F363474

General Info

Members Datasets Scaffolds Average Seq Length
252 185 504 215

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0003785|Ga0495603_0003785_6622_7404
Length 260
Sequence MAWTRNDMAARAAAELRDGDYVNLGIGLPTLVPEFVPAGVHVVLQSENGIMGVGPYPAETEVDADLINAGKETVTVIPGASFFDSALSFGMIRGGHIDAAILGAMQVSAQGDLANWMVPGKMVKGMGGAMDLVHGARRVVVVMEHTAKDGSPKIVAECSLPLTGRACVHRIITDLGVLDITANGLVLVETAPGVSTQEILDRTAAPVRVPAPATGRLTSPPPHSPAGQVSLDSPRPSGEPTLSHDLPGNHRPHHPHEEPR

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
7 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
8 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
9 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
29 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
30 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
31 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
32 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
33 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
34 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
35 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
36 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
37 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
40 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
41 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
42 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
43 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
44 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
45 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
46 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
47 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
48 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
54 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
60 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
61 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
62 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
65 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
66 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
67 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
68 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
69 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
70 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
73 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
81 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
82 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
83 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
84 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
87 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
98 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
127 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
128 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
129 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
130 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
133 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
134 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
135 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
138 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
139 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
140 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
142 2508501039 Frankia saprophytica CN3 Isolate Nodule
143 2517572101 Frankia sp. DC12 Isolate Nodule
144 2527291629 Frankia sp. BMG5.23 Isolate Nodule
145 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
146 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
147 2576861822 Frankia sp. CeD Isolate Nodule
148 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
149 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
150 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
151 2619618881 Frankia sp. ACN1ag Isolate Unclassified
152 2619619003 Frankia sp. CpI1-P Isolate Nodule
153 2626541554 Frankia sp. AvcI.1 Isolate Nodule
154 2671180195 Frankia sp. CcI49 Isolate Nodule
155 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
156 2687453737 Frankia sp. BMG5.36 Isolate Nodule
157 2710264753 Frankia sp. KB5 Isolate Nodule
158 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
159 2773857922 Frankia sp. CcI49 Isolate Nodule
160 2773857924 Frankia sp. CgIS1 Isolate Nodule
161 2808606448 Streptomyces sp. 193411 Isolate Unclassified
162 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
163 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
164 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
165 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
166 2867428634 Streptomyces sp. RP5T Isolate Unclassified
167 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
168 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
169 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
170 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
171 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
172 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
173 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
174 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
175 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
176 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
177 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
178 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
179 637000116 Frankia casuarinae CcI3 Isolate Nodule
180 8002775197 Frankia nepalensis CN7 Isolate Nodule
181 8002784119 Frankia sp. AgB1.9 Isolate Nodule
182 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
183 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
184 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
185 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.76
Metatranscriptomes 1.59
Isolates 18.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.13
Nodule 7.14
Rhizoplane 4.76
Rhizosphere 58.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0003785 3300046455 Bacteria 9000
2 JGI24735J21928_10054251 3300002067 Bacteria 1155
3 JGI25160J50197_1000293 3300003354 Bacteria 35871
4 Ga0006562J51391_1053283 3300003578 Bacteria 7172
5 Ga0006562J51391_1053287 3300003578 Bacteria 5400
6 Ga0006562J51391_1246357 3300003578 Bacteria 60288
7 Ga0006562J51391_1246358 3300003578 Bacteria 60288
8 Ga0070714_100117835 3300005435 Bacteria 2359
9 Ga0068859_100000944 3300005617 Bacteria 29749
10 Ga0068859_100280973 3300005617 Bacteria 1757
11 Ga0068864_100448778 3300005618 Bacteria 1233
12 Ga0068863_100000648 3300005841 Bacteria 35309
13 Ga0068863_100005880 3300005841 Bacteria 12022
14 Ga0068858_100567203 3300005842 Bacteria 1099
15 Ga0068862_100000182 3300005844 Bacteria 69071
16 Ga0081455_10016485 3300005937 Bacteria 7131
17 Ga0075364_10141743 3300006051 Bacteria 1617
18 Ga0075364_10506629 3300006051 Bacteria 825
19 Ga0075370_10149035 3300006353 Bacteria 1371
20 Ga0097620_100000944 3300006931 Bacteria 29749
21 Ga0097620_100280962 3300006931 Bacteria 1757
22 Ga0111539_10025656 3300009094 Bacteria 7223
23 Ga0105248_10000039 3300009177 Bacteria 179700
24 Ga0105249_10018667 3300009553 Bacteria 6176
25 Ga0163163_10094349 3300014325 Bacteria 3010
26 Ga0157379_10054714 3300014968 Bacteria 3566
27 Ga0207426_1000759 3300025302 Bacteria 35923
28 Ga0207711_10000151 3300025941 Bacteria 74004
29 Ga0207712_10004372 3300025961 Bacteria 8928
30 Ga0207641_10001957 3300026088 Bacteria 19733
31 Ga0207641_10002264 3300026088 Bacteria 17942
32 Ga0207676_10691706 3300026095 Bacteria 987
33 Ga0268265_10000177 3300028380 Bacteria 76484
34 Ga0307517_10112204 3300028786 Bacteria 2066
35 Ga0307515_10022820 3300028794 Bacteria 11011
36 Ga0307515_10037813 3300028794 Bacteria 7743
37 Ga0307512_10011626 3300030522 Bacteria 8332
38 Ga0307512_10096699 3300030522 Bacteria 2023
39 Ga0265339_10084095 3300031249 Bacteria 1677
40 Ga0265331_10051191 3300031250 Bacteria 1977
41 Ga0307513_10000929 3300031456 Bacteria 42318
42 Ga0307513_10014126 3300031456 Bacteria 9772
43 Ga0307513_10052039 3300031456 Bacteria 4412
44 Ga0265313_10032871 3300031595 Bacteria 2643
45 Ga0265313_10124955 3300031595 Bacteria 1119
46 Ga0307508_10011362 3300031616 Bacteria 8143
47 Ga0307508_10030778 3300031616 Bacteria 4849
48 Ga0307508_10038559 3300031616 Bacteria 4294
49 Ga0307514_10018049 3300031649 Bacteria 5796
50 Ga0307514_10071097 3300031649 Bacteria 2611
51 Ga0307514_10354248 3300031649 Bacteria 780
52 Ga0307510_10308366 3300033180 Bacteria 1043
53 Ga0395899_0003287 3300037312 Bacteria 12816
54 Ga0395900_0329244 3300037418 Bacteria 1506
55 Ga0436364_0462558 3300037853 Bacteria 1816
56 Ga0436360_0772233 3300039438 Bacteria 747
57 Ga0436363_1059263 3300039450 Bacteria 2542
58 Ga0436362_0151657 3300039453 Bacteria 1304
59 Ga0466969_0017455 3300044656 Bacteria 3746
60 Ga0466969_0021640 3300044656 Bacteria 3324
61 Ga0466972_0001272 3300044658 Bacteria 12174
62 Ga0466965_0022949 3300044683 Bacteria 3011
63 Ga0466965_0023814 3300044683 Bacteria 2958
64 Ga0466966_0012574 3300044684 Bacteria 5609
65 Ga0466966_0056583 3300044684 Bacteria 2480
66 Ga0466961_0011279 3300044693 Bacteria 5714
67 Ga0466961_0019725 3300044693 Bacteria 4338
68 Ga0466963_0025645 3300044694 Bacteria 3762
69 Ga0466971_0186917 3300044719 Bacteria 975
70 Ga0466957_0143100 3300044842 Bacteria 1542
71 Ga0466959_0030279 3300045049 Bacteria 4008
72 Ga0466959_0046569 3300045049 Bacteria 3190
73 Ga0466967_0477729 3300045976 Bacteria 1221
74 Ga0466967_0650493 3300045976 Bacteria 1042
75 Ga0495627_023459 3300046453 Bacteria 2021
76 Ga0495603_0001770 3300046455 Bacteria 12730
77 Ga0495603_0003285 3300046455 Bacteria 9632
78 Ga0495629_0000794 3300046459 Bacteria 25498
79 Ga0495629_0004558 3300046459 Bacteria 10365
80 Ga0495629_0103276 3300046459 Bacteria 1988
81 Ga0495638_0060025 3300046460 Bacteria 2353
82 Ga0495638_0084578 3300046460 Bacteria 1920
83 Ga0495638_0271375 3300046460 Bacteria 926
84 Ga0495651_0100850 3300046462 Bacteria 2150
85 Ga0495662_0011805 3300046476 Bacteria 4268
86 Ga0495585_0031872 3300046492 Bacteria 2990
87 Ga0495585_0045715 3300046492 Bacteria 2443
88 Ga0495585_0086347 3300046492 Bacteria 1695
89 Ga0495594_0000151 3300046499 Bacteria 33013
90 Ga0495594_0001039 3300046499 Bacteria 14456
91 Ga0495594_0081644 3300046499 Bacteria 1805
92 Ga0495583_0044218 3300046506 Bacteria 2068
93 Ga0495628_0110513 3300046516 Bacteria 2114
94 Ga0495643_0009517 3300046522 Bacteria 6036
95 Ga0495666_0085985 3300046526 Bacteria 1485
96 Ga0495666_0145619 3300046526 Bacteria 1103
97 Ga0495640_0023990 3300046533 Bacteria 4437
98 Ga0495622_0048965 3300046557 Bacteria 1962
99 Ga0495667_0020393 3300046559 Bacteria 4474
100 Ga0495634_0084020 3300046642 Bacteria 2077
101 Ga0495625_0012314 3300046660 Bacteria 6936
102 Ga0495588_0026242 3300046674 Bacteria 2907
103 Ga0495646_0117393 3300046680 Bacteria 1508
104 Ga0495613_0068572 3300046689 Bacteria 2586
105 Ga0495670_0014955 3300046691 Bacteria 3819
106 Ga0495649_0262602 3300046694 Bacteria 885
107 Ga0495589_0003033 3300046794 Bacteria 9221
108 Ga0495660_0065654 3300046810 Bacteria 1936
109 Ga0495660_0096626 3300046810 Bacteria 1526
110 Ga0495581_0264400 3300047315 Bacteria 1006
111 Ga0495604_0007853 3300047317 Bacteria 8446
112 Ga0495674_0146453 3300047319 Bacteria 1982
113 Ga0495676_0001501 3300047321 Bacteria 20170
114 Ga0495676_0008973 3300047321 Bacteria 9126
115 Ga0495676_0010923 3300047321 Bacteria 8208
116 Ga0495680_0170817 3300047322 Bacteria 1574
117 Ga0495683_0037814 3300047323 Bacteria 2445
118 Ga0495687_102406 3300047443 Bacteria 1071
119 Ga0495679_082733 3300047446 Bacteria 909
120 Ga0495685_000092 3300047447 Bacteria 32494
121 Ga0495685_000783 3300047447 Bacteria 9728
122 Ga0495681_0008206 3300047470 Bacteria 6567
123 Ga0495686_0035385 3300047472 Bacteria 3211
124 Ga0495593_0003912 3300047673 Bacteria 8898
125 Ga0496100_0045840 3300048903 Bacteria 2807
126 Ga0496100_0473146 3300048903 Bacteria 963
127 Ga0496101_0049274 3300048904 Bacteria 3029
128 Ga0496102_0000244 3300048905 Bacteria 71365
129 Ga0496103_0000437 3300048906 Bacteria 36022
130 Ga0496104_0007754 3300048907 Bacteria 9509
131 Ga0496105_0042561 3300048908 Bacteria 3744
132 Ga0496106_0099563 3300048909 Bacteria 2253
133 Ga0496108_0336233 3300048911 Bacteria 1317
134 Ga0496109_0335293 3300048912 Bacteria 1428
135 Ga0496115_0376553 3300048918 Bacteria 1155
136 Ga0496116_0000354 3300048919 Bacteria 72118
137 Ga0496116_0000581 3300048919 Bacteria 48839
138 Ga0496117_0000410 3300048920 Bacteria 72120
139 Ga0496117_0003015 3300048920 Bacteria 20223
140 Ga0496118_0000114 3300048921 Bacteria 148007
141 Ga0496118_0001766 3300048921 Bacteria 31294
142 Ga0496118_0004625 3300048921 Bacteria 16162
143 Ga0496119_0000311 3300048922 Bacteria 68041
144 Ga0496119_0003646 3300048922 Bacteria 15813
145 Ga0496120_0002125 3300048923 Bacteria 21178
146 Ga0496120_0108675 3300048923 Bacteria 1453
147 Ga0496121_0098558 3300048924 Bacteria 2261
148 Ga0496124_0164368 3300048927 Bacteria 1726
149 Ga0496125_0072371 3300048928 Bacteria 2686
150 Ga0496125_0099809 3300048928 Bacteria 2142
151 Ga0496126_0001059 3300048929 Bacteria 46430
152 Ga0496126_0157249 3300048929 Bacteria 1945
153 Ga0496126_0204762 3300048929 Bacteria 1664
154 Ga0501031_0051283 3300049568 Bacteria 2687
155 Ga0501033_0001052 3300049570 Bacteria 25193
156 Ga0501033_0165607 3300049570 Bacteria 1589
157 Ga0501034_0004383 3300049571 Bacteria 15724
158 Ga0501034_0292041 3300049571 Bacteria 1568
159 Ga0501036_0000549 3300049572 Bacteria 26914
160 Ga0501036_0024978 3300049572 Bacteria 5039
161 Ga0501038_0002475 3300049574 Bacteria 17183
162 Ga0501038_0007844 3300049574 Bacteria 9838
163 Ga0501038_0017883 3300049574 Bacteria 6404
164 Ga0501038_0149053 3300049574 Bacteria 1908
165 Ga0501038_0350654 3300049574 Bacteria 1149
166 Ga0501039_0002928 3300049575 Bacteria 12774
167 Ga0501039_0022126 3300049575 Bacteria 4879
168 Ga0501042_0011825 3300049578 Bacteria 5897
169 Ga0501042_0371032 3300049578 Bacteria 1036
170 Ga0501043_0000335 3300049579 Bacteria 42702
171 Ga0501043_0008226 3300049579 Bacteria 8220
172 Ga0501047_0004002 3300049581 Bacteria 13849
173 Ga0501047_0392541 3300049581 Bacteria 1221
174 Ga0501048_0009484 3300049582 Bacteria 7306
175 Ga0501070_0002341 3300049586 Bacteria 16632
176 Ga0501073_0063113 3300049589 Bacteria 2584
177 Ga0501073_0077624 3300049589 Bacteria 2311
178 Ga0501074_0000455 3300049590 Bacteria 24576
179 Ga0501074_0038274 3300049590 Bacteria 3476
180 Ga0501080_0018201 3300049742 Bacteria 6503
181 Ga0501035_0001747 3300049822 Bacteria 21950
182 Ga0501035_0013198 3300049822 Bacteria 7625
183 Ga0501044_0046187 3300049823 Bacteria 4510
184 Ga0501044_0203121 3300049823 Bacteria 1939
185 Ga0501045_0325019 3300049824 Bacteria 1145
186 nmdc:mga00v17_44228_c1 3300050491 Bacteria 1666
187 nmdc:mga08y16_200831_c1 3300050511 Bacteria 2066
188 Ga0500610_0203688 3300053079 Bacteria 951
189 Ga0500578_0028806 3300053086 Bacteria 3566
190 Ga0500654_039189 3300053099 Bacteria 2716
191 Ga0500569_009272 3300053109 Bacteria 2281
192 Ga0500628_001038 3300053129 Bacteria 4842
193 Ga0500652_004036 3300053131 Bacteria 4502
194 Ga0500658_0009512 3300053134 Bacteria 3582
195 Ga0500561_0002013 3300053137 Bacteria 3373
196 Ga0500579_040355 3300053143 Bacteria 2940
197 Ga0500600_0000869 3300053149 Bacteria 15007
198 Ga0500600_0058603 3300053149 Bacteria 2156
199 Ga0500603_087199 3300053150 Bacteria 912
200 Ga0500616_0012296 3300053153 Bacteria 5010
201 Ga0500633_0033243 3300053160 Bacteria 1681
202 Ga0500634_0027504 3300053161 Bacteria 3098
203 Ga0500656_020528 3300053732 Bacteria 815
204 Ga0500587_000526 3300053739 Bacteria 4674
205 Ga0466962_0005172 3300061719 Bacteria 6279
206 2508673727 2508501039 Bacteria 9978592
207 2517764227 2517572101 Bacteria 6884336
208 2528215658 2527291629 Bacteria 5267418
209 2546951174 2546825537 Bacteria 5389291
210 2547412115 2547132111 Bacteria 8013147
211 2579750845 2576861822 Bacteria 5004595
212 2579854334 2579778521 Bacteria 7624758
213 2585311998 2582581314 Bacteria 11452267
214 2588108891 2585428157 Bacteria 3018951
215 2619858973 2619618881 Bacteria 7521104
216 2620350508 2619619003 Bacteria 7619552
217 2626639388 2626541554 Bacteria 7741902
218 2671834404 2671180195 Bacteria 9757215
219 2671834748 2671180195 Bacteria 9757215
220 2676201506 2675902999 Bacteria 9438463
221 2689964495 2687453737 Bacteria 11203906
222 2710605254 2710264753 Bacteria 5455564
223 2774846082 2773857921 Bacteria 9435764
224 2774852560 2773857922 Bacteria 9757215
225 2774852904 2773857922 Bacteria 9757215
226 2774866845 2773857924 Bacteria 5256821
227 2809228831 2808606448 Bacteria 8656184
228 2809235484 2808606448 Bacteria 8656184
229 2811846298 2808606982 Bacteria 7791042
230 2812354471 2811994879 Bacteria 9313447
231 2819698660 2818991463 Bacteria 7948711
232 2852636091 2852635781 Bacteria 8251373
233 2867434634 2867428634 Bacteria 9590268
234 2877677809 2877676314 Bacteria 9512378
235 2946071231 2946064051 Bacteria 8957905
236 2947225512 2947224130 Bacteria 9938529
237 2954009716 2954002825 Bacteria 9173742
238 2954713095 2954711539 Bacteria 10867210
239 2954723055 2954721474 Bacteria 10456478
240 2954738775 2954731030 Bacteria 10243860
241 2954741962 2954740390 Bacteria 10229294
242 2954757632 2954749733 Bacteria 10366972
243 2954760939 2954759201 Bacteria 9358192
244 3006324432 3006321560 Bacteria 8247479
245 3006500525 3006493962 Bacteria 8825450
246 637879833 637000116 Bacteria 5433628
247 8002781880 8002775197 Bacteria 10728764
248 8002790884 8002784119 Bacteria 9788632
249 8008488480 8008485437 Bacteria 7198341
250 8023624142 8023623736 Bacteria 8593882
251 8025527473 8025524527 Bacteria 7197316
252 8056834447 8056829672 Bacteria 9045328
253 Ga0495603_0003785
254 JGI24735J21928_10054251
255 JGI25160J50197_1000293
256 Ga0006562J51391_1053283
257 Ga0006562J51391_1053287
258 Ga0006562J51391_1246357
259 Ga0006562J51391_1246358
260 Ga0070714_100117835
261 Ga0068859_100000944
262 Ga0068859_100280973
263 Ga0068864_100448778
264 Ga0068863_100000648
265 Ga0068863_100005880
266 Ga0068858_100567203
267 Ga0068862_100000182
268 Ga0081455_10016485
269 Ga0075364_10141743
270 Ga0075364_10506629
271 Ga0075370_10149035
272 Ga0097620_100000944
273 Ga0097620_100280962
274 Ga0111539_10025656
275 Ga0105248_10000039
276 Ga0105249_10018667
277 Ga0163163_10094349
278 Ga0157379_10054714
279 Ga0207426_1000759
280 Ga0207711_10000151
281 Ga0207712_10004372
282 Ga0207641_10001957
283 Ga0207641_10002264
284 Ga0207676_10691706
285 Ga0268265_10000177
286 Ga0307517_10112204
287 Ga0307515_10022820
288 Ga0307515_10037813
289 Ga0307512_10011626
290 Ga0307512_10096699
291 Ga0265339_10084095
292 Ga0265331_10051191
293 Ga0307513_10000929
294 Ga0307513_10014126
295 Ga0307513_10052039
296 Ga0265313_10032871
297 Ga0265313_10124955
298 Ga0307508_10011362
299 Ga0307508_10030778
300 Ga0307508_10038559
301 Ga0307514_10018049
302 Ga0307514_10071097
303 Ga0307514_10354248
304 Ga0307510_10308366
305 Ga0395899_0003287
306 Ga0395900_0329244
307 Ga0436364_0462558
308 Ga0436360_0772233
309 Ga0436363_1059263
310 Ga0436362_0151657
311 Ga0466969_0017455
312 Ga0466969_0021640
313 Ga0466972_0001272
314 Ga0466965_0022949
315 Ga0466965_0023814
316 Ga0466966_0012574
317 Ga0466966_0056583
318 Ga0466961_0011279
319 Ga0466961_0019725
320 Ga0466963_0025645
321 Ga0466971_0186917
322 Ga0466957_0143100
323 Ga0466959_0030279
324 Ga0466959_0046569
325 Ga0466967_0477729
326 Ga0466967_0650493
327 Ga0495627_023459
328 Ga0495603_0001770
329 Ga0495603_0003285
330 Ga0495629_0000794
331 Ga0495629_0004558
332 Ga0495629_0103276
333 Ga0495638_0060025
334 Ga0495638_0084578
335 Ga0495638_0271375
336 Ga0495651_0100850
337 Ga0495662_0011805
338 Ga0495585_0031872
339 Ga0495585_0045715
340 Ga0495585_0086347
341 Ga0495594_0000151
342 Ga0495594_0001039
343 Ga0495594_0081644
344 Ga0495583_0044218
345 Ga0495628_0110513
346 Ga0495643_0009517
347 Ga0495666_0085985
348 Ga0495666_0145619
349 Ga0495640_0023990
350 Ga0495622_0048965
351 Ga0495667_0020393
352 Ga0495634_0084020
353 Ga0495625_0012314
354 Ga0495588_0026242
355 Ga0495646_0117393
356 Ga0495613_0068572
357 Ga0495670_0014955
358 Ga0495649_0262602
359 Ga0495589_0003033
360 Ga0495660_0065654
361 Ga0495660_0096626
362 Ga0495581_0264400
363 Ga0495604_0007853
364 Ga0495674_0146453
365 Ga0495676_0001501
366 Ga0495676_0008973
367 Ga0495676_0010923
368 Ga0495680_0170817
369 Ga0495683_0037814
370 Ga0495687_102406
371 Ga0495679_082733
372 Ga0495685_000092
373 Ga0495685_000783
374 Ga0495681_0008206
375 Ga0495686_0035385
376 Ga0495593_0003912
377 Ga0496100_0045840
378 Ga0496100_0473146
379 Ga0496101_0049274
380 Ga0496102_0000244
381 Ga0496103_0000437
382 Ga0496104_0007754
383 Ga0496105_0042561
384 Ga0496106_0099563
385 Ga0496108_0336233
386 Ga0496109_0335293
387 Ga0496115_0376553
388 Ga0496116_0000354
389 Ga0496116_0000581
390 Ga0496117_0000410
391 Ga0496117_0003015
392 Ga0496118_0000114
393 Ga0496118_0001766
394 Ga0496118_0004625
395 Ga0496119_0000311
396 Ga0496119_0003646
397 Ga0496120_0002125
398 Ga0496120_0108675
399 Ga0496121_0098558
400 Ga0496124_0164368
401 Ga0496125_0072371
402 Ga0496125_0099809
403 Ga0496126_0001059
404 Ga0496126_0157249
405 Ga0496126_0204762
406 Ga0501031_0051283
407 Ga0501033_0001052
408 Ga0501033_0165607
409 Ga0501034_0004383
410 Ga0501034_0292041
411 Ga0501036_0000549
412 Ga0501036_0024978
413 Ga0501038_0002475
414 Ga0501038_0007844
415 Ga0501038_0017883
416 Ga0501038_0149053
417 Ga0501038_0350654
418 Ga0501039_0002928
419 Ga0501039_0022126
420 Ga0501042_0011825
421 Ga0501042_0371032
422 Ga0501043_0000335
423 Ga0501043_0008226
424 Ga0501047_0004002
425 Ga0501047_0392541
426 Ga0501048_0009484
427 Ga0501070_0002341
428 Ga0501073_0063113
429 Ga0501073_0077624
430 Ga0501074_0000455
431 Ga0501074_0038274
432 Ga0501080_0018201
433 Ga0501035_0001747
434 Ga0501035_0013198
435 Ga0501044_0046187
436 Ga0501044_0203121
437 Ga0501045_0325019
438 nmdc:mga00v17_44228_c1
439 nmdc:mga08y16_200831_c1
440 Ga0500610_0203688
441 Ga0500578_0028806
442 Ga0500654_039189
443 Ga0500569_009272
444 Ga0500628_001038
445 Ga0500652_004036
446 Ga0500658_0009512
447 Ga0500561_0002013
448 Ga0500579_040355
449 Ga0500600_0000869
450 Ga0500600_0058603
451 Ga0500603_087199
452 Ga0500616_0012296
453 Ga0500633_0033243
454 Ga0500634_0027504
455 Ga0500656_020528
456 Ga0500587_000526
457 Ga0466962_0005172
458 2508673727
459 2517764227
460 2528215658
461 2546951174
462 2547412115
463 2579750845
464 2579854334
465 2585311998
466 2588108891
467 2619858973
468 2620350508
469 2626639388
470 2671834404
471 2671834748
472 2676201506
473 2689964495
474 2710605254
475 2774846082
476 2774852560
477 2774852904
478 2774866845
479 2809228831
480 2809235484
481 2811846298
482 2812354471
483 2819698660
484 2852636091
485 2867434634
486 2877677809
487 2946071231
488 2947225512
489 2954009716
490 2954713095
491 2954723055
492 2954738775
493 2954741962
494 2954757632
495 2954760939
496 3006324432
497 3006500525
498 637879833
499 8002781880
500 8002790884
501 8008488480
502 8023624142
503 8025527473
504 8056834447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

202

0.96

PF13336

AcetylCoA_hyd_C

Acetyl-CoA hydrolase/transferase C-terminal domain

90

188

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dbn-assembly1.cif.gz_D crystal structure of atoda complex 0.8229 5 210
3cdk-assembly1.cif.gz_B crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.8091 5 210
1ooy-assembly1.cif.gz_A succinyl-coa:3-ketoacid coa transferase from pig heart 0.8051 5 210
3rrl-assembly1.cif.gz_D complex structure of 3-oxoadipate coa-transferase subunit a and b from helicobacter pylori 26695 0.8031 8 210
3dlx-assembly1.cif.gz_A crystal structure of human 3-oxoacid coa transferase 1 0.8027 5 210
ID Description Score Start End Superfamily
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8229 5 210 3.40.1080.10
af_P32144_74_134_3.30.750.70 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;4-hydroxybutyrate coenzyme 0.8058 5 46 3.30.750.70
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.802 5 210 3.40.1080.10
5dbnD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7901 5 210 3.40.1080.10
2nrcB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.7807 5 210 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A841BKR9-F1-model_v4 3-oxoacid CoA-transferase B subunit 1.001 140 209 GO:0008410
AF-A0A855HNL5-F1-model_v4 deleted 0.9983 141 209
AF-X0UX17-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9967 142 210 GO:0008410
AF-A0A5N5E4H1-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9934 131 208 GO:0008410
AF-A0A3C1GTP1-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.9932 135 208 GO:0047569

Map