757
187 Ga0451807_0001790 3300041486 Bacteria 711
188 Ga0451837_0206844 3300041494 Bacteria 2050
189 Ga0451853_3654769 3300041512 Unclassified 514
190 Ga0439446_0346543 3300042156 Bacteria 529
191 Ga0451577_1462389 3300042876 Unclassified 605
192 Ga0451576_0085495 3300045051 Bacteria 3281
193 Ga0451576_0631233 3300045051 Bacteria 1126
194 Ga0495658_0179532 3300046683 Bacteria 1313
195 Ga0496109_0553575 3300048912 Bacteria 1085
196 Ga0496114_0530398 3300048917 Bacteria 1041
197 Ga0496117_0027859 3300048920 Bacteria 4388
198 Ga0496118_0004248 3300048921 Bacteria 17157
199 Ga0496121_0043517 3300048924 Bacteria 3888
200 Ga0496126_0741513 3300048929 Bacteria 759
201 Ga0501034_0003074 3300049571 Bacteria 19249
202 Ga0501034_0056400 3300049571 Bacteria 3953
203 Ga0501040_0403947 3300049576 Bacteria 981
204 Ga0501040_1019598 3300049576 Bacteria 600
205 Ga0501041_0420194 3300049577 Bacteria 848
206 Ga0501043_0417597 3300049579 Bacteria 1012
207 Ga0501043_0616343 3300049579 Bacteria 800
208 Ga0501046_0178962 3300049580 Bacteria 1587
209 Ga0501047_0045243 3300049581 Bacteria 4255
210 Ga0501068_0332717 3300049584 Bacteria 975
211 Ga0501070_0170217 3300049586 Bacteria 1794
212 Ga0501071_0336120 3300049587 Bacteria 1148
213 Ga0501073_0090592 3300049589 Bacteria 2125
214 Ga0501075_0392414 3300049591 Bacteria 1058
215 Ga0501075_1024901 3300049591 Bacteria 627
216 Ga0501076_0579260 3300049592 Bacteria 926
217 Ga0501077_0748332 3300049593 Bacteria 628
218 Ga0501235_028648 3300049669 Bacteria 1252
219 Ga0501239_068365 3300049672 Bacteria 548
220 Ga0501080_0010014 3300049742 Bacteria 8665
221 Ga0501080_1111065 3300049742 Bacteria 682
222 Ga0501044_0899150 3300049823 Bacteria 760
223 Ga0501045_0116989 3300049824 Bacteria 1979
224 Ga0501204_079493 3300049850 Unclassified 555
225 nmdc:mga00v17_54809_c1 3300050491 Bacteria 2433
226 nmdc:mga06z11_907291_c1 3300050494 Bacteria 537
227 nmdc:mga05p37_201773_c1 3300050507 Bacteria 2408
228 nmdc:mga05p37_236923_c1 3300050507 Bacteria 2196
229 nmdc:mga05p37_97178_c1 3300050507 Bacteria 3628
230 nmdc:mga09592_24730_c1 3300050508 Bacteria 4966
231 nmdc:mga0qj67_1460584_c1 3300050509 Bacteria 527
232 nmdc:mga0qj67_1578677_c1 3300050509 Bacteria 504
233 nmdc:mga06r32_37006_c1 3300050510 Bacteria 4616
234 nmdc:mga08y16_450211_c1 3300050511 Bacteria 1313
235 nmdc:mga08y16_487850_c1 3300050511 Bacteria 1253
236 nmdc:mga0n895_48689_c1 3300050512 Bacteria 4150
237 nmdc:mga0n895_50554_c1 3300050512 Bacteria 4075
238 nmdc:mga0a205_29322_c1 3300050515 Bacteria 5265
239 nmdc:mga0a205_33_c1 3300050515 Bacteria 66467
240 Ga0500568_0001165 3300053139 Bacteria 17570
241 Ga0587066_072630 3300059490 Bacteria 728
242 Ga0587070_084880 3300059491 Bacteria 702
243 Ga0587073_0174572 3300059492 Bacteria 626
244 Ga0587086_066333 3300059507 Bacteria 612
245 Ga0587089_033148 3300059509 Bacteria 770
246 Ga0587091_079302 3300059511 Bacteria 734
247 Ga0587109_073960 3300059624 Bacteria 742
248 Ga0587115_038265 3300059626 Bacteria 740
249 Ga0587067_090470 3300059640 Bacteria 692
250 Ga0587075_144016 3300059644 Unclassified 511
251 Ga0587079_077534 3300059647 Bacteria 754
252 Ga0587071_070993 3300060344 Bacteria 758
253 Ga0501082_0613439 3300060353 Bacteria 952
254 Ga0070688_100605192
255 Ga0065712_10205897
256 Ga0065712_10489245
257 Ga0065715_10406283
258 Ga0065707_10298958
259 Ga0070658_10134783
260 Ga0070658_10649493
261 Ga0070676_10005332
262 Ga0070683_100389627
263 Ga0070690_100291244
264 Ga0070670_100102363
265 Ga0070670_100467334
266 Ga0068869_100025497
267 Ga0068869_100040579
268 Ga0070666_10189523
269 Ga0068868_100023256
270 Ga0070660_100726363
271 Ga0070689_100172432
272 Ga0070668_100026673
273 Ga0070669_100039810
274 Ga0070675_100055548
275 Ga0070671_100102683
276 Ga0070671_100510650
277 Ga0070673_100026013
278 Ga0070673_101318966
279 Ga0070688_100543802
280 Ga0070709_10205005
281 Ga0070694_100094211
282 Ga0070663_100033534
283 Ga0070663_100128309
284 Ga0070663_101381887
285 Ga0070678_100000729
286 Ga0070662_100716295
287 Ga0070662_101122853
288 Ga0070681_10542299
289 Ga0068867_100076035
290 Ga0070684_100015429
291 Ga0070684_100632431
292 Ga0068853_100018825
293 Ga0070672_100033808
294 Ga0070672_100036784
295 Ga0070695_100561122
296 Ga0070696_101921209
297 Ga0070665_100009120
298 Ga0070704_100066607
299 Ga0068855_100014598
300 Ga0070664_100024221
301 Ga0068856_100059232
302 Ga0068859_101046328
303 Ga0068861_100414252
304 Ga0068858_100104287
305 Ga0068862_100247764
306 Ga0081539_10102468
307 Ga0070717_10886514
308 Ga0075364_10020288
309 Ga0070715_10433109
310 Ga0070712_100577029
311 Ga0075367_10335776
312 Ga0075428_100012626
313 Ga0075428_100101070
314 Ga0075428_100148037
315 Ga0075430_100131981
316 Ga0075433_10003670
317 Ga0075433_10032048
318 Ga0075434_100082227
319 Ga0075434_100226520
320 Ga0075429_100017383
321 Ga0068865_100114193
322 Ga0068865_100465698
323 Ga0097620_101046382
324 Ga0075435_100148372
325 Ga0105240_10053504
326 Ga0111539_10267952
327 Ga0111539_10425474
328 Ga0111539_11459363
329 Ga0105247_10377126
330 Ga0114129_10013929
331 Ga0114129_10037406
332 Ga0114129_10255701
333 Ga0114129_12441371
334 Ga0105241_10019412
335 Ga0105242_10182563
336 Ga0105242_10193617
337 Ga0105242_10392491
338 Ga0105242_12290673
339 Ga0105248_13237848
340 Ga0105237_10202407
341 Ga0105237_10531895
342 Ga0105237_11063366
343 Ga0105249_10248917
344 Ga0105249_10389202
345 Ga0105249_12278522
346 Ga0105239_10015677
347 Ga0105239_10907475
348 Ga0105246_10062877
349 Ga0157373_10028357
350 Ga0157371_10399960
351 Ga0157370_10227585
352 Ga0157370_10310437
353 Ga0157369_10026314
354 Ga0157374_10045402
355 Ga0157378_10000033
356 Ga0157378_11611618
357 Ga0157378_11898905
358 Ga0163162_12184055
359 Ga0157372_10006740
360 Ga0182008_10123336
361 Ga0157377_11373115
362 Ga0163161_10029670
363 Ga0207656_10413744
364 Ga0207680_10538046
365 Ga0207699_10332693
366 Ga0207645_10001890
367 Ga0207705_10027757
368 Ga0207705_10563812
369 Ga0207707_10143584
370 Ga0207695_10017798
371 Ga0207695_10356312
372 Ga0207671_10030635
373 Ga0207671_10177696
374 Ga0207693_10321267
375 Ga0207663_10459296
376 Ga0207657_10013441
377 Ga0207649_10008797
378 Ga0207649_10751024
379 Ga0207681_10020936
380 Ga0207659_10468908
381 Ga0207700_10605728
382 Ga0207644_10080678
383 Ga0207690_10271013
384 Ga0207706_10495165
385 Ga0207686_10744716
386 Ga0207686_10827935
387 Ga0207670_10125405
388 Ga0207670_10457070
389 Ga0207691_10020349
390 Ga0207691_10065397
391 Ga0207689_10017678
392 Ga0207689_10043163
393 Ga0207661_10298217
394 Ga0207661_11688681
395 Ga0207679_10831559
396 Ga0207667_10063417
397 Ga0207667_10076526
398 Ga0207651_10028582
399 Ga0207651_12160426
400 Ga0207668_10030690
401 Ga0207703_10064365
402 Ga0207639_10019469
403 Ga0207648_10173701
404 Ga0207676_10522465
405 Ga0207674_10021320
406 Ga0207683_10002366
407 Ga0207428_10411579
408 Ga0268266_10039813
409 Ga0265337_1019858
410 Ga0265338_10034845
411 Ga0265338_10369464
412 Ga0265324_10042437
413 Ga0265762_1081195
414 Ga0265760_10071898
415 Ga0265320_10241387
416 Ga0265340_10028084
417 Ga0265316_10279484
418 Ga0265316_10376440
419 Ga0265316_10673466
420 Ga0307408_101027822
421 Ga0265313_10018310
422 Ga0307516_10001150
423 Ga0307516_10044196
424 Ga0307516_10152423
425 Ga0307405_10300079
426 Ga0307413_11436795
427 Ga0307410_10593210
428 Ga0307416_100265577
429 Ga0307415_100126251
430 Ga0395900_1138684
431 Ga0395900_1183379
432 Ga0395905_0164543
433 Ga0395901_0926264
434 Ga0395901_1138371
435 Ga0436365_1264057
436 Ga0436365_1817443
437 Ga0436362_1105423
438 Ga0451800_0256090
439 Ga0451800_0686219
440 Ga0451807_0001790
441 Ga0451837_0206844
442 Ga0451853_3654769
443 Ga0439446_0346543
444 Ga0451577_1462389
445 Ga0451576_0085495
446 Ga0451576_0631233
447 Ga0495658_0179532
448 Ga0496109_0553575
449 Ga0496114_0530398
450 Ga0496117_0027859
451 Ga0496118_0004248
452 Ga0496121_0043517
453 Ga0496126_0741513
454 Ga0501034_0003074
455 Ga0501034_0056400
456 Ga0501040_0403947
457 Ga0501040_1019598
458 Ga0501041_0420194
459 Ga0501043_0417597
460 Ga0501043_0616343
461 Ga0501046_0178962
462 Ga0501047_0045243
463 Ga0501068_0332717
464 Ga0501070_0170217
465 Ga0501071_0336120
466 Ga0501073_0090592
467 Ga0501075_0392414
468 Ga0501075_1024901
469 Ga0501076_0579260
470 Ga0501077_0748332
471 Ga0501235_028648
472 Ga0501239_068365
473 Ga0501080_0010014
474 Ga0501080_1111065
475 Ga0501044_0899150
476 Ga0501045_0116989
477 Ga0501204_079493
478 nmdc:mga00v17_54809_c1
479 nmdc:mga06z11_907291_c1
480 nmdc:mga05p37_201773_c1
481 nmdc:mga05p37_236923_c1
482 nmdc:mga05p37_97178_c1
483 nmdc:mga09592_24730_c1
484 nmdc:mga0qj67_1460584_c1
485 nmdc:mga0qj67_1578677_c1
486 nmdc:mga06r32_37006_c1
487 nmdc:mga08y16_450211_c1
488 nmdc:mga08y16_487850_c1
489 nmdc:mga0n895_48689_c1
490 nmdc:mga0n895_50554_c1
491 nmdc:mga0a205_29322_c1
492 nmdc:mga0a205_33_c1
493 Ga0500568_0001165
494 Ga0587066_072630
495 Ga0587070_084880
496 Ga0587073_0174572
497 Ga0587086_066333
498 Ga0587089_033148
499 Ga0587091_079302
500 Ga0587109_073960
501 Ga0587115_038265
502 Ga0587067_090470
503 Ga0587075_144016
504 Ga0587079_077534
505 Ga0587071_070993
506 Ga0501082_0613439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13564

DoxX_2

DoxX-like family

7

112

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.964 80 118
5uhq-assembly1.cif.gz_A structure of a semisweet q20a mutant 0.6694 50 122
4qnc-assembly1.cif.gz_A crystal structure of a semisweet in an occluded state 0.6404 50 118
8a3k-assembly1.cif.gz_UNK x-ray crystal structure of a de novo designed single-chain antiparallel 4-helix coiled-coil bundle, sc-apcc-4 0.6284 5 115
8piv-assembly1.cif.gz_F homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.6143 1 118
ID Description Score Start End Superfamily
af_C0H546_170_249_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.9183 68 119 1.20.1280.20
af_O44620_4_91_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8992 73 114 1.20.1280.290
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.8757 73 119 1.10.287.1080
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.8516 3 120 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.826 3 120 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A2V7RI09-F1-model_v4 DoxX family protein 0.9839 1 117 GO:0016020
AF-A0A239LH11-F1-model_v4 DoxX-like family protein 0.9796 1 122 GO:0016020
AF-A0A2V7GID9-F1-model_v4 DoxX family protein 0.9767 1 119 GO:0016020
AF-A0A411HNJ8-F1-model_v4 DoxX family protein 0.9743 1 122 GO:0016020
AF-A0A239LH11-F1-model_v4 DoxX-like family protein 0.9718 1 122 GO:0016020

Map